data_6KE2 # _entry.id 6KE2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6KE2 pdb_00006ke2 10.2210/pdb6ke2/pdb WWPDB D_1300012809 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6KE2 _pdbx_database_status.recvd_initial_deposition_date 2019-07-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, W.M.' 1 ? 'Wang, H.F.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem.Commun.(Camb.)' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1364-548X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 55 _citation.language ? _citation.page_first 12344 _citation.page_last 12347 _citation.title 'AB loop engineered ferritin nanocages for drug loading under benign experimental conditions.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/c9cc05247j _citation.pdbx_database_id_PubMed 31556881 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, W.' 1 ? primary 'Wang, L.' 2 ? primary 'Li, G.' 3 ? primary 'Zhao, G.' 4 ? primary 'Zhao, X.' 5 ? primary 'Wang, H.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6KE2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 182.448 _cell.length_a_esd ? _cell.length_b 182.448 _cell.length_b_esd ? _cell.length_c 182.448 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 96 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6KE2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ferritin heavy chain' 21024.428 1 1.16.3.1 Deletion,K84Q ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 5 ? ? ? ? 3 non-polymer syn 'FE (III) ION' 55.845 2 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 5 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 6 water nat water 18.015 260 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ferritin H subunit,Cell proliferation-inducing gene 15 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIF LQDIQKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAP ESGLAEYLFDKHTLGDSDNES ; _entity_poly.pdbx_seq_one_letter_code_can ;MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIF LQDIQKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAP ESGLAEYLFDKHTLGDSDNES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 THR n 1 4 ALA n 1 5 SER n 1 6 THR n 1 7 SER n 1 8 GLN n 1 9 VAL n 1 10 ARG n 1 11 GLN n 1 12 ASN n 1 13 TYR n 1 14 HIS n 1 15 GLN n 1 16 ASP n 1 17 SER n 1 18 GLU n 1 19 ALA n 1 20 ALA n 1 21 ILE n 1 22 ASN n 1 23 ARG n 1 24 GLN n 1 25 ILE n 1 26 ASN n 1 27 LEU n 1 28 GLU n 1 29 LEU n 1 30 TYR n 1 31 ALA n 1 32 SER n 1 33 TYR n 1 34 VAL n 1 35 TYR n 1 36 LEU n 1 37 SER n 1 38 MET n 1 39 SER n 1 40 TYR n 1 41 TYR n 1 42 PHE n 1 43 ASP n 1 44 ARG n 1 45 VAL n 1 46 ALA n 1 47 LEU n 1 48 LYS n 1 49 ASN n 1 50 PHE n 1 51 ALA n 1 52 LYS n 1 53 TYR n 1 54 PHE n 1 55 LEU n 1 56 HIS n 1 57 GLN n 1 58 SER n 1 59 HIS n 1 60 GLU n 1 61 GLU n 1 62 ARG n 1 63 GLU n 1 64 HIS n 1 65 ALA n 1 66 GLU n 1 67 LYS n 1 68 LEU n 1 69 MET n 1 70 LYS n 1 71 LEU n 1 72 GLN n 1 73 ASN n 1 74 GLN n 1 75 ARG n 1 76 GLY n 1 77 GLY n 1 78 ARG n 1 79 ILE n 1 80 PHE n 1 81 LEU n 1 82 GLN n 1 83 ASP n 1 84 ILE n 1 85 GLN n 1 86 LYS n 1 87 PRO n 1 88 ASP n 1 89 CYS n 1 90 ASP n 1 91 ASP n 1 92 TRP n 1 93 GLU n 1 94 SER n 1 95 GLY n 1 96 LEU n 1 97 ASN n 1 98 ALA n 1 99 MET n 1 100 GLU n 1 101 CYS n 1 102 ALA n 1 103 LEU n 1 104 HIS n 1 105 LEU n 1 106 GLU n 1 107 LYS n 1 108 ASN n 1 109 VAL n 1 110 ASN n 1 111 GLN n 1 112 SER n 1 113 LEU n 1 114 LEU n 1 115 GLU n 1 116 LEU n 1 117 HIS n 1 118 LYS n 1 119 LEU n 1 120 ALA n 1 121 THR n 1 122 ASP n 1 123 LYS n 1 124 ASN n 1 125 ASP n 1 126 PRO n 1 127 HIS n 1 128 LEU n 1 129 CYS n 1 130 ASP n 1 131 PHE n 1 132 ILE n 1 133 GLU n 1 134 THR n 1 135 HIS n 1 136 TYR n 1 137 LEU n 1 138 ASN n 1 139 GLU n 1 140 GLN n 1 141 VAL n 1 142 LYS n 1 143 ALA n 1 144 ILE n 1 145 LYS n 1 146 GLU n 1 147 LEU n 1 148 GLY n 1 149 ASP n 1 150 HIS n 1 151 VAL n 1 152 THR n 1 153 ASN n 1 154 LEU n 1 155 ARG n 1 156 LYS n 1 157 MET n 1 158 GLY n 1 159 ALA n 1 160 PRO n 1 161 GLU n 1 162 SER n 1 163 GLY n 1 164 LEU n 1 165 ALA n 1 166 GLU n 1 167 TYR n 1 168 LEU n 1 169 PHE n 1 170 ASP n 1 171 LYS n 1 172 HIS n 1 173 THR n 1 174 LEU n 1 175 GLY n 1 176 ASP n 1 177 SER n 1 178 ASP n 1 179 ASN n 1 180 GLU n 1 181 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 181 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FRIH_HUMAN _struct_ref.pdbx_db_accession P02794 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGR IFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMG APESGLAEYLFDKHTLGDSDNES ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6KE2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 181 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02794 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 181 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6KE2 ? A ? ? UNP P02794 ASP 45 deletion ? 1 1 6KE2 ? A ? ? UNP P02794 ASP 46 deletion ? 2 1 6KE2 GLN A 85 ? UNP P02794 LYS 87 'engineered mutation' 85 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6KE2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.20 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.53 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 285 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M bincine pH 9.0, 2M MgCl2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-04-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9779 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9779 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6KE2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.7980 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24788 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.90 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 21.4 _reflns.pdbx_Rmerge_I_obs 0.073 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 53.