data_6KY4 # _entry.id 6KY4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6KY4 pdb_00006ky4 10.2210/pdb6ky4/pdb WWPDB D_1300013830 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6KY4 _pdbx_database_status.recvd_initial_deposition_date 2019-09-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liu, M.' 1 ? 'Wang, J.' 2 ? 'Li, X.' 3 ? 'Li, M.' 4 ? 'Sylvanno, M.J.' 5 ? 'Zhang, M.' 6 ? 'Wang, M.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 520 _citation.language ? _citation.page_first 347 _citation.page_last 352 _citation.title 'The crystal structure of sulfiredoxin from Arabidopsis thaliana revealed a more robust antioxidant mechanism in plants.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2019.10.034 _citation.pdbx_database_id_PubMed 31604522 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, M.' 1 ? primary 'Wang, J.' 2 ? primary 'Li, X.' 3 ? primary 'Sylvanno, M.J.' 4 ? primary 'Li, M.' 5 ? primary 'Zhang, M.' 6 ? primary 'Wang, M.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6KY4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 102.544 _cell.length_a_esd ? _cell.length_b 102.544 _cell.length_b_esd ? _cell.length_c 102.544 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6KY4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 212 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Sulfiredoxin, chloroplastic/mitochondrial' 12769.820 1 1.8.98.2 ? ? ? 2 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201 1 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 2 ? ? ? ? 4 water nat water 18.015 4 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name AtSRX # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNGSPPVIGGSSGGVGPMIVELPLEKIRRPLMRTRSNDQNKVKELMDSIRQIGLQVPIDVIEVDGTYYGFSGCHRYEAHQ KLGLPTIRCKIRKGTKETLRHHLRLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MNGSPPVIGGSSGGVGPMIVELPLEKIRRPLMRTRSNDQNKVKELMDSIRQIGLQVPIDVIEVDGTYYGFSGCHRYEAHQ KLGLPTIRCKIRKGTKETLRHHLRLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 GLY n 1 4 SER n 1 5 PRO n 1 6 PRO n 1 7 VAL n 1 8 ILE n 1 9 GLY n 1 10 GLY n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 GLY n 1 15 VAL n 1 16 GLY n 1 17 PRO n 1 18 MET n 1 19 ILE n 1 20 VAL n 1 21 GLU n 1 22 LEU n 1 23 PRO n 1 24 LEU n 1 25 GLU n 1 26 LYS n 1 27 ILE n 1 28 ARG n 1 29 ARG n 1 30 PRO n 1 31 LEU n 1 32 MET n 1 33 ARG n 1 34 THR n 1 35 ARG n 1 36 SER n 1 37 ASN n 1 38 ASP n 1 39 GLN n 1 40 ASN n 1 41 LYS n 1 42 VAL n 1 43 LYS n 1 44 GLU n 1 45 LEU n 1 46 MET n 1 47 ASP n 1 48 SER n 1 49 ILE n 1 50 ARG n 1 51 GLN n 1 52 ILE n 1 53 GLY n 1 54 LEU n 1 55 GLN n 1 56 VAL n 1 57 PRO n 1 58 ILE n 1 59 ASP n 1 60 VAL n 1 61 ILE n 1 62 GLU n 1 63 VAL n 1 64 ASP n 1 65 GLY n 1 66 THR n 1 67 TYR n 1 68 TYR n 1 69 GLY n 1 70 PHE n 1 71 SER n 1 72 GLY n 1 73 CYS n 1 74 HIS n 1 75 ARG n 1 76 TYR n 1 77 GLU n 1 78 ALA n 1 79 HIS n 1 80 GLN n 1 81 LYS n 1 82 LEU n 1 83 GLY n 1 84 LEU n 1 85 PRO n 1 86 THR n 1 87 ILE n 1 88 ARG n 1 89 CYS n 1 90 LYS n 1 91 ILE n 1 92 ARG n 1 93 LYS n 1 94 GLY n 1 95 THR n 1 96 LYS n 1 97 GLU n 1 98 THR n 1 99 LEU n 1 100 ARG n 1 101 HIS n 1 102 HIS n 1 103 LEU n 1 104 ARG n 1 105 LEU n 1 106 GLU n 1 107 HIS n 1 108 HIS n 1 109 HIS n 1 110 HIS n 1 111 HIS n 1 112 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 112 _entity_src_gen.gene_src_common_name 'Mouse-ear cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SRX, At1g31170, F28K20.12' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET22b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SRX_ARATH _struct_ref.pdbx_db_accession Q8GY89 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NGSPPVIGGSSGGVGPMIVELPLEKIRRPLMRTRSNDQNKVKELMDSIRQIGLQVPIDVIEVDGTYYGFSGCHRYEAHQK LGLPTIRCKIRKGTKETLRHHLR ; _struct_ref.pdbx_align_begin 23 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6KY4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8GY89 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 125 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 103 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6KY4 MET A 1 ? UNP Q8GY89 ? ? 'initiating methionine' 0 1 1 6KY4 LEU A 105 ? UNP Q8GY89 ? ? 'expression tag' 104 2 1 6KY4 GLU A 106 ? UNP Q8GY89 ? ? 'expression tag' 105 3 1 6KY4 HIS A 107 ? UNP Q8GY89 ? ? 'expression tag' 106 4 1 6KY4 HIS A 108 ? UNP Q8GY89 ? ? 'expression tag' 107 5 1 6KY4 HIS A 109 ? UNP Q8GY89 ? ? 'expression tag' 108 6 1 6KY4 HIS A 110 ? UNP Q8GY89 ? ? 'expression tag' 109 7 1 6KY4 HIS A 111 ? UNP Q8GY89 ? ? 'expression tag' 110 8 1 6KY4 HIS A 112 ? UNP Q8GY89 ? ? 'expression tag' 111 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ADP non-polymer n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6KY4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.52 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 65.04 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.8 M NaH2PO4/1.2 M KH2PO4, acetate pH 4.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-06-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6KY4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.200 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3377 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 37.000 _reflns.pdbx_Rmerge_I_obs 0.098 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.054 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.099 _reflns.pdbx_Rpim_I_all 0.018 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 124863 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 3.200 3.310 ? ? ? ? ? ? 330 100.000 ? ? ? ? 2.261 ? ? ? ? ? ? ? ? 37.200 ? 0.908 ? ? 2.292 0.372 ? 1 1 0.851 ? 3.310 3.450 ? ? ? ? ? ? 318 100.000 ? ? ? ? 1.248 ? ? ? ? ? ? ? ? 43.100 ? 1.094 ? ? 1.263 0.191 ? 2 1 0.946 ? 3.450 3.600 ? ? ? ? ? ? 329 100.000 ? ? ? ? 0.668 ? ? ? ? ? ? ? ? 42.800 ? 1.055 ? ? 0.677 0.103 ? 3 1 0.983 ? 3.600 3.790 ? ? ? ? ? ? 323 100.000 ? ? ? ? 0.381 ? ? ? ? ? ? ? ? 41.400 ? 1.125 ? ? 0.386 0.060 ? 4 1 0.990 ? 3.790 4.030 ? ? ? ? ? ? 326 100.000 ? ? ? ? 0.259 ? ? ? ? ? ? ? ? 39.500 ? 1.258 ? ? 0.262 0.042 ? 5 1 0.996 ? 4.030 4.340 ? ? ? ? ? ? 329 100.000 ? ? ? ? 0.148 ? ? ? ? ? ? ? ? 38.500 ? 1.055 ? ? 0.150 0.024 ? 6 1 0.999 ? 4.340 4.780 ? ? ? ? ? ? 333 100.000 ? ? ? ? 0.100 ? ? ? ? ? ? ? ? 33.800 ? 0.976 ? ? 0.101 0.017 ? 7 1 0.999 ? 4.780 5.470 ? ? ? ? ? ? 343 100.000 ? ? ? ? 0.090 ? ? ? ? ? ? ? ? 36.200 ? 1.029 ? ? 0.091 0.015 ? 8 1 0.999 ? 5.470 6.890 ? ? ? ? ? ? 351 100.000 ? ? ? ? 0.075 ? ? ? ? ? ? ? ? 35.200 ? 0.984 ? ? 0.076 0.013 ? 9 1 0.999 ? 6.890 50.000 ? ? ? ? ? ? 395 99.000 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 24.900 ? 1.026 ? ? 0.074 0.015 ? 10 1 0.998 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 104.520 _refine.B_iso_mean 66.2696 _refine.B_iso_min 38.510 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6KY4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.20 _refine.ls_d_res_low 41.8630 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3335 _refine.ls_number_reflns_R_free 334 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6100 _refine.ls_percent_reflns_R_free 10.0100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2492 _refine.ls_R_factor_R_free 0.2938 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2443 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1xw3 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.5600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.20 _refine_hist.d_res_low 41.8630 _refine_hist.number_atoms_solvent 4 _refine_hist.number_atoms_total 771 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 89 _refine_hist.pdbx_B_iso_mean_ligand 70.73 _refine_hist.pdbx_B_iso_mean_solvent 49.16 _refine_hist.pdbx_number_atoms_protein 730 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 37 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.20 4.0348 . . 161 1448 100.0000 . . . 0.3314 0.0000 0.2894 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0348 41.86 . . 173 1553 100.0000 . . . 