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.83 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1207 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.20 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 63.080 _refine.B_iso_mean 14.9419 _refine.B_iso_min 4.400 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6KE2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.7980 _refine.ls_d_res_low 26.3340 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24762 _refine.ls_number_reflns_R_free 1999 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9700 _refine.ls_percent_reflns_R_free 8.0700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1565 _refine.ls_R_factor_R_free 0.1794 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1544 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.380 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2FHA _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 15.5300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.7980 _refine_hist.d_res_low 26.3340 _refine_hist.number_atoms_solvent 260 _refine_hist.number_atoms_total 1660 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 169 _refine_hist.pdbx_B_iso_mean_ligand 30.74 _refine_hist.pdbx_B_iso_mean_solvent 26.53 _refine_hist.pdbx_number_atoms_protein 1390 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.7981 1.8430 . . 141 1615 100.0000 . . . 0.1999 0.0000 0.1578 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8430 1.8928 . . 140 1575 100.0000 . . . 0.1825 0.0000 0.1550 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8928 1.9485 . . 138 1583 100.0000 . . . 0.1982 0.0000 0.1555 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9485 2.0114 . . 140 1587 100.0000 . . . 0.2051 0.0000 0.1507 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0114 2.0832 . . 139 1592 100.0000 . . . 0.1898 0.0000 0.1427 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0832 2.1666 . . 140 1582 100.0000 . . . 0.1606 0.0000 0.1374 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1666 2.2652 . . 142 1623 100.0000 . . . 0.1657 0.0000 0.1398 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2652 2.3845 . . 141 1608 100.0000 . . . 0.1677 0.0000 0.1490 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3845 2.5338 . . 142 1615 100.0000 . . . 0.1906 0.0000 0.1632 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5338 2.7293 . . 142 1616 100.0000 . . . 0.1867 0.0000 0.1607 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7293 3.0036 . . 144 1636 100.0000 . . . 0.1664 0.0000 0.1591 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0036 3.4374 . . 145 1650 100.0000 . . . 0.1714 0.0000 0.1548 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4374 4.3276 . . 147 1680 100.0000 . . . 0.1791 0.0000 0.1366 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.3276 26.3340 . . 158 1801 100.0000 . . . 0.1822 0.0000 0.1830 . . . . . . . . . . # _struct.entry_id 6KE2 _struct.title 'ABloop reengineered Ferritin Nanocage' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6KE2 _struct_keywords.text 'rHuHF, ABloop reengineered, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 3 ? H N N 3 ? I N N 4 ? J N N 4 ? K N N 5 ? L N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 14 ? VAL A 45 ? HIS A 14 VAL A 45 1 ? 32 HELX_P HELX_P2 AA2 LEU A 47 ? ARG A 75 ? LEU A 47 ARG A 75 1 ? 29 HELX_P HELX_P3 AA3 SER A 94 ? LYS A 123 ? SER A 94 LYS A 123 1 ? 30 HELX_P HELX_P4 AA4 ASP A 125 ? TYR A 136 ? ASP A 125 TYR A 136 1 ? 12 HELX_P HELX_P5 AA5 TYR A 136 ? GLY A 158 ? TYR A 136 GLY A 158 1 ? 23 HELX_P HELX_P6 AA6 SER A 162 ? THR A 173 ? SER A 162 THR A 173 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 28 OE2 ? ? ? 1_555 G FE . FE ? ? A GLU 28 A FE 206 1_555 ? ? ? ? ? ? ? 2.030 ? ? metalc2 metalc ? ? A GLN 57 OE1 ? ? ? 1_555 H FE . FE ? ? A GLN 57 A FE 207 1_555 ? ? ? ? ? ? ? 2.259 ? ? metalc3 metalc ? ? A GLU 60 OE1 ? ? ? 1_555 H FE . FE ? ? A GLU 60 A FE 207 1_555 ? ? ? ? ? ? ? 2.435 ? ? metalc4 metalc ? ? A GLU 61 OE2 ? ? ? 1_555 G FE . FE ? ? A GLU 61 A FE 206 1_555 ? ? ? ? ? ? ? 2.054 ? ? metalc5 metalc ? ? A HIS 64 ND1 ? ? ? 1_555 G FE . FE ? ? A HIS 64 A FE 206 1_555 ? ? ? ? ? ? ? 2.278 ? ? metalc6 metalc one ? A ARG 78 NH1 A ? ? 1_555 E MG . MG ? ? A ARG 78 A MG 204 1_555 ? ? ? ? ? ? ? 2.459 ? ? metalc7 metalc ? ? A ASP 130 OD1 ? ? ? 1_555 K CA . CA ? ? A ASP 130 A CA 210 1_555 ? ? ? ? ? ? ? 2.564 ? ? metalc8 metalc ? ? A GLU 133 OE1 ? ? ? 1_555 K CA . CA ? ? A GLU 133 A CA 210 6_555 ? ? ? ? ? ? ? 2.896 ? ? metalc9 metalc ? ? B MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 201 A HOH 317 1_555 ? ? ? ? ? ? ? 2.076 ? ? metalc10 metalc ? ? B MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 201 A HOH 317 72_555 ? ? ? ? ? ? ? 2.076 ? ? metalc11 metalc ? ? B MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 201 A HOH 352 1_555 ? ? ? ? ? ? ? 2.025 ? ? metalc12 metalc ? ? B MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 201 A HOH 352 72_555 ? ? ? ? ? ? ? 2.025 ? ? metalc13 metalc ? ? B MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 201 A HOH 497 51_555 ? ? ? ? ? ? ? 2.112 ? ? metalc14 metalc ? ? B MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 201 A HOH 556 22_555 ? ? ? ? ? ? ? 