0.2754 0.0000 0.2224 . . . . . . . . . . # _struct.entry_id 6KY4 _struct.title 'Crystal structure of Sulfiredoxin from Arabidopsis thaliana' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6KY4 _struct_keywords.text 'sulfiredoxin, cysteine, sulfinic acid, peroxiredoxin repair protein, arabidopsis thaliana, antioxidant, oxidoreductase' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 29 ? ARG A 35 ? ARG A 28 ARG A 34 5 ? 7 HELX_P HELX_P2 AA2 ASP A 38 ? GLY A 53 ? ASP A 37 GLY A 52 1 ? 16 HELX_P HELX_P3 AA3 GLY A 72 ? LEU A 82 ? GLY A 71 LEU A 81 1 ? 11 HELX_P HELX_P4 AA4 THR A 95 ? LEU A 103 ? THR A 94 LEU A 102 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 19 ? PRO A 23 ? ILE A 18 PRO A 22 AA1 2 THR A 86 ? LYS A 93 ? THR A 85 LYS A 92 AA1 3 ILE A 58 ? VAL A 63 ? ILE A 57 VAL A 62 AA1 4 THR A 66 ? TYR A 68 ? THR A 65 TYR A 67 AA1 5 ILE A 27 ? ARG A 28 ? ILE A 26 ARG A 27 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 20 ? N VAL A 19 O CYS A 89 ? O CYS A 88 AA1 2 3 O ARG A 92 ? O ARG A 91 N VAL A 60 ? N VAL A 59 AA1 3 4 N VAL A 63 ? N VAL A 62 O THR A 66 ? O THR A 65 AA1 4 5 O TYR A 67 ? O TYR A 66 N ARG A 28 ? N ARG A 27 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ADP 201 ? 14 'binding site for residue ADP A 201' AC2 Software A PO4 202 ? 4 'binding site for residue PO4 A 202' AC3 Software A PO4 203 ? 4 'binding site for residue PO4 A 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 LEU A 45 ? LEU A 44 . ? 1_555 ? 2 AC1 14 SER A 48 ? SER A 47 . ? 1_555 ? 3 AC1 14 GLY A 53 ? GLY A 52 . ? 1_555 ? 4 AC1 14 LEU A 54 ? LEU A 53 . ? 1_555 ? 5 AC1 14 GLN A 55 ? GLN A 54 . ? 1_555 ? 6 AC1 14 VAL A 56 ? VAL A 55 . ? 1_555 ? 7 AC1 14 GLY A 72 ? GLY A 71 . ? 1_555 ? 8 AC1 14 CYS A 73 ? CYS A 72 . ? 1_555 ? 9 AC1 14 HIS A 74 ? HIS A 73 . ? 1_555 ? 10 AC1 14 ARG A 75 ? ARG A 74 . ? 1_555 ? 11 AC1 14 LYS A 96 ? LYS A 95 . ? 15_445 ? 12 AC1 14 LEU A 99 ? LEU A 98 . ? 15_445 ? 13 AC1 14 ARG A 100 ? ARG A 99 . ? 15_445 ? 14 AC1 14 PO4 D . ? PO4 A 203 . ? 1_555 ? 15 AC2 4 SER A 36 ? SER A 35 . ? 1_555 ? 16 AC2 4 ASN A 37 ? ASN A 36 . ? 1_555 ? 17 AC2 4 ASP A 38 ? ASP A 37 . ? 1_555 ? 18 AC2 4 HIS A 74 ? HIS A 73 . ? 1_555 ? 19 AC3 4 SER A 71 ? SER A 70 . ? 1_555 ? 20 AC3 4 GLY A 72 ? GLY A 71 . ? 1_555 ? 21 AC3 4 CYS A 73 ? CYS A 72 . ? 1_555 ? 22 AC3 4 ADP B . ? ADP A 201 . ? 1_555 ? # _atom_sites.entry_id 6KY4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009752 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009752 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009752 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 ASN 2 1 ? ? ? A . n A 1 3 GLY 3 2 ? ? ? A . n A 1 4 SER 4 3 ? ? ? A . n A 1 5 PRO 5 4 ? ? ? A . n A 1 6 PRO 6 5 ? ? ? A . n A 1 7 VAL 7 6 ? ? ? A . n A 1 8 ILE 8 7 ? ? ? A . n A 1 9 GLY 9 8 ? ? ? A . n A 1 10 GLY 10 9 ? ? ? A . n A 1 11 SER 11 10 ? ? ? A . n A 1 12 SER 12 11 ? ? ? A . n A 1 13 GLY 13 12 ? ? ? A . n A 1 14 GLY 14 13 ? ? ? A . n A 1 15 VAL 15 14 ? ? ? A . n A 1 16 GLY 16 15 ? ? ? A . n A 1 17 PRO 17 16 16 PRO PRO A . n A 1 18 MET 18 17 17 MET MET A . n A 1 19 ILE 19 18 18 ILE ILE A . n A 1 20 VAL 20 19 19 VAL VAL A . n A 1 21 GLU 21 20 20 GLU GLU A . n A 1 22 LEU 22 21 21 LEU LEU A . n A 1 23 PRO 23 22 22 PRO PRO A . n A 1 24 LEU 24 23 23 LEU LEU A . n A 1 25 GLU 25 24 24 GLU GLU A . n A 1 26 LYS 26 25 25 LYS LYS A . n A 1 27 ILE 27 26 26 ILE ILE A . n A 1 28 ARG 28 27 27 ARG ARG A . n A 1 29 ARG 29 28 28 ARG ARG A . n A 1 30 PRO 30 29 29 PRO PRO A . n A 1 31 LEU 31 30 30 LEU LEU A . n A 1 32 MET 32 31 31 MET MET A . n A 1 33 ARG 33 32 32 ARG ARG A . n A 1 34 THR 34 33 33 THR THR A . n A 1 35 ARG 35 34 34 ARG ARG A . n A 1 36 SER 36 35 35 SER SER A . n A 1 37 ASN 37 36 36 ASN ASN A . n A 1 38 ASP 38 37 37 ASP ASP A . n A 1 39 GLN 39 38 38 GLN GLN A . n A 1 40 ASN 40 39 39 ASN ASN A . n A 1 41 LYS 41 40 40 LYS LYS A . n A 1 42 VAL 42 41 41 VAL VAL A . n A 1 43 LYS 43 42 42 LYS LYS A . n A 1 44 GLU 44 43 43 GLU GLU A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 MET 46 45 45 MET MET A . n A 1 47 ASP 47 46 46 ASP ASP A . n A 1 48 SER 48 47 47 SER SER A . n A 1 49 ILE 49 48 48 ILE ILE A . n A 1 50 ARG 50 49 49 ARG ARG A . n A 1 51 GLN 51 50 50 GLN GLN A . n A 1 52 ILE 52 51 51 ILE ILE A . n A 1 53 GLY 53 52 52 GLY GLY A . n A 1 54 LEU 54 53 53 LEU LEU A . n A 1 55 GLN 55 54 54 GLN GLN A . n A 1 56 VAL 56 55 55 VAL VAL A . n A 1 57 PRO 57 56 56 PRO PRO A . n A 1 58 ILE 58 57 57 ILE ILE A . n A 1 59 ASP 59 58 58 ASP ASP A . n A 1 60 VAL 60 59 59 VAL VAL A . n A 1 61 ILE 61 60 60 ILE ILE A . n A 1 62 GLU 62 61 61 GLU GLU A . n A 1 63 VAL 63 62 62 VAL VAL A . n A 1 64 ASP 64 63 63 ASP ASP A . n A 1 65 GLY 65 64 64 GLY GLY A . n A 1 66 THR 66 65 65 THR THR A . n A 1 67 TYR 67 66 66 TYR TYR A . n A 1 68 TYR 68 67 67 TYR TYR A . n A 1 69 GLY 69 68 68 GLY GLY A . n A 1 70 PHE 70 69 69 PHE PHE A . n A 1 71 SER 71 70 70 SER SER A . n A 1 72 GLY 72 71 71 GLY GLY A . n A 1 73 CYS 73 72 72 CYS CYS A . n A 1 74 HIS 74 73 73 HIS HIS A . n A 1 75 ARG 75 74 74 ARG ARG A . n A 1 76 TYR 76 75 75 TYR TYR A . n A 1 77 GLU 77 76 76 GLU GLU A . n A 1 78 ALA 78 77 77 ALA ALA A . n A 1 79 HIS 79 78 78 HIS HIS A . n A 1 80 GLN 80 79 79 GLN GLN A . n A 1 81 LYS 81 80 80 LYS LYS A . n A 1 82 LEU 82 81 81 LEU LEU A . n A 1 83 GLY 83 82 82 GLY GLY A . n A 1 84 LEU 84 83 83 LEU LEU A . n A 1 85 PRO 85 84 84 PRO PRO A . n A 1 86 THR 86 85 85 THR THR A . n A 1 87 ILE 87 86 86 ILE ILE A . n A 1 88 ARG 88 87 87 ARG ARG A . n A 1 89 CYS 89 88 88 CYS CYS A . n A 1 90 LYS 90 89 89 LYS LYS A . n A 1 91 ILE 91 90 90 ILE ILE A . n A 1 92 ARG 92 91 91 ARG ARG A . n A 1 93 LYS 93 92 92 LYS LYS A . n A 1 94 GLY 94 93 93 GLY GLY A . n A 1 95 THR 95 94 94 THR THR A . n A 1 96 LYS 96 95 95 LYS LYS A . n A 1 97 GLU 97 96 96 GLU GLU A . n A 1 98 THR 98 97 97 THR THR A . n A 1 99 LEU 99 98 98 LEU LEU A . n A 1 100 ARG 100 99 99 ARG ARG A . n A 1 101 HIS 101 100 100 HIS HIS A . n A 1 102 HIS 102 101 101 HIS HIS A . n A 1 103 LEU 103 102 102 LEU LEU A . n A 1 104 ARG 104 103 103 ARG ARG A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 GLU 106 105 ? ? ? A . n A 1 107 HIS 107 106 ? ? ? A . n A 1 108 HIS 108 107 ? ? ? A . n A 1 109 HIS 109 108 ? ? ? A . n A 1 110 HIS 110 109 ? ? ? A . n A 1 111 HIS 111 110 ? ? ? A . n A 1 112 HIS 112 111 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ADP 1 201 1 ADP ADP A . C 3 PO4 1 202 1 PO4 PO4 A . D 3 PO4 1 203 2 PO4 PO4 A . E 4 HOH 1 301 2 HOH HOH A . E 4 HOH 2 302 1 HOH HOH A . E 4 HOH 3 303 4 HOH HOH A . E 4 HOH 4 304 3 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 760 ? 1 MORE -11 ? 1 'SSA (A^2)' 6170 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-10-16 2 'Structure model' 1 1 2019-10-23 3 'Structure model' 1 2 2019-11-13 4 'Structure model' 1 3 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_citation_author.name' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' 7 4 'Structure model' '_database_2.pdbx_DOI' 8 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 6KY4 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 33 ? ? -102.57 64.58 2 1 ARG A 34 ? ? -104.94 67.37 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A ASN 1 ? A ASN 2 3 1 Y 1 A GLY 2 ? A GLY 3 4 1 Y 1 A SER 3 ? A SER 4 5 1 Y 1 A PRO 4 ? A PRO 5 6 1 Y 1 A PRO 5 ? A PRO 6 7 1 Y 1 A VAL 6 ? A VAL 7 8 1 Y 1 A ILE 7 ? A ILE 8 9 1 Y 1 A GLY 8 ? A GLY 9 10 1 Y 1 A GLY 9 ? A GLY 10 11 1 Y 1 A SER 10 ? A SER 11 12 1 Y 1 A SER 11 ? A SER 12 13 1 Y 1 A GLY 12 ? A GLY 13 14 1 Y 1 A GLY 13 ? A GLY 14 15 1 Y 1 A VAL 14 ? A VAL 15 16 1 Y 1 A GLY 15 ? A GLY 16 17 1 Y 1 A GLU 105 ? A GLU 106 18 1 Y 1 A HIS 106 ? A HIS 107 19 1 Y 1 A HIS 107 ? A HIS 108 20 1 Y 1 A HIS 108 ? A HIS 109 21 1 Y 1 A HIS 109 ? A HIS 110 22 1 Y 1 A HIS 110 ? A HIS 111 23 1 Y 1 A HIS 111 ? A HIS 112 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ADP PB P N N 1 ADP O1B O N N 2 ADP O2B O N N 3 ADP O3B O N N 4 ADP PA P N S 5 ADP O1A O N N 6 ADP O2A O N N 7 ADP O3A O N N 8 ADP "O5'" O N N 9 ADP "C5'" C N N 10 ADP "C4'" C N R 11 ADP "O4'" O N N 12 ADP "C3'" C N S 13 ADP "O3'" O N N 14 ADP "C2'" C N R 15 ADP "O2'" O N N 16 ADP "C1'" C N R 17 ADP N9 N Y N 18 ADP C8 C Y N 19 ADP N7 N Y N 20 ADP C5 C Y N 21 ADP C6 C Y N 22 ADP N6 N N N 23 ADP N1 N Y N 24 ADP C2 C Y N 25 ADP N3 N Y N 26 ADP C4 C Y N 27 