2.056 ? ? metalc15 metalc ? ? C MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 202 A HOH 329 1_555 ? ? ? ? ? ? ? 2.084 ? ? metalc16 metalc ? ? C MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 202 A HOH 329 6_555 ? ? ? ? ? ? ? 2.084 ? ? metalc17 metalc ? ? C MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 202 A HOH 495 1_555 ? ? ? ? ? ? ? 2.064 ? ? metalc18 metalc ? ? C MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 202 A HOH 495 6_555 ? ? ? ? ? ? ? 2.064 ? ? metalc19 metalc ? ? D MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 203 A HOH 343 6_555 ? ? ? ? ? ? ? 2.505 ? ? metalc20 metalc ? ? D MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 203 A HOH 377 6_555 ? ? ? ? ? ? ? 2.177 ? ? metalc21 metalc ? ? D MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 203 A HOH 396 1_555 ? ? ? ? ? ? ? 1.984 ? ? metalc22 metalc ? ? D MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 203 A HOH 443 1_555 ? ? ? ? ? ? ? 2.147 ? ? metalc23 metalc ? ? D MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 203 A HOH 508 1_555 ? ? ? ? ? ? ? 2.166 ? ? metalc24 metalc ? ? E MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 204 A HOH 308 1_555 ? ? ? ? ? ? ? 2.107 ? ? metalc25 metalc ? ? E MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 204 A HOH 337 1_555 ? ? ? ? ? ? ? 2.057 ? ? metalc26 metalc ? ? E MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 204 A HOH 394 1_555 ? ? ? ? ? ? ? 2.074 ? ? metalc27 metalc ? ? E MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 204 A HOH 452 1_555 ? ? ? ? ? ? ? 2.174 ? ? metalc28 metalc ? ? F MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 205 A HOH 344 1_555 ? ? ? ? ? ? ? 1.971 ? ? metalc29 metalc ? ? F MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 205 A HOH 459 1_555 ? ? ? ? ? ? ? 2.046 ? ? metalc30 metalc ? ? F MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 205 A HOH 484 1_555 ? ? ? ? ? ? ? 2.014 ? ? metalc31 metalc ? ? G FE . FE ? ? ? 1_555 L HOH . O ? ? A FE 206 A HOH 326 1_555 ? ? ? ? ? ? ? 2.095 ? ? metalc32 metalc ? ? G FE . FE ? ? ? 1_555 L HOH . O ? ? A FE 206 A HOH 330 1_555 ? ? ? ? ? ? ? 2.206 ? ? metalc33 metalc ? ? G FE . FE ? ? ? 1_555 L HOH . O ? ? A FE 206 A HOH 351 1_555 ? ? ? ? ? ? ? 2.075 ? ? metalc34 metalc ? ? H FE . FE ? ? ? 1_555 L HOH . O ? ? A FE 207 A HOH 327 1_555 ? ? ? ? ? ? ? 2.111 ? ? metalc35 metalc ? ? H FE . FE ? ? ? 1_555 L HOH . O ? ? A FE 207 A HOH 360 1_555 ? ? ? ? ? ? ? 2.230 ? ? metalc36 metalc ? ? H FE . FE ? ? ? 1_555 L HOH . O ? ? A FE 207 A HOH 433 1_555 ? ? ? ? ? ? ? 2.163 ? ? metalc37 metalc ? ? H FE . FE ? ? ? 1_555 L HOH . O ? ? A FE 207 A HOH 437 1_555 ? ? ? ? ? ? ? 1.907 ? ? metalc38 metalc ? ? K CA . CA ? ? ? 1_555 L HOH . O ? ? A CA 210 A HOH 315 1_555 ? ? ? ? ? ? ? 2.761 ? ? metalc39 metalc ? ? K CA . CA ? ? ? 1_555 L HOH . O ? ? A CA 210 A HOH 315 12_555 ? ? ? ? ? ? ? 2.168 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 159 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 159 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 160 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 160 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.38 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 201 ? 8 'binding site for residue MG A 201' AC2 Software A MG 202 ? 6 'binding site for residue MG A 202' AC3 Software A MG 203 ? 5 'binding site for residue MG A 203' AC4 Software A MG 204 ? 5 'binding site for residue MG A 204' AC5 Software A MG 205 ? 3 'binding site for residue MG A 205' AC6 Software A FE 206 ? 6 'binding site for residue FE A 206' AC7 Software A FE 207 ? 6 'binding site for residue FE A 207' AC8 Software A CL 208 ? 4 'binding site for residue CL A 208' AC9 Software A CL 209 ? 7 'binding site for residue CL A 209' AD1 Software A CA 210 ? 4 'binding site for residue CA A 210' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 HOH L . ? HOH A 317 . ? 1_555 ? 2 AC1 8 HOH L . ? HOH A 317 . ? 72_555 ? 3 AC1 8 HOH L . ? HOH A 352 . ? 1_555 ? 4 AC1 8 HOH L . ? HOH A 352 . ? 72_555 ? 5 AC1 8 HOH L . ? HOH A 497 . ? 51_555 ? 6 AC1 8 HOH L . ? HOH A 497 . ? 22_555 ? 7 AC1 8 HOH L . ? HOH A 556 . ? 51_555 ? 8 AC1 8 HOH L . ? HOH A 556 . ? 22_555 ? 9 AC2 6 HOH L . ? HOH A 329 . ? 1_555 ? 10 AC2 6 HOH L . ? HOH A 329 . ? 6_555 ? 11 AC2 6 HOH L . ? HOH A 329 . ? 12_555 ? 12 AC2 6 HOH L . ? HOH A 495 . ? 6_555 ? 13 AC2 6 HOH L . ? HOH A 495 . ? 1_555 ? 14 AC2 6 HOH L . ? HOH A 495 . ? 12_555 ? 15 AC3 5 HOH L . ? HOH A 343 . ? 6_555 ? 16 AC3 5 HOH L . ? HOH A 377 . ? 6_555 ? 17 AC3 5 HOH L . ? HOH A 396 . ? 1_555 ? 18 AC3 5 HOH L . ? HOH A 443 . ? 1_555 ? 19 AC3 5 HOH L . ? HOH A 508 . ? 1_555 ? 20 AC4 5 ARG A 78 ? ARG A 78 . ? 1_555 ? 21 AC4 5 HOH L . ? HOH A 308 . ? 1_555 ? 22 AC4 5 HOH L . ? HOH A 337 . ? 1_555 ? 23 AC4 5 HOH L . ? HOH A 394 . ? 1_555 ? 24 AC4 5 HOH L . ? HOH A 452 . ? 1_555 ? 25 AC5 3 HOH L . ? HOH A 344 . ? 1_555 ? 26 AC5 3 HOH L . ? HOH A 459 . ? 1_555 ? 27 AC5 3 HOH L . ? HOH A 484 . ? 1_555 ? 28 AC6 6 GLU A 28 ? GLU A 28 . ? 1_555 ? 29 AC6 6 GLU A 61 ? GLU A 61 . ? 1_555 ? 30 AC6 6 HIS A 64 ? HIS A 64 . ? 1_555 ? 31 AC6 6 HOH L . ? HOH A 326 . ? 1_555 ? 32 AC6 6 HOH L . ? HOH A 330 . ? 1_555 ? 33 AC6 6 HOH L . ? HOH A 351 . ? 1_555 ? 34 AC7 6 GLN A 57 ? GLN A 57 . ? 1_555 ? 35 AC7 6 GLU A 60 ? GLU A 60 . ? 1_555 ? 36 AC7 6 HOH L . ? HOH A 327 . ? 1_555 ? 37 AC7 6 HOH L . ? HOH A 360 . ? 1_555 ? 38 AC7 6 HOH L . ? HOH A 433 . ? 1_555 ? 39 AC7 6 HOH L . ? HOH A 437 . ? 1_555 ? 40 AC8 4 ARG A 10 ? ARG A 10 . ? 1_555 ? 41 AC8 4 ASN A 12 ? ASN A 12 . ? 1_555 ? 42 AC8 4 TYR A 13 ? TYR A 13 . ? 1_555 ? 43 AC8 4 HOH L . ? HOH A 462 . ? 1_555 ? 44 AC9 7 GLU A 133 ? GLU A 133 . ? 1_555 ? 45 AC9 7 THR A 134 ? THR A 134 . ? 1_555 ? 46 AC9 7 HIS A 135 ? HIS A 135 . ? 1_555 ? 47 AC9 7 TYR A 136 ? TYR A 136 . ? 1_555 ? 48 AC9 7 LEU A 137 ? LEU A 137 . ? 1_555 ? 49 AC9 7 ASN A 138 ? ASN A 138 . ? 1_555 ? 50 AC9 7 GLU A 139 ? GLU A 139 . ? 1_555 ? 51 AD1 4 ASP A 130 ? ASP A 130 . ? 1_555 ? 52 AD1 4 GLU A 133 ? GLU A 133 . ? 12_555 ? 53 AD1 4 HOH L . ? HOH A 315 . ? 1_555 ? 54 AD1 4 HOH L . ? HOH A 315 . ? 12_555 ? # _atom_sites.entry_id 6KE2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.005481 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005481 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005481 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA CL FE MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 ALA 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 THR 6 6 ? ? ? A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 CYS 89 89 89 CYS CYS A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 MET 99 99 99 MET MET A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 CYS 129 129 129 CYS CYS A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 HIS 135 135 135 HIS HIS A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 HIS 150 150 150 HIS HIS A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 MET 157 157 157 MET MET A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 TYR 167 167 167 TYR TYR A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 PHE 169 169 169 PHE PHE A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 THR 173 173 173 THR THR A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 GLY 175 175 175 GLY GLY A . n A 1 176 ASP 176 176 ? ? ? A . n A 1 177 SER 177 177 ? ? ? A . n A 1 178 ASP 178 178 ? ? ? A . n A 1 179 ASN 179 179 ? ? ? A . n A 1 180 GLU 180 180 ? ? ? A . n A 1 181 SER 181 181 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 201 1 MG MG A . C 2 MG 1 202 2 MG MG A . D 2 MG 1 203 3 MG MG A . E 2 MG 1 204 4 MG MG A . F 2 MG 1 205 5 MG MG A . G 3 FE 1 206 1 FE FE A . H 3 FE 1 207 2 FE FE A . I 4 CL 1 208 1 CL CL A . J 4 CL 1 209 2 CL CL A . K 5 CA 1 210 1 CA CA A . L 6 HOH 1 301 72 HOH HOH A . L 6 HOH 2 302 220 HOH HOH A . L 6 HOH 3 303 87 HOH HOH A . L 6 HOH 4 304 206 HOH HOH A . L 6 HOH 5 305 191 HOH HOH A . L 6 HOH 6 306 125 HOH HOH A . L 6 HOH 7 307 102 HOH HOH A . L 6 HOH 8 308 210 HOH HOH A . L 6 HOH 9 309 217 HOH HOH A . L 6 HOH 10 310 64 HOH HOH A . L 6 HOH 11 311 164 HOH HOH A . L 6 HOH 12 312 182 HOH HOH A . L 6 HOH 13 313 108 HOH HOH A . L 6 HOH 14 314 67 HOH HOH A . L 6 HOH 15 315 296 HOH HOH A . L 6 HOH 16 316 41 HOH HOH A . L 6 HOH 17 317 36 HOH HOH A . L 6 HOH 18 318 82 HOH HOH A . L 6 HOH 19 319 267 HOH HOH A . L 6 HOH 20 320 96 HOH HOH A . L 6 HOH 21 321 163 HOH HOH A . L 6 HOH 22 322 156 HOH HOH A . L 6 HOH 23 323 150 HOH HOH A . L 6 HOH 24 324 233 HOH HOH A . L 6 HOH 25 325 44 HOH HOH A . L 6 HOH 26 326 198 HOH HOH A . L 6 HOH 27 327 144 HOH HOH A . L 6 HOH 28 328 147 HOH HOH A . L 6 HOH 29 329 14 HOH HOH A . L 6 HOH 30 330 137 HOH HOH A . L 6 HOH 31 331 284 HOH HOH A . L 6 HOH 32 332 62 HOH HOH A . L 6 HOH 33 333 213 HOH HOH A . L 6 HOH 34 334 172 HOH HOH A . L 6 HOH 35 335 130 HOH HOH A . L 6 HOH 36 336 100 HOH HOH A . L 6 HOH 37 337 40 HOH HOH A . L 6 HOH 38 338 92 HOH HOH A . L 6 HOH 39 339 223 HOH HOH A . L 6 HOH 40 340 141 HOH HOH A . L 6 HOH 41 341 119 HOH HOH A . L 6 HOH 42 342 43 HOH HOH A . L 6 HOH 43 343 152 HOH HOH A . L 6 HOH 44 344 70 HOH HOH A . L 6 HOH 45 345 199 HOH HOH A . L 6 HOH 46 346 53 HOH HOH A . L 6 HOH 47 347 214 HOH HOH A . L 6 HOH 48 348 3 HOH HOH A . L 6 HOH 49 349 6 HOH HOH A . L 6 HOH 50 350 126 HOH HOH A . L 6 HOH 51 351 34 HOH HOH A . L 6 HOH 52 352 28 HOH HOH A . L 6 HOH 53 353 18 HOH HOH A . L 6 HOH 54 354 158 HOH HOH A . L 6 HOH 55 355 259 HOH HOH A . L 6 HOH 56 356 122 HOH HOH A . L 6 HOH 57 357 88 HOH HOH A . L 6 HOH 58 358 13 HOH HOH A . L 6 HOH 59 359 63 HOH HOH A . L 6 HOH 60 360 290 HOH HOH A . L 6 HOH 61 361 202 HOH HOH A . L 6 HOH 62 362 134 HOH HOH A . L 6 HOH 63 363 85 HOH HOH A . L 6 HOH 64 364 160 HOH HOH A . L 6 HOH 65 365 73 HOH HOH A . L 6 HOH 66 366 187 HOH HOH A . L 6 HOH 67 367 7 HOH HOH A . L 6 HOH 68 368 5 HOH HOH A . L 6 HOH 69 369 94 HOH HOH A . L 6 HOH 70 370 19 HOH HOH A . L 6 HOH 71 371 29 HOH HOH A . L 6 HOH 72 372 69 HOH HOH A . L 6 HOH 73 373 42 HOH HOH A . L 6 HOH 74 374 106 HOH HOH A . L 6 HOH 75 375 35 HOH HOH A . L 6 HOH 76 376 183 HOH HOH A . L 6 HOH 77 377 294 HOH HOH A . L 6 HOH 78 378 27 HOH HOH A . L 6 HOH 79 379 101 HOH HOH A . L 6 HOH 80 380 264 HOH HOH A . L 6 HOH 81 381 31 HOH HOH A . L 6 HOH 82 382 21 HOH HOH A . L 6 HOH 83 383 221 HOH HOH A . L 6 HOH 84 384 47 HOH HOH A . L 6 HOH 85 385 75 HOH HOH A . L 6 HOH 86 386 32 HOH HOH A . L 6 HOH 87 387 136 HOH HOH A . L 6 HOH 88 388 128 HOH HOH A . L 6 HOH 89 389 15 HOH HOH A . L 6 HOH 90 390 124 HOH HOH A . L 6 HOH 91 391 37 HOH HOH A . L 6 HOH 92 392 76 HOH HOH A . L 6 HOH 93 393 83 HOH HOH A . L 6 HOH 94 394 212 HOH HOH A . L 6 HOH 95 395 12 HOH HOH A . L 6 HOH 96 396 107 HOH HOH A . L 6 HOH 97 397 241 HOH HOH A . L 6 HOH 98 398 120 HOH HOH A . L 6 HOH 99 399 71 HOH HOH A . L 6 HOH 100 400 4 HOH HOH A . L 6 HOH 101 401 140 HOH HOH A . L 6 HOH 102 402 57 HOH HOH A . L 6 HOH 103 403 234 HOH HOH A . L 6 HOH 104 404 45 HOH HOH A . L 6 HOH 105 405 16 HOH HOH A . L 6 HOH 106 406 186 HOH HOH A . L 6 HOH 107 407 22 HOH HOH A . L 6 HOH 108 