ADP HOB2 H N N 28 ADP HOB3 H N N 29 ADP HOA2 H N N 30 ADP "H5'1" H N N 31 ADP "H5'2" H N N 32 ADP "H4'" H N N 33 ADP "H3'" H N N 34 ADP "HO3'" H N N 35 ADP "H2'" H N N 36 ADP "HO2'" H N N 37 ADP "H1'" H N N 38 ADP H8 H N N 39 ADP HN61 H N N 40 ADP HN62 H N N 41 ADP H2 H N N 42 ALA N N N N 43 ALA CA C N S 44 ALA C C N N 45 ALA O O N N 46 ALA CB C N N 47 ALA OXT O N N 48 ALA H H N N 49 ALA H2 H N N 50 ALA HA H N N 51 ALA HB1 H N N 52 ALA HB2 H N N 53 ALA HB3 H N N 54 ALA HXT H N N 55 ARG N N N N 56 ARG CA C N S 57 ARG C C N N 58 ARG O O N N 59 ARG CB C N N 60 ARG CG C N N 61 ARG CD C N N 62 ARG NE N N N 63 ARG CZ C N N 64 ARG NH1 N N N 65 ARG NH2 N N N 66 ARG OXT O N N 67 ARG H H N N 68 ARG H2 H N N 69 ARG HA H N N 70 ARG HB2 H N N 71 ARG HB3 H N N 72 ARG HG2 H N N 73 ARG HG3 H N N 74 ARG HD2 H N N 75 ARG HD3 H N N 76 ARG HE H N N 77 ARG HH11 H N N 78 ARG HH12 H N N 79 ARG HH21 H N N 80 ARG HH22 H N N 81 ARG HXT H N N 82 ASN N N N N 83 ASN CA C N S 84 ASN C C N N 85 ASN O O N N 86 ASN CB C N N 87 ASN CG C N N 88 ASN OD1 O N N 89 ASN ND2 N N N 90 ASN OXT O N N 91 ASN H H N N 92 ASN H2 H N N 93 ASN HA H N N 94 ASN HB2 H N N 95 ASN HB3 H N N 96 ASN HD21 H N N 97 ASN HD22 H N N 98 ASN HXT H N N 99 ASP N N N N 100 ASP CA C N S 101 ASP C C N N 102 ASP O O N N 103 ASP CB C N N 104 ASP CG C N N 105 ASP OD1 O N N 106 ASP OD2 O N N 107 ASP OXT O N N 108 ASP H H N N 109 ASP H2 H N N 110 ASP HA H N N 111 ASP HB2 H N N 112 ASP HB3 H N N 113 ASP HD2 H N N 114 ASP HXT H N N 115 CYS N N N N 116 CYS CA C N R 117 CYS C C N N 118 CYS O O N N 119 CYS CB C N N 120 CYS SG S N N 121 CYS OXT O N N 122 CYS H H N N 123 CYS H2 H N N 124 CYS HA H N N 125 CYS HB2 H N N 126 CYS HB3 H N N 127 CYS HG H N N 128 CYS HXT H N N 129 GLN N N N N 130 GLN CA C N S 131 GLN C C N N 132 GLN O O N N 133 GLN CB C N N 134 GLN CG C N N 135 GLN CD C N N 136 GLN OE1 O N N 137 GLN NE2 N N N 138 GLN OXT O N N 139 GLN H H N N 140 GLN H2 H N N 141 GLN HA H N N 142 GLN HB2 H N N 143 GLN HB3 H N N 144 GLN HG2 H N N 145 GLN HG3 H N N 146 GLN HE21 H N N 147 GLN HE22 H N N 148 GLN HXT H N N 149 GLU N N N N 150 GLU CA C N S 151 GLU C C N N 152 GLU O O N N 153 GLU CB C N N 154 GLU CG C N N 155 GLU CD C N N 156 GLU OE1 O N N 157 GLU OE2 O N N 158 GLU OXT O N N 159 GLU H H N N 160 GLU H2 H N N 161 GLU HA H N N 162 GLU HB2 H N N 163 GLU HB3 H N N 164 GLU HG2 H N N 165 GLU HG3 H N N 166 GLU HE2 H N N 167 GLU HXT H N N 168 GLY N N N N 169 GLY CA C N N 170 GLY C C N N 171 GLY O O N N 172 GLY OXT O N N 173 GLY H H N N 174 GLY H2 H N N 175 GLY HA2 H N N 176 GLY HA3 H N N 177 GLY HXT H N N 178 HIS N N N N 179 HIS CA C N S 180 HIS C C N N 181 HIS O O N N 182 HIS CB C N N 183 HIS CG C Y N 184 HIS ND1 N Y N 185 HIS CD2 C Y N 186 HIS CE1 C Y N 187 HIS NE2 N Y N 188 HIS OXT O N N 189 HIS H H N N 190 HIS H2 H N N 191 HIS HA H N N 192 HIS HB2 H N N 193 HIS HB3 H N N 194 HIS HD1 H N N 195 HIS HD2 H N N 196 HIS HE1 H N N 197 HIS HE2 H N N 198 HIS HXT H N N 199 HOH O O N N 200 HOH H1 H N N 201 HOH H2 H N N 202 ILE N N N N 203 ILE CA C N S 204 ILE C C N N 205 ILE O O N N 206 ILE CB C N S 207 ILE CG1 C N N 208 ILE CG2 C N N 209 ILE CD1 C N N 210 ILE OXT O N N 211 ILE H H N N 212 ILE H2 H N N 213 ILE HA H N N 214 ILE HB H N N 215 ILE HG12 H N N 216 ILE HG13 H N N 217 ILE HG21 H N N 218 ILE HG22 H N N 219 ILE HG23 H N N 220 ILE HD11 H N N 221 ILE HD12 H N N 222 ILE HD13 H N N 223 ILE HXT H N N 224 LEU N N N N 225 LEU CA C N S 226 LEU C C N N 227 LEU O O N N 228 LEU CB C N N 229 LEU CG C N N 230 LEU CD1 C N N 231 LEU CD2 C N N 232 LEU OXT O N N 233 LEU H H N N 234 LEU H2 H N N 235 LEU HA H N N 236 LEU HB2 H N N 237 LEU HB3 H N N 238 LEU HG H N N 239 LEU HD11 H N N 240 LEU HD12 H N N 241 LEU HD13 H N N 242 LEU HD21 H N N 243 LEU HD22 H N N 244 LEU HD23 H N N 245 LEU HXT H N N 246 LYS N N N N 247 LYS CA C N S 248 LYS C C N N 249 LYS O O N N 250 LYS CB C N N 251 LYS CG C N N 252 LYS CD C N N 253 LYS CE C N N 254 LYS NZ N N N 255 LYS OXT O N N 256 LYS H H N N 257 LYS H2 H N N 258 LYS HA H N N 259 LYS HB2 H N N 260 LYS HB3 H N N 261 LYS HG2 H N N 262 LYS HG3 H N N 263 