408 282 HOH HOH A . L 6 HOH 109 409 111 HOH HOH A . L 6 HOH 110 410 249 HOH HOH A . L 6 HOH 111 411 208 HOH HOH A . L 6 HOH 112 412 58 HOH HOH A . L 6 HOH 113 413 211 HOH HOH A . L 6 HOH 114 414 244 HOH HOH A . L 6 HOH 115 415 253 HOH HOH A . L 6 HOH 116 416 168 HOH HOH A . L 6 HOH 117 417 74 HOH HOH A . L 6 HOH 118 418 9 HOH HOH A . L 6 HOH 119 419 112 HOH HOH A . L 6 HOH 120 420 162 HOH HOH A . L 6 HOH 121 421 287 HOH HOH A . L 6 HOH 122 422 11 HOH HOH A . L 6 HOH 123 423 218 HOH HOH A . L 6 HOH 124 424 24 HOH HOH A . L 6 HOH 125 425 50 HOH HOH A . L 6 HOH 126 426 127 HOH HOH A . L 6 HOH 127 427 209 HOH HOH A . L 6 HOH 128 428 59 HOH HOH A . L 6 HOH 129 429 26 HOH HOH A . L 6 HOH 130 430 149 HOH HOH A . L 6 HOH 131 431 242 HOH HOH A . L 6 HOH 132 432 46 HOH HOH A . L 6 HOH 133 433 265 HOH HOH A . L 6 HOH 134 434 49 HOH HOH A . L 6 HOH 135 435 262 HOH HOH A . L 6 HOH 136 436 227 HOH HOH A . L 6 HOH 137 437 293 HOH HOH A . L 6 HOH 138 438 55 HOH HOH A . L 6 HOH 139 439 181 HOH HOH A . L 6 HOH 140 440 132 HOH HOH A . L 6 HOH 141 441 89 HOH HOH A . L 6 HOH 142 442 80 HOH HOH A . L 6 HOH 143 443 153 HOH HOH A . L 6 HOH 144 444 157 HOH HOH A . L 6 HOH 145 445 251 HOH HOH A . L 6 HOH 146 446 60 HOH HOH A . L 6 HOH 147 447 228 HOH HOH A . L 6 HOH 148 448 133 HOH HOH A . L 6 HOH 149 449 115 HOH HOH A . L 6 HOH 150 450 146 HOH HOH A . L 6 HOH 151 451 276 HOH HOH A . L 6 HOH 152 452 248 HOH HOH A . L 6 HOH 153 453 215 HOH HOH A . L 6 HOH 154 454 261 HOH HOH A . L 6 HOH 155 455 51 HOH HOH A . L 6 HOH 156 456 113 HOH HOH A . L 6 HOH 157 457 95 HOH HOH A . L 6 HOH 158 458 68 HOH HOH A . L 6 HOH 159 459 286 HOH HOH A . L 6 HOH 160 460 105 HOH HOH A . L 6 HOH 161 461 185 HOH HOH A . L 6 HOH 162 462 189 HOH HOH A . L 6 HOH 163 463 17 HOH HOH A . L 6 HOH 164 464 207 HOH HOH A . L 6 HOH 165 465 173 HOH HOH A . L 6 HOH 166 466 148 HOH HOH A . L 6 HOH 167 467 90 HOH HOH A . L 6 HOH 168 468 93 HOH HOH A . L 6 HOH 169 469 222 HOH HOH A . L 6 HOH 170 470 118 HOH HOH A . L 6 HOH 171 471 79 HOH HOH A . L 6 HOH 172 472 246 HOH HOH A . L 6 HOH 173 473 142 HOH HOH A . L 6 HOH 174 474 56 HOH HOH A . L 6 HOH 175 475 110 HOH HOH A . L 6 HOH 176 476 195 HOH HOH A . L 6 HOH 177 477 271 HOH HOH A . L 6 HOH 178 478 116 HOH HOH A . L 6 HOH 179 479 193 HOH HOH A . L 6 HOH 180 480 66 HOH HOH A . L 6 HOH 181 481 30 HOH HOH A . L 6 HOH 182 482 91 HOH HOH A . L 6 HOH 183 483 291 HOH HOH A . L 6 HOH 184 484 295 HOH HOH A . L 6 HOH 185 485 238 HOH HOH A . L 6 HOH 186 486 256 HOH HOH A . L 6 HOH 187 487 171 HOH HOH A . L 6 HOH 188 488 216 HOH HOH A . L 6 HOH 189 489 77 HOH HOH A . L 6 HOH 190 490 258 HOH HOH A . L 6 HOH 191 491 104 HOH HOH A . L 6 HOH 192 492 226 HOH HOH A . L 6 HOH 193 493 240 HOH HOH A . L 6 HOH 194 494 86 HOH HOH A . L 6 HOH 195 495 10 HOH HOH A . L 6 HOH 196 496 247 HOH HOH A . L 6 HOH 197 497 38 HOH HOH A . L 6 HOH 198 498 20 HOH HOH A . L 6 HOH 199 499 190 HOH HOH A . L 6 HOH 200 500 184 HOH HOH A . L 6 HOH 201 501 48 HOH HOH A . L 6 HOH 202 502 272 HOH HOH A . L 6 HOH 203 503 196 HOH HOH A . L 6 HOH 204 504 151 HOH HOH A . L 6 HOH 205 505 121 HOH HOH A . L 6 HOH 206 506 245 HOH HOH A . L 6 HOH 207 507 135 HOH HOH A . L 6 HOH 208 508 292 HOH HOH A . L 6 HOH 209 509 52 HOH HOH A . L 6 HOH 210 510 263 HOH HOH A . L 6 HOH 211 511 188 HOH HOH A . L 6 HOH 212 512 109 HOH HOH A . L 6 HOH 213 513 236 HOH HOH A . L 6 HOH 214 514 224 HOH HOH A . L 6 HOH 215 515 39 HOH HOH A . L 6 HOH 216 516 237 HOH HOH A . L 6 HOH 217 517 8 HOH HOH A . L 6 HOH 218 518 138 HOH HOH A . L 6 HOH 219 519 257 HOH HOH A . L 6 HOH 220 520 65 HOH HOH A . L 6 HOH 221 521 131 HOH HOH A . L 6 HOH 222 522 239 HOH HOH A . L 6 HOH 223 523 254 HOH HOH A . L 6 HOH 224 524 165 HOH HOH A . L 6 HOH 225 525 98 HOH HOH A . L 6 HOH 226 526 273 HOH HOH A . L 6 HOH 227 527 230 HOH HOH A . L 6 HOH 228 528 243 HOH HOH A . L 6 HOH 229 529 231 HOH HOH A . L 6 HOH 230 530 180 HOH HOH A . L 6 HOH 231 531 252 HOH HOH A . L 6 HOH 232 532 54 HOH HOH A . L 6 HOH 233 533 154 HOH HOH A . L 6 HOH 234 534 155 HOH HOH A . L 6 HOH 235 535 78 HOH HOH A . L 6 HOH 236 536 197 HOH HOH A . L 6 HOH 237 537 61 HOH HOH A . L 6 HOH 238 538 176 HOH HOH A . L 6 HOH 239 539 229 HOH HOH A . L 6 HOH 240 540 99 HOH HOH A . L 6 HOH 241 541 33 HOH HOH A . L 6 HOH 242 542 161 HOH HOH A . L 6 HOH 243 543 175 HOH HOH A . L 6 HOH 244 544 114 HOH HOH A . L 6 HOH 245 545 145 HOH HOH A . L 6 HOH 246 546 169 HOH HOH A . L 6 HOH 247 547 203 HOH HOH A . L 6 HOH 248 548 281 HOH HOH A . L 6 HOH 249 549 260 HOH HOH A . L 6 HOH 250 550 201 HOH HOH A . L 6 HOH 251 551 159 HOH HOH A . L 6 HOH 252 552 97 HOH HOH A . L 6 HOH 253 553 204 HOH HOH A . L 6 HOH 254 554 268 HOH HOH A . L 6 HOH 255 555 192 HOH HOH A . L 6 HOH 256 556 23 HOH HOH A . L 6 HOH 257 557 129 HOH HOH A . L 6 HOH 258 558 235 HOH HOH A . L 6 HOH 259 559 166 HOH HOH A . L 6 HOH 260 560 179 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 103710 ? 1 MORE -2024 ? 1 'SSA (A^2)' 135630 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 13 'crystal symmetry operation' 13_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 14 'crystal symmetry operation' 14_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 15 'crystal symmetry operation' 15_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_555 x,z,-y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 18 'crystal symmetry operation' 18_555 -x,z,y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_555 -x,-z,-y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 20_555 x,-z,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_555 z,y,-x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 22 'crystal symmetry operation' 22_555 z,-y,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 23 'crystal symmetry operation' 23_555 -z,y,x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 24 'crystal symmetry operation' 24_555 -z,-y,-x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A MG 201 ? B MG . 2 1 A MG 202 ? C MG . 3 1 A HOH 317 ? L HOH . 4 1 A HOH 556 ? L HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 28 ? A GLU 28 ? 1_555 FE ? G FE . ? A FE 206 ? 1_555 OE2 ? A GLU 61 ? A GLU 61 ? 1_555 88.8 ? 2 OE2 ? A GLU 28 ? A GLU 28 ? 1_555 FE ? G FE . ? A FE 206 ? 1_555 ND1 ? A HIS 64 ? A HIS 64 ? 1_555 99.2 ? 3 OE2 ? A GLU 61 ? A GLU 61 ? 1_555 FE ? G FE . ? A FE 206 ? 1_555 ND1 ? A HIS 64 ? A HIS 64 ? 1_555 107.1 ? 4 OE2 ? A GLU 28 ? A GLU 28 ? 1_555 FE ? G FE . ? A FE 206 ? 1_555 O ? L HOH . ? A HOH 326 ? 1_555 167.3 ? 5 OE2 ? A GLU 61 ? A GLU 61 ? 1_555 FE ? G FE . ? A FE 206 ? 1_555 O ? L HOH . ? A HOH 326 ? 1_555 92.0 ? 6 ND1 ? A HIS 64 ? A HIS 64 ? 1_555 FE ? G FE . ? A FE 206 ? 1_555 O ? L HOH . ? A HOH 326 ? 1_555 92.7 ? 7 OE2 ? A GLU 28 ? A GLU 28 ? 1_555 FE ? G FE . ? A FE 206 ? 1_555 O ? L HOH . ? A HOH 330 ? 1_555 97.4 ? 8 OE2 ? A GLU 61 ? A GLU 61 ? 1_555 FE ? G FE . ? A FE 206 ? 1_555 O ? L HOH . ? A HOH 330 ? 1_555 74.5 ? 9 ND1 ? A HIS 64 ? A HIS 64 ? 1_555 FE ? G FE . ? A FE 206 ? 1_555 O ? L HOH . ? A HOH 330 ? 1_555 163.4 ? 10 O ? L HOH . ? A HOH 326 ? 1_555 FE ? G FE . ? A FE 206 ? 1_555 O ? L HOH . ? A HOH 330 ? 1_555 70.7 ? 11 OE2 ? A GLU 28 ? A GLU 28 ? 1_555 FE ? G FE . ? A FE 206 ? 1_555 O ? L HOH . ? A HOH 351 ? 1_555 89.5 ? 12 OE2 ? A GLU 61 ? A GLU 61 ? 1_555 FE ? G FE . ? A FE 206 ? 1_555 O ? L HOH . ? A HOH 351 ? 1_555 167.9 ? 13 ND1 ? A HIS 64 ? A HIS 64 ? 1_555 FE ? G FE . ? A FE 206 ? 1_555 O ? L HOH . ? A HOH 351 ? 1_555 85.1 ? 14 O ? L HOH . ? A HOH 326 ? 1_555 FE ? G FE . ? A FE 206 ? 1_555 O ? L HOH . ? A HOH 351 ? 1_555 87.0 ? 15 O ? L HOH . ? A HOH 330 ? 1_555 FE ? G FE . ? A FE 206 ? 1_555 O ? L HOH . ? A HOH 351 ? 1_555 93.8 ? 16 OE1 ? A GLN 57 ? A GLN 57 ? 1_555 FE ? H FE . ? A FE 207 ? 1_555 OE1 ? A GLU 60 ? A GLU 60 ? 1_555 77.6 ? 17 OE1 ? A GLN 57 ? A GLN 57 ? 1_555 FE ? H FE . ? A FE 207 ? 1_555 O ? L HOH . ? A HOH 327 ? 1_555 87.4 ? 18 OE1 ? A GLU 60 ? A GLU 60 ? 1_555 FE ? H FE . ? A FE 207 ? 1_555 O ? L HOH . ? A HOH 327 ? 1_555 87.5 ? 19 OE1 ? A GLN 57 ? A GLN 57 ? 1_555 FE ? H FE . ? A FE 207 ? 1_555 O ? L HOH . ? A HOH 360 ? 1_555 73.4 ? 20 OE1 ? A GLU 60 ? A GLU 60 ? 1_555 FE ? H FE . ? A FE 207 ? 1_555 O ? L HOH . ? A HOH 360 ? 1_555 90.1 ? 21 O ? L HOH . ? A HOH 327 ? 1_555 FE ? H FE . ? A FE 207 ? 1_555 O ? L HOH . ? A HOH 360 ? 1_555 160.7 ? 22 OE1 ? A GLN 57 ? A GLN 57 ? 1_555 FE ? H FE . ? A FE 207 ? 1_555 O ? L HOH . ? A HOH 433 ? 1_555 154.0 ? 23 OE1 ? A GLU 60 ? A GLU 60 ? 1_555 FE ? H FE . ? A FE 207 ? 1_555 O ? L HOH . ? A HOH 433 ? 1_555 77.5 ? 24 O ? L HOH . ? A HOH 327 ? 1_555 FE ? H FE . ? A FE 207 ? 1_555 O ? L HOH . ? A HOH 433 ? 1_555 98.9 ? 25 O ? L HOH . ? A HOH 360 ? 1_555 FE ? H FE . ? A FE 207 ? 1_555 O ? L HOH . ? A HOH 433 ? 1_555 99.2 ? 26 OE1 ? A GLN 57 ? A GLN 57 ? 1_555 FE ? H FE . ? A FE 207 ? 1_555 O ? L HOH . ? A HOH 437 ? 1_555 115.0 ? 27 OE1 ? A GLU 60 ? A GLU 60 ? 1_555 FE ? H FE . ? A FE 207 ? 1_555 O ? L HOH . ? A HOH 437 ? 1_555 158.4 ? 28 O ? L HOH . ? A HOH 327 ? 1_555 FE ? H FE . ? A FE 207 ? 1_555 O ? L HOH . ? A HOH 437 ? 1_555 76.2 ? 29 O ? L HOH . ? A HOH 360 ? 1_555 FE ? H FE . ? A FE 207 ? 1_555 O ? L HOH . ? A HOH 437 ? 1_555 110.0 ? 30 O ? L HOH . ? A HOH 433 ? 1_555 FE ? H FE . ? A FE 207 ? 1_555 O ? L HOH . ? A HOH 437 ? 1_555 90.9 ? 31 NH1 A A ARG 78 ? A ARG 78 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? L HOH . ? A HOH 308 ? 1_555 121.5 ? 32 NH1 A A ARG 78 ? A ARG 78 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? L HOH . ? A HOH 337 ? 1_555 104.2 ? 33 O ? L HOH . ? A HOH 308 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? L HOH . ? A HOH 337 ? 1_555 86.4 ? 34 NH1 A A ARG 78 ? A ARG 78 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? L HOH . ? A HOH 394 ? 1_555 157.9 ? 35 O ? L HOH . ? A HOH 308 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? L HOH . ? A HOH 394 ? 1_555 76.6 ? 36 O ? L HOH . ? A HOH 337 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? L HOH . ? A HOH 394 ? 1_555 88.5 ? 37 NH1 A A ARG 78 ? A ARG 78 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? L HOH . ? A HOH 452 ? 1_555 80.9 ? 38 O ? L HOH . ? A HOH 308 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? L HOH . ? A HOH 452 ? 1_555 91.0 ? 39 O ? L HOH . ? A HOH 337 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? L HOH . ? A HOH 452 ? 1_555 174.8 ? 40 O ? L HOH . ? A HOH 394 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? L HOH . ? A HOH 452 ? 1_555 86.6 ? 41 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? K CA . ? A CA 210 ? 1_555 OE1 ? A GLU 133 ? A GLU 133 ? 1_555 118.6 ? 42 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? K CA . ? A CA 210 ? 1_555 O ? L HOH . ? A HOH 315 ? 1_555 68.8 ? 43 OE1 ? A GLU 133 ? A GLU 133 ? 1_555 CA ? K CA . ? A CA 210 ? 1_555 O ? L HOH . ? A HOH 315 ? 1_555 79.2 ? 44 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? K CA . ? A CA 210 ? 1_555 O ? L HOH . ? A HOH 315 ? 12_555 73.9 ? 45 OE1 ? A GLU 133 ? A GLU 133 ? 1_555 CA ? K CA . ? A CA 210 ? 1_555 O ? L HOH . ? A HOH 315 ? 12_555 146.7 ? 46 O ? L HOH . ? A HOH 315 ? 