LYS HD2 H N N 264 LYS HD3 H N N 265 LYS HE2 H N N 266 LYS HE3 H N N 267 LYS HZ1 H N N 268 LYS HZ2 H N N 269 LYS HZ3 H N N 270 LYS HXT H N N 271 MET N N N N 272 MET CA C N S 273 MET C C N N 274 MET O O N N 275 MET CB C N N 276 MET CG C N N 277 MET SD S N N 278 MET CE C N N 279 MET OXT O N N 280 MET H H N N 281 MET H2 H N N 282 MET HA H N N 283 MET HB2 H N N 284 MET HB3 H N N 285 MET HG2 H N N 286 MET HG3 H N N 287 MET HE1 H N N 288 MET HE2 H N N 289 MET HE3 H N N 290 MET HXT H N N 291 PHE N N N N 292 PHE CA C N S 293 PHE C C N N 294 PHE O O N N 295 PHE CB C N N 296 PHE CG C Y N 297 PHE CD1 C Y N 298 PHE CD2 C Y N 299 PHE CE1 C Y N 300 PHE CE2 C Y N 301 PHE CZ C Y N 302 PHE OXT O N N 303 PHE H H N N 304 PHE H2 H N N 305 PHE HA H N N 306 PHE HB2 H N N 307 PHE HB3 H N N 308 PHE HD1 H N N 309 PHE HD2 H N N 310 PHE HE1 H N N 311 PHE HE2 H N N 312 PHE HZ H N N 313 PHE HXT H N N 314 PO4 P P N N 315 PO4 O1 O N N 316 PO4 O2 O N N 317 PO4 O3 O N N 318 PO4 O4 O N N 319 PRO N N N N 320 PRO CA C N S 321 PRO C C N N 322 PRO O O N N 323 PRO CB C N N 324 PRO CG C N N 325 PRO CD C N N 326 PRO OXT O N N 327 PRO H H N N 328 PRO HA H N N 329 PRO HB2 H N N 330 PRO HB3 H N N 331 PRO HG2 H N N 332 PRO HG3 H N N 333 PRO HD2 H N N 334 PRO HD3 H N N 335 PRO HXT H N N 336 SER N N N N 337 SER CA C N S 338 SER C C N N 339 SER O O N N 340 SER CB C N N 341 SER OG O N N 342 SER OXT O N N 343 SER H H N N 344 SER H2 H N N 345 SER HA H N N 346 SER HB2 H N N 347 SER HB3 H N N 348 SER HG H N N 349 SER HXT H N N 350 THR N N N N 351 THR CA C N S 352 THR C C N N 353 THR O O N N 354 THR CB C N R 355 THR OG1 O N N 356 THR CG2 C N N 357 THR OXT O N N 358 THR H H N N 359 THR H2 H N N 360 THR HA H N N 361 THR HB H N N 362 THR HG1 H N N 363 THR HG21 H N N 364 THR HG22 H N N 365 THR HG23 H N N 366 THR HXT H N N 367 TYR N N N N 368 TYR CA C N S 369 TYR C C N N 370 TYR O O N N 371 TYR CB C N N 372 TYR CG C Y N 373 TYR CD1 C Y N 374 TYR CD2 C Y N 375 TYR CE1 C Y N 376 TYR CE2 C Y N 377 TYR CZ C Y N 378 TYR OH O N N 379 TYR OXT O N N 380 TYR H H N N 381 TYR H2 H N N 382 TYR HA H N N 383 TYR HB2 H N N 384 TYR HB3 H N N 385 TYR HD1 H N N 386 TYR HD2 H N N 387 TYR HE1 H N N 388 TYR HE2 H N N 389 TYR HH H N N 390 TYR HXT H N N 391 VAL N N N N 392 VAL CA C N S 393 VAL C C N N 394 VAL O O N N 395 VAL CB C N N 396 VAL CG1 C N N 397 VAL CG2 C N N 398 VAL OXT O N N 399 VAL H H N N 400 VAL H2 H N N 401 VAL HA H N N 402 VAL HB H N N 403 VAL HG11 H N N 404 VAL HG12 H N N 405 VAL HG13 H N N 406 VAL HG21 H N N 407 VAL HG22 H N N 408 VAL HG23 H N N 409 VAL HXT H N N 410 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ADP PB O1B doub N N 1 ADP PB O2B sing N N 2 ADP PB O3B sing N N 3 ADP PB O3A sing N N 4 ADP O2B HOB2 sing N N 5 ADP O3B HOB3 sing N N 6 ADP PA O1A doub N N 7 ADP PA O2A sing N N 8 ADP PA O3A sing N N 9 ADP PA "O5'" sing N N 10 ADP O2A HOA2 sing N N 11 ADP "O5'" "C5'" sing N N 12 ADP "C5'" "C4'" sing N N 13 ADP "C5'" "H5'1" sing N N 14 ADP "C5'" "H5'2" sing N N 15 ADP "C4'" "O4'" sing N N 16 ADP "C4'" "C3'" sing N N 17 ADP "C4'" "H4'" sing N N 18 ADP "O4'" "C1'" sing N N 19 ADP "C3'" "O3'" sing N N 20 ADP "C3'" "C2'" sing N N 21 ADP "C3'" "H3'" sing N N 22 ADP "O3'" "HO3'" sing N N 23 ADP "C2'" "O2'" sing N N 24 ADP "C2'" "C1'" sing N N 25 ADP "C2'" "H2'" sing N N 26 ADP "O2'" "HO2'" sing N N 27 ADP "C1'" N9 sing N N 28 ADP "C1'" "H1'" sing N N 29 ADP N9 C8 sing Y N 30 ADP N9 C4 sing Y N 31 ADP C8 N7 doub Y N 32 ADP C8 H8 sing N N 33 ADP N7 C5 sing Y N 34 ADP C5 C6 sing Y N 35 ADP C5 C4 doub Y N 36 ADP C6 N6 sing N N 37 ADP C6 N1 doub Y N 38 ADP N6 HN61 sing N N 39 ADP N6 HN62 sing N N 40 ADP N1 C2 sing Y N 41 ADP C2 N3 doub Y N 42 ADP C2 H2 sing N N 43 ADP N3 C4 sing Y N 44 ALA N CA sing N N 45 ALA N H sing N N 46 ALA N H2 sing N N 47 ALA CA C sing N N 48 ALA CA CB sing N N 49 ALA CA HA sing N N 50 ALA C O doub N N 51 ALA C OXT sing N N 52 ALA CB HB1 sing N N 53 ALA CB HB2 sing N N 54 ALA CB HB3 sing N N 55 ALA OXT HXT sing N N 56 ARG N CA sing N N 57 ARG N H sing N N 58 ARG N H2 sing N N 59 ARG CA C sing N N 60 ARG CA CB sing N N 