1_555 CA ? K CA . ? A CA 210 ? 1_555 O ? L HOH . ? A HOH 315 ? 12_555 77.6 ? 47 O ? L HOH . ? A HOH 317 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? L HOH . ? A HOH 317 ? 72_555 0.0 ? 48 O ? L HOH . ? A HOH 317 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? L HOH . ? A HOH 352 ? 1_555 89.3 ? 49 O ? L HOH . ? A HOH 317 ? 72_555 MG ? B MG . ? A MG 201 ? 1_555 O ? L HOH . ? A HOH 352 ? 1_555 89.3 ? 50 O ? L HOH . ? A HOH 317 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? L HOH . ? A HOH 352 ? 72_555 89.3 ? 51 O ? L HOH . ? A HOH 317 ? 72_555 MG ? B MG . ? A MG 201 ? 1_555 O ? L HOH . ? A HOH 352 ? 72_555 89.3 ? 52 O ? L HOH . ? A HOH 352 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? L HOH . ? A HOH 352 ? 72_555 178.6 ? 53 O ? L HOH . ? A HOH 317 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? L HOH . ? A HOH 497 ? 51_555 90.0 ? 54 O ? L HOH . ? A HOH 317 ? 72_555 MG ? B MG . ? A MG 201 ? 1_555 O ? L HOH . ? A HOH 497 ? 51_555 90.0 ? 55 O ? L HOH . ? A HOH 352 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? L HOH . ? A HOH 497 ? 51_555 89.6 ? 56 O ? L HOH . ? A HOH 352 ? 72_555 MG ? B MG . ? A MG 201 ? 1_555 O ? L HOH . ? A HOH 497 ? 51_555 90.4 ? 57 O ? L HOH . ? A HOH 317 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? L HOH . ? A HOH 556 ? 22_555 180.0 ? 58 O ? L HOH . ? A HOH 317 ? 72_555 MG ? B MG . ? A MG 201 ? 1_555 O ? L HOH . ? A HOH 556 ? 22_555 180.0 ? 59 O ? L HOH . ? A HOH 352 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? L HOH . ? A HOH 556 ? 22_555 90.7 ? 60 O ? L HOH . ? A HOH 352 ? 72_555 MG ? B MG . ? A MG 201 ? 1_555 O ? L HOH . ? A HOH 556 ? 22_555 90.7 ? 61 O ? L HOH . ? A HOH 497 ? 51_555 MG ? B MG . ? A MG 201 ? 1_555 O ? L HOH . ? A HOH 556 ? 22_555 90.0 ? 62 O ? L HOH . ? A HOH 329 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? L HOH . ? A HOH 329 ? 6_555 90.8 ? 63 O ? L HOH . ? A HOH 329 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? L HOH . ? A HOH 495 ? 1_555 88.1 ? 64 O ? L HOH . ? A HOH 329 ? 6_555 MG ? C MG . ? A MG 202 ? 1_555 O ? L HOH . ? A HOH 495 ? 1_555 89.0 ? 65 O ? L HOH . ? A HOH 329 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? L HOH . ? A HOH 495 ? 6_555 178.9 ? 66 O ? L HOH . ? A HOH 329 ? 6_555 MG ? C MG . ? A MG 202 ? 1_555 O ? L HOH . ? A HOH 495 ? 6_555 88.1 ? 67 O ? L HOH . ? A HOH 495 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? L HOH . ? A HOH 495 ? 6_555 92.1 ? 68 O ? L HOH . ? A HOH 343 ? 6_555 MG ? D MG . ? A MG 203 ? 1_555 O ? L HOH . ? A HOH 377 ? 6_555 82.3 ? 69 O ? L HOH . ? A HOH 343 ? 6_555 MG ? D MG . ? A MG 203 ? 1_555 O ? L HOH . ? A HOH 396 ? 1_555 93.5 ? 70 O ? L HOH . ? A HOH 377 ? 6_555 MG ? D MG . ? A MG 203 ? 1_555 O ? L HOH . ? A HOH 396 ? 1_555 173.2 ? 71 O ? L HOH . ? A HOH 343 ? 6_555 MG ? D MG . ? A MG 203 ? 1_555 O ? L HOH . ? A HOH 443 ? 1_555 82.3 ? 72 O ? L HOH . ? A HOH 377 ? 6_555 MG ? D MG . ? A MG 203 ? 1_555 O ? L HOH . ? A HOH 443 ? 1_555 84.1 ? 73 O ? L HOH . ? A HOH 396 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? L HOH . ? A HOH 443 ? 1_555 90.1 ? 74 O ? L HOH . ? A HOH 343 ? 6_555 MG ? D MG . ? A MG 203 ? 1_555 O ? L HOH . ? A HOH 508 ? 1_555 163.3 ? 75 O ? L HOH . ? A HOH 377 ? 6_555 MG ? D MG . ? A MG 203 ? 1_555 O ? L HOH . ? A HOH 508 ? 1_555 83.6 ? 76 O ? L HOH . ? A HOH 396 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? L HOH . ? A HOH 508 ? 1_555 99.7 ? 77 O ? L HOH . ? A HOH 443 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? L HOH . ? A HOH 508 ? 1_555 87.3 ? 78 O ? L HOH . ? A HOH 344 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? L HOH . ? A HOH 459 ? 1_555 101.4 ? 79 O ? L HOH . ? A HOH 344 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? L HOH . ? A HOH 484 ? 1_555 85.1 ? 80 O ? L HOH . ? A HOH 459 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? L HOH . ? A HOH 484 ? 1_555 102.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-10-23 2 'Structure model' 1 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' pdbx_struct_conn_angle 6 2 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 17 2 'Structure model' '_pdbx_struct_conn_angle.value' 18 2 'Structure model' '_struct_conn.pdbx_dist_value' 19 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 2 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15.2_3472 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 6KE2 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 46 ? ? 71.41 39.85 2 1 GLU A 93 ? ? 76.75 -51.41 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A THR 3 ? A THR 3 4 1 Y 1 A ALA 4 ? A ALA 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A THR 6 ? A THR 6 7 1 Y 1 A ASP 176 ? A ASP 176 8 1 Y 1 A SER 177 ? A SER 177 9 1 Y 1 A ASP 178 ? A ASP 178 10 1 Y 1 A ASN 179 ? A ASN 179 11 1 Y 1 A GLU 180 ? A GLU 180 12 1 Y 1 A SER 181 ? A SER 181 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CL CL CL N N 75 CYS N N N N 76 CYS CA C N R 77 CYS C C N N 78 CYS O O N N 79 CYS CB C N N 80 CYS SG S N N 81 CYS OXT O N N 82 CYS H H N N 83 CYS H2 H N N 84 CYS HA H N N 85 CYS HB2 H N N 86 CYS HB3 H N N 87 CYS HG H N N 88 CYS HXT H N N 89 FE FE FE N N 90 GLN N N N N 91 GLN CA C N S 92 GLN C C N N 93 GLN O O N N 94 GLN CB C N N 95 GLN CG C N N 96 GLN CD C N N 97 GLN OE1 O N N 98 GLN NE2 N N N 99 GLN OXT O N N 100 GLN H H N N 101 GLN H2 H N N 102 GLN HA H N N 103 GLN HB2 H N N 104 GLN HB3 H N N 105 GLN HG2 H N N 106 GLN HG3 H N N 107 GLN HE21 H N N 108 GLN HE22 H N N 109 GLN HXT H N N 110 GLU N N N N 111 GLU CA C N S 112 GLU C C N N 113 GLU O O N N 114 GLU CB C N N 115 GLU CG C N N 116 GLU CD C N N 117 GLU OE1 O N N 118 GLU OE2 O N N 119 GLU OXT O N N 120 GLU H H N N 121 GLU H2 H N N 122 GLU HA H N N 123 GLU HB2 H N N 124 GLU HB3 H N N 125 GLU HG2 H N N 126 GLU HG3 H N N 127 GLU HE2 H N N 128 GLU HXT H N N 129 GLY N N N N 130 GLY CA C N N 131 GLY C C N N 132 GLY O O N N 133 GLY OXT O N N 134 GLY H H N N 135 GLY H2 H N N 136 GLY HA2 H N N 137 GLY HA3 H N N 138 GLY HXT H N N 139 HIS N N N N 140 HIS CA C N S 141 HIS C C N N 142 HIS O O N N 143 HIS CB C N N 144 HIS CG C Y N 145 HIS ND1 N Y N 146 HIS CD2 C Y N 147 HIS CE1 C Y N 148 HIS NE2 N Y N 149 HIS OXT O N N 150 HIS H H N N 151 HIS H2 H N N 152 HIS HA H N N 153 HIS HB2 H N N 154 HIS HB3 H N N 155 HIS HD1 H N N 156 HIS HD2 H N N 157 HIS HE1 H N N 158 HIS HE2 H N N 159 HIS HXT H N N 160 HOH O O N N 161 HOH H1 H N N 162 HOH H2 H N N 163 ILE N N N N 164 ILE CA C N S 165 ILE C C N N 166 ILE O O N N 167 ILE CB C N S 168 ILE CG1 C N N 169 ILE CG2 C N N 170 ILE CD1 C N N 171 ILE OXT O N N 172 ILE H H N N 173 ILE H2 H N N 174 ILE HA H N N 175 ILE HB H N N 176 ILE HG12 H N N 177 ILE HG13 H N N 178 ILE HG21 H N N 179 ILE HG22 H N N 180 ILE HG23 H N N 181 ILE HD11 H N N 182 ILE HD12 H N N 183 ILE HD13 H N N 184 ILE HXT H N N 185 LEU N N N N 186 LEU CA C N S 187 LEU C C N N 188 LEU O O N N 189 LEU CB C N N 190 LEU CG C N N 191 LEU CD1 C N N 192 LEU CD2 C N N 193 LEU OXT O N N 194 LEU H H N N 195 LEU H2 H N N 196 LEU HA H N N 197 LEU HB2 H N N 198 LEU HB3 H N N 199 LEU HG H N N 200 LEU HD11 H N N 201 LEU HD12 H N N 202 LEU HD13 H N N 203 LEU HD21 H N N 204 LEU HD22 H N N 205 LEU HD23 H N N 206 LEU HXT H N N 207 LYS N N N N 208 LYS CA C N S 209 LYS C C N N 210 LYS O O N N 211 LYS CB C N N 212 LYS CG C N N 213 LYS CD C N N 214 LYS CE C N N 215 LYS NZ N N N 216 LYS OXT O N N 217 LYS H H N N 218 LYS H2 H N N 219 LYS HA H N N 220 LYS HB2 H N N 221 LYS HB3 H N N 222 LYS HG2 H N N 223 LYS HG3 H N N 224 LYS HD2 H N N 225 LYS HD3 H N N 226 LYS HE2 H N N 227 LYS HE3 H N N 228 LYS HZ1 H N N 229 LYS HZ2 H N N 230 LYS HZ3 H N N 231 LYS HXT H N N 232 MET N N N N 233 MET CA C N S 234 MET C C N N 235 MET O O N N 236 MET CB C N N 237 MET CG C N N 238 MET SD S N N 239 MET CE C N N 240 MET OXT O N N 241 MET H H N N 242 MET H2 H N N 243 MET HA H N N 244 MET HB2 H N N 245 MET HB3 H N N 246 MET HG2 H N N 247 MET HG3 H N N 248 MET HE1 H N N 249 MET HE2 H N N 250 MET HE3 H N N 251 MET HXT H N N 252 MG MG MG N N 253 PHE N N N N 254 PHE CA C N S 255 PHE C C N N 256 PHE O O N N 257 PHE CB C N N 258 PHE CG C Y N 259 PHE CD1 C Y N 260 PHE CD2 C Y N 261 PHE CE1 C Y N 262 PHE CE2 C Y N 263 PHE CZ C Y N 264 PHE OXT O N N 265 PHE H H N N 266 PHE H2 H N N 267 PHE HA H N N 268 PHE HB2 H N N 269 PHE HB3 H N N 270 PHE HD1 H N N 271 PHE HD2 H N N 272 PHE HE1 H N N 273 PHE HE2 H N N 274 PHE HZ H N N 275 PHE HXT H N N 276 PRO N N N N 277 PRO CA C N S 278 PRO C C N N 279 PRO O O N N 280 PRO CB C N N 281 PRO CG C N N 282 PRO CD C N N 283 PRO OXT O N N 284 PRO H H N N 285 PRO HA H N N 286 PRO HB2 H N N 287 PRO HB3 H N N 288 PRO HG2 H N N 289 PRO HG3 H N N 290 PRO HD2 H N N 291 PRO HD3 H N N 292 PRO HXT H N N 293 SER N N N N 294 SER CA C N S 295 SER C C N N 296 SER O O N N 297 SER CB C N N 298 SER OG O N N 299 SER OXT O N N 300 SER H H N N 301 SER H2 H N N 302 SER HA H N N 303 SER HB2 H N N 304 SER HB3 H N N 305 SER HG H N N 306 SER HXT H N N 307 THR N N N N 308 THR CA C N S 309 THR C C N N 310 THR O O N N 311 THR CB C N R 312 THR OG1 O N N 313 THR CG2 C N N 314 THR OXT O N N 315 THR H H N N 316 THR H2 H N N 317 THR HA H N N 318 THR HB H N N 319 THR HG1 H N N 320 THR HG21 H N N 321 THR HG22 H N N 322 THR HG23 H N N 323 THR HXT H N N 324 TRP N N N N 325 TRP CA C N S 326 TRP C C N N 327 TRP O O N N 328 TRP CB C N N 329 TRP CG C Y N 330 TRP CD1 C Y N 331 TRP CD2 C Y N 332 TRP NE1 N Y N 333 TRP CE2 C Y N 334 TRP CE3 C Y N 335 TRP CZ2 C Y N 336 TRP CZ3 C Y N 337 TRP CH2 C Y N 338 TRP OXT O N N 339 TRP H H N N 340 TRP H2 H N N 341 TRP HA H N N 342 TRP HB2 H N N 343 TRP HB3 H N N 344 TRP HD1 H N N 345 TRP HE1 H N N 346 TRP HE3 H N N 347 TRP HZ2 H N N 348 TRP HZ3 H N N 349 TRP HH2 H N N 350 TRP HXT H N N 351 TYR N N N N 352 TYR CA C N S 353 TYR C C N N 354 TYR O O N N 355 TYR CB C N N 356 TYR CG C Y N 357 TYR CD1 C Y N 358 TYR CD2 C Y N 359 TYR CE1 C Y N 360 TYR CE2 C Y N 361 TYR CZ C Y N 362 TYR OH O N N 363 TYR OXT O N N 364 TYR H H N N 365 TYR H2 H N N 366 TYR HA H N N 367 TYR HB2 H N N 368 TYR HB3 H N N 369 TYR HD1 H N N 370 TYR HD2 H N N 371 TYR HE1 H N N 372 TYR HE2 H N N 373 TYR HH H N N 374 TYR HXT H N N 375 VAL N N N N 376 VAL CA C N S 377 VAL C C N N 378 VAL O O N N 379 VAL CB C N N 380 VAL CG1 C N N 381 VAL CG2 C N N 382 VAL OXT O N N 383 VAL H H N N 384 VAL H2 H N N 385 VAL HA H N N 386 VAL HB H N N 387 VAL HG11 H N N 388 VAL HG12 H N N 389 VAL HG13 H N N 390 VAL HG21 H N N 391 VAL HG22 H N N 392 VAL HG23 H N N 393 VAL HXT H N N 394 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China' _pdbx_audit_support.country China _pdbx_audit_support.grant_number '21601112, 21671125' _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id MG _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id MG _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 'FE (III) ION' FE 4 'CHLORIDE ION' CL 5 'CALCIUM ION' CA 6 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2FHA _pdbx_initial_refinement_model.details ? # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'native gel electrophoresis' ? 2 1 'gel filtration' ? #