61 ARG CA HA sing N N 62 ARG C O doub N N 63 ARG C OXT sing N N 64 ARG CB CG sing N N 65 ARG CB HB2 sing N N 66 ARG CB HB3 sing N N 67 ARG CG CD sing N N 68 ARG CG HG2 sing N N 69 ARG CG HG3 sing N N 70 ARG CD NE sing N N 71 ARG CD HD2 sing N N 72 ARG CD HD3 sing N N 73 ARG NE CZ sing N N 74 ARG NE HE sing N N 75 ARG CZ NH1 sing N N 76 ARG CZ NH2 doub N N 77 ARG NH1 HH11 sing N N 78 ARG NH1 HH12 sing N N 79 ARG NH2 HH21 sing N N 80 ARG NH2 HH22 sing N N 81 ARG OXT HXT sing N N 82 ASN N CA sing N N 83 ASN N H sing N N 84 ASN N H2 sing N N 85 ASN CA C sing N N 86 ASN CA CB sing N N 87 ASN CA HA sing N N 88 ASN C O doub N N 89 ASN C OXT sing N N 90 ASN CB CG sing N N 91 ASN CB HB2 sing N N 92 ASN CB HB3 sing N N 93 ASN CG OD1 doub N N 94 ASN CG ND2 sing N N 95 ASN ND2 HD21 sing N N 96 ASN ND2 HD22 sing N N 97 ASN OXT HXT sing N N 98 ASP N CA sing N N 99 ASP N H sing N N 100 ASP N H2 sing N N 101 ASP CA C sing N N 102 ASP CA CB sing N N 103 ASP CA HA sing N N 104 ASP C O doub N N 105 ASP C OXT sing N N 106 ASP CB CG sing N N 107 ASP CB HB2 sing N N 108 ASP CB HB3 sing N N 109 ASP CG OD1 doub N N 110 ASP CG OD2 sing N N 111 ASP OD2 HD2 sing N N 112 ASP OXT HXT sing N N 113 CYS N CA sing N N 114 CYS N H sing N N 115 CYS N H2 sing N N 116 CYS CA C sing N N 117 CYS CA CB sing N N 118 CYS CA HA sing N N 119 CYS C O doub N N 120 CYS C OXT sing N N 121 CYS CB SG sing N N 122 CYS CB HB2 sing N N 123 CYS CB HB3 sing N N 124 CYS SG HG sing N N 125 CYS OXT HXT sing N N 126 GLN N CA sing N N 127 GLN N H sing N N 128 GLN N H2 sing N N 129 GLN CA C sing N N 130 GLN CA CB sing N N 131 GLN CA HA sing N N 132 GLN C O doub N N 133 GLN C OXT sing N N 134 GLN CB CG sing N N 135 GLN CB HB2 sing N N 136 GLN CB HB3 sing N N 137 GLN CG CD sing N N 138 GLN CG HG2 sing N N 139 GLN CG HG3 sing N N 140 GLN CD OE1 doub N N 141 GLN CD NE2 sing N N 142 GLN NE2 HE21 sing N N 143 GLN NE2 HE22 sing N N 144 GLN OXT HXT sing N N 145 GLU N CA sing N N 146 GLU N H sing N N 147 GLU N H2 sing N N 148 GLU CA C sing N N 149 GLU CA CB sing N N 150 GLU CA HA sing N N 151 GLU C O doub N N 152 GLU C OXT sing N N 153 GLU CB CG sing N N 154 GLU CB HB2 sing N N 155 GLU CB HB3 sing N N 156 GLU CG CD sing N N 157 GLU CG HG2 sing N N 158 GLU CG HG3 sing N N 159 GLU CD OE1 doub N N 160 GLU CD OE2 sing N N 161 GLU OE2 HE2 sing N N 162 GLU OXT HXT sing N N 163 GLY N CA sing N N 164 GLY N H sing N N 165 GLY N H2 sing N N 166 GLY CA C sing N N 167 GLY CA HA2 sing N N 168 GLY CA HA3 sing N N 169 GLY C O doub N N 170 GLY C OXT sing N N 171 GLY OXT HXT sing N N 172 HIS N CA sing N N 173 HIS N H sing N N 174 HIS N H2 sing N N 175 HIS CA C sing N N 176 HIS CA CB sing N N 177 HIS CA HA sing N N 178 HIS C O doub N N 179 HIS C OXT sing N N 180 HIS CB CG sing N N 181 HIS CB HB2 sing N N 182 HIS CB HB3 sing N N 183 HIS CG ND1 sing Y N 184 HIS CG CD2 doub Y N 185 HIS ND1 CE1 doub Y N 186 HIS ND1 HD1 sing N N 187 HIS CD2 NE2 sing Y N 188 HIS CD2 HD2 sing N N 189 HIS CE1 NE2 sing Y N 190 HIS CE1 HE1 sing N N 191 HIS NE2 HE2 sing N N 192 HIS OXT HXT sing N N 193 HOH O H1 sing N N 194 HOH O H2 sing N N 195 ILE N CA sing N N 196 ILE N H sing N N 197 ILE N H2 sing N N 198 ILE CA C sing N N 199 ILE CA CB sing N N 200 ILE CA HA sing N N 201 ILE C O doub N N 202 ILE C OXT sing N N 203 ILE CB CG1 sing N N 204 ILE CB CG2 sing N N 205 ILE CB HB sing N N 206 ILE CG1 CD1 sing N N 207 ILE CG1 HG12 sing N N 208 ILE CG1 HG13 sing N N 209 ILE CG2 HG21 sing N N 210 ILE CG2 HG22 sing N N 211 ILE CG2 HG23 sing N N 212 ILE CD1 HD11 sing N N 213 ILE CD1 HD12 sing N N 214 ILE CD1 HD13 sing N N 215 ILE OXT HXT sing N N 216 LEU N CA sing N N 217 LEU N H sing N N 218 LEU N H2 sing N N 219 LEU CA C sing N N 220 LEU CA CB sing N N 221 LEU CA HA sing N N 222 LEU C O doub N N 223 LEU C OXT sing N N 224 LEU CB CG sing N N 225 LEU CB HB2 sing N N 226 LEU CB HB3 sing N N 227 LEU CG CD1 sing N N 228 LEU CG CD2 sing N N 229 LEU CG HG sing N N 230 LEU CD1 HD11 sing N N 231 LEU CD1 HD12 sing N N 232 LEU CD1 HD13 sing N N 233 LEU CD2 HD21 sing N N 234 LEU CD2 HD22 sing N N 235 LEU CD2 HD23 sing N N 236 LEU OXT HXT sing N N 237 LYS N CA sing N N 238 LYS N H sing N N 239 LYS N H2 sing N N 240 LYS CA C sing N N 241 LYS CA CB sing N N 242 LYS CA HA sing N N 243 LYS C O doub N N 244 LYS C OXT sing N N 245 LYS CB CG sing N N 246 LYS CB HB2 sing N N 247 LYS CB HB3 sing N N 248 LYS CG CD sing N N 249 LYS CG HG2 sing N N 250 LYS CG HG3 sing N N 251 LYS CD CE sing N N 252 LYS CD HD2 sing N N 253 LYS CD HD3 sing N N 254 LYS CE NZ sing N N 255 LYS CE HE2 sing N N 256 LYS CE HE3 sing N N 257 LYS NZ HZ1 sing N N 258 LYS NZ HZ2 sing N N 259 LYS NZ HZ3 sing N N 260 LYS OXT HXT sing N N 261 MET N CA sing N N 262 MET N H sing N N 263 MET N H2 sing N N 264 MET CA C sing N N 265 MET CA CB sing N N 266 MET CA HA sing N N 267 MET C O doub N N 268 MET C OXT sing N N 269 MET CB CG sing N N 270 MET CB HB2 sing N N 271 MET CB HB3 sing N N 272 MET CG SD sing N N 273 MET CG HG2 sing N N 274 MET CG HG3 sing N N 275 MET SD CE sing N N 276 MET CE HE1 sing N N 277 MET CE HE2 sing N N 278 MET CE HE3 sing N N 279 MET OXT HXT sing N N 280 PHE N CA sing N N 281 PHE N H sing N N 282 PHE N H2 sing N N 283 PHE CA C sing N N 284 PHE CA CB sing N N 285 PHE CA HA sing N N 286 PHE C O doub N N 287 PHE C OXT sing N N 288 PHE CB CG sing N N 289 PHE CB HB2 sing N N 290 PHE CB HB3 sing N N 291 PHE CG CD1 doub Y N 292 PHE CG CD2 sing Y N 293 PHE CD1 CE1 sing Y N 294 PHE CD1 HD1 sing N N 295 PHE CD2 CE2 doub Y N 296 PHE CD2 HD2 sing N N 297 PHE CE1 CZ doub Y N 298 PHE CE1 HE1 sing N N 299 PHE CE2 CZ sing Y N 300 PHE CE2 HE2 sing N N 301 PHE CZ HZ sing N N 302 PHE OXT HXT sing N N 303 PO4 P O1 doub N N 304 PO4 P O2 sing N N 305 PO4 P O3 sing N N 306 PO4 P O4 sing N N 307 PRO N CA sing N N 308 PRO N CD sing N N 309 PRO N H sing N N 310 PRO CA C sing N N 311 PRO CA CB sing N N 312 PRO CA HA sing N N 313 PRO C O doub N N 314 PRO C OXT sing N N 315 PRO CB CG sing N N 316 PRO CB HB2 sing N N 317 PRO CB HB3 sing N N 318 PRO CG CD sing N N 319 PRO CG HG2 sing N N 320 PRO CG HG3 sing N N 321 PRO CD HD2 sing N N 322 PRO CD HD3 sing N N 323 PRO OXT HXT sing N N 324 SER N CA sing N N 325 SER N H sing N N 326 SER N H2 sing N N 327 SER CA C sing N N 328 SER CA CB sing N N 329 SER CA HA sing N N 330 SER C O doub N N 331 SER C OXT sing N N 332 SER CB OG sing N N 333 SER CB HB2 sing N N 334 SER CB HB3 sing N N 335 SER OG HG sing N N 336 SER OXT HXT sing N N 337 THR N CA sing N N 338 THR N H sing N N 339 THR N H2 sing N N 340 THR CA C sing N N 341 THR CA CB sing N N 342 THR CA HA sing N N 343 THR C O doub N N 344 THR C OXT sing N N 345 THR CB OG1 sing N N 346 THR CB CG2 sing N N 347 THR CB HB sing N N 348 THR OG1 HG1 sing N N 349 THR CG2 HG21 sing N N 350 THR CG2 HG22 sing N N 351 THR CG2 HG23 sing N N 352 THR OXT HXT sing N N 353 TYR N CA sing N N 354 TYR N H sing N N 355 TYR N H2 sing N N 356 TYR CA C sing N N 357 TYR CA CB sing N N 358 TYR CA HA sing N N 359 TYR C O doub N N 360 TYR C OXT sing N N 361 TYR CB CG sing N N 362 TYR CB HB2 sing N N 363 TYR CB HB3 sing N N 364 TYR CG CD1 doub Y N 365 TYR CG CD2 sing Y N 366 TYR CD1 CE1 sing Y N 367 TYR CD1 HD1 sing N N 368 TYR CD2 CE2 doub Y N 369 TYR CD2 HD2 sing N N 370 TYR CE1 CZ doub Y N 371 TYR CE1 HE1 sing N N 372 TYR CE2 CZ sing Y N 373 TYR CE2 HE2 sing N N 374 TYR CZ OH sing N N 375 TYR OH HH sing N N 376 TYR OXT HXT sing N N 377 VAL N CA sing N N 378 VAL N H sing N N 379 VAL N H2 sing N N 380 VAL CA C sing N N 381 VAL CA CB sing N N 382 VAL CA HA sing N N 383 VAL C O doub N N 384 VAL C OXT sing N N 385 VAL CB CG1 sing N N 386 VAL CB CG2 sing N N 387 VAL CB HB sing N N 388 VAL CG1 HG11 sing N N 389 VAL CG1 HG12 sing N N 390 VAL CG1 HG13 sing N N 391 VAL CG2 HG21 sing N N 392 VAL CG2 HG22 sing N N 393 VAL CG2 HG23 sing N N 394 VAL OXT HXT sing N N 395 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 ADP ? ? ADP ? ? 'SUBJECT OF INVESTIGATION' ? 2 PO4 ? ? PO4 ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "ADENOSINE-5'-DIPHOSPHATE" ADP 3 'PHOSPHATE ION' PO4 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1XW3 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #