data_6L0L # _entry.id 6L0L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6L0L pdb_00006l0l 10.2210/pdb6l0l/pdb WWPDB D_1300013939 ? ? BMRB 36289 ? 10.13018/BMR36289 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-09-30 2 'Structure model' 1 1 2021-05-12 3 'Structure model' 1 2 2021-06-09 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 4 'Structure model' Other 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' 8 3 'Structure model' '_citation.journal_volume' 9 3 'Structure model' '_citation.page_first' 10 3 'Structure model' '_citation.page_last' 11 3 'Structure model' '_citation.pdbx_database_id_PubMed' 12 3 'Structure model' '_citation_author.identifier_ORCID' 13 3 'Structure model' '_citation_author.name' 14 4 'Structure model' '_database_2.pdbx_DOI' 15 4 'Structure model' '_database_2.pdbx_database_accession' 16 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 17 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6L0L _pdbx_database_status.recvd_initial_deposition_date 2019-09-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Hydra-1ubq de nova designed by Hydra based on ubiquitin' _pdbx_database_related.db_id 36289 _pdbx_database_related.content_type unspecified # _audit_author.name 'Ouyang, B.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-2877-0635 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Comput Struct Biotechnol J' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2001-0370 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 19 _citation.language ? _citation.page_first 2575 _citation.page_last 2587 _citation.title 'Multiobjective heuristic algorithm for de novo protein design in a quantified continuous sequence space.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.csbj.2021.04.046 _citation.pdbx_database_id_PubMed 34025944 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, R.X.' 1 ? primary 'Zhang, N.N.' 2 ? primary 'Wu, B.' 3 ? primary 'OuYang, B.' 4 ? primary 'Shen, H.B.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Hydra-1ubq _entity.formula_weight 9217.411 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGSLEIKIRTTEGRTLTVDVKPDRTIEELMEKLKEQTGVPPEQLRVIYNGRELEPRTTLEEYNITPGVTLELKTRSSGH GT ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGSLEIKIRTTEGRTLTVDVKPDRTIEELMEKLKEQTGVPPEQLRVIYNGRELEPRTTLEEYNITPGVTLELKTRSSGH GT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 LEU n 1 6 GLU n 1 7 ILE n 1 8 LYS n 1 9 ILE n 1 10 ARG n 1 11 THR n 1 12 THR n 1 13 GLU n 1 14 GLY n 1 15 ARG n 1 16 THR n 1 17 LEU n 1 18 THR n 1 19 VAL n 1 20 ASP n 1 21 VAL n 1 22 LYS n 1 23 PRO n 1 24 ASP n 1 25 ARG n 1 26 THR n 1 27 ILE n 1 28 GLU n 1 29 GLU n 1 30 LEU n 1 31 MET n 1 32 GLU n 1 33 LYS n 1 34 LEU n 1 35 LYS n 1 36 GLU n 1 37 GLN n 1 38 THR n 1 39 GLY n 1 40 VAL n 1 41 PRO n 1 42 PRO n 1 43 GLU n 1 44 GLN n 1 45 LEU n 1 46 ARG n 1 47 VAL n 1 48 ILE n 1 49 TYR n 1 50 ASN n 1 51 GLY n 1 52 ARG n 1 53 GLU n 1 54 LEU n 1 55 GLU n 1 56 PRO n 1 57 ARG n 1 58 THR n 1 59 THR n 1 60 LEU n 1 61 GLU n 1 62 GLU n 1 63 TYR n 1 64 ASN n 1 65 ILE n 1 66 THR n 1 67 PRO n 1 68 GLY n 1 69 VAL n 1 70 THR n 1 71 LEU n 1 72 GLU n 1 73 LEU n 1 74 LYS n 1 75 THR n 1 76 ARG n 1 77 SER n 1 78 SER n 1 79 GLY n 1 80 HIS n 1 81 GLY n 1 82 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 82 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 THR 82 82 82 THR THR A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 82 ? O ? A THR 82 O 2 2 Y 1 A THR 82 ? O ? A THR 82 O 3 3 Y 1 A THR 82 ? O ? A THR 82 O 4 4 Y 1 A THR 82 ? O ? A THR 82 O 5 5 Y 1 A THR 82 ? O ? A THR 82 O 6 6 Y 1 A THR 82 ? O ? A THR 82 O 7 7 Y 1 A THR 82 ? O ? A THR 82 O 8 8 Y 1 A THR 82 ? O ? A THR 82 O 9 9 Y 1 A THR 82 ? O ? A THR 82 O 10 10 Y 1 A THR 82 ? O ? A THR 82 O 11 11 Y 1 A THR 82 ? O ? A THR 82 O 12 12 Y 1 A THR 82 ? O ? A THR 82 O 13 13 Y 1 A THR 82 ? O ? A THR 82 O 14 14 Y 1 A THR 82 ? O ? A THR 82 O 15 15 Y 1 A THR 82 ? O ? A THR 82 O 16 16 Y 1 A THR 82 ? O ? A THR 82 O 17 17 Y 1 A THR 82 ? O ? A THR 82 O 18 18 Y 1 A THR 82 ? O ? A THR 82 O 19 19 Y 1 A THR 82 ? O ? A THR 82 O 20 20 Y 1 A THR 82 ? O ? A THR 82 O # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6L0L _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6L0L _struct.title 'Hydra-1ubq de nova designed by Hydra based on ubiquitin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6L0L _struct_keywords.text 'de novo protein design, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6L0L _struct_ref.pdbx_db_accession 6L0L _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6L0L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6L0L _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 82 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 82 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5000 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 26 ? GLY A 39 ? THR A 26 GLY A 39 1 ? 14 HELX_P HELX_P2 AA2 PRO A 41 ? GLU A 43 ? PRO A 41 GLU A 43 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 16 ? VAL A 21 ? THR A 16 VAL A 21 AA1 2 LEU A 5 ? ARG A 10 ? LEU A 5 ARG A 10 AA1 3 THR A 70 ? THR A 75 ? THR A 70 THR A 75 AA1 4 LEU A 45 ? TYR A 49 ? LEU A 45 TYR A 49 AA1 5 ARG A 52 ? LEU A 54 ? ARG A 52 LEU A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 19 ? O VAL A 19 N ILE A 7 ? N ILE A 7 AA1 2 3 N ARG A 10 ? N ARG A 10 O LEU A 71 ? O LEU A 71 AA1 3 4 O GLU A 72 ? O GLU A 72 N ILE A 48 ? N ILE A 48 AA1 4 5 N VAL A 47 ? N VAL A 47 O LEU A 54 ? O LEU A 54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 76 ? ? -110.96 71.96 2 1 SER A 78 ? ? -168.43 105.07 3 2 SER A 77 ? ? -69.99 95.02 4 2 HIS A 80 ? ? -54.70 102.16 5 3 ASN A 64 ? ? 63.79 61.90 6 3 HIS A 80 ? ? -161.51 19.87 7 4 SER A 78 ? ? -138.63 -78.82 8 4 HIS A 80 ? ? 76.39 -3.14 9 5 SER A 77 ? ? -164.29 -53.61 10 5 HIS A 80 ? ? -157.19 80.17 11 6 HIS A 80 ? ? 66.57 108.41 12 7 PRO A 2 ? ? -62.17 97.85 13 7 ILE A 65 ? ? -69.69 88.28 14 8 PRO A 2 ? ? -81.76 36.56 15 8 SER A 78 ? ? 68.76 161.42 16 8 HIS A 80 ? ? 62.74 86.16 17 10 HIS A 80 ? ? -166.20 -41.54 18 11 ILE A 65 ? ? -67.57 93.59 19 11 SER A 78 ? ? -145.88 23.96 20 12 PRO A 2 ? ? -56.92 103.25 21 12 SER A 77 ? ? -56.41 91.37 22 13 PRO A 2 ? ? -57.04 105.63 23 13 HIS A 80 ? ? 52.06 71.91 24 14 ARG A 76 ? ? -64.61 86.29 25 14 SER A 77 ? ? -132.79 -63.70 26 14 HIS A 80 ? ? -156.78 -43.13 27 15 SER A 77 ? ? 66.88 114.08 28 15 SER A 78 ? ? -84.14 41.23 29 16 ARG A 76 ? ? -61.68 97.77 30 16 SER A 77 ? ? -70.75 -73.81 31 16 SER A 78 ? ? 64.88 153.82 32 16 HIS A 80 ? ? 68.37 -73.73 33 17 PRO A 2 ? ? -80.38 30.46 34 17 ILE A 65 ? ? -69.18 88.60 35 18 ARG A 76 ? ? -64.95 87.60 36 19 SER A 77 ? ? 69.84 169.23 # _pdbx_nmr_ensemble.entry_id 6L0L _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6L0L _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.6 mM [U-99% 13C; U-99% 15N] Hydra-1ubq, 90% H2O/10% D2O' '90% H2O/10% D2O' '15N 13C' solution ? 2 '0.6 mM [U-99% 13C; U-99% 15N] Hydra-1ubq, 100% D2O' '100% D2O' '13C 15N' solution ? 3 '0.6 mM [U-10% 13C; U-99% 15N] Hydra-1ubq, 90% H2O/10% D2O' '90% H2O/10% D2O' '10% 13C 15N' solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Hydra-1ubq 0.6 ? mM '[U-99% 13C; U-99% 15N]' 2 Hydra-1ubq 0.6 ? mM '[U-99% 13C; U-99% 15N]' 3 Hydra-1ubq 0.6 ? mM '[U-10% 13C; U-99% 15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label '15N 13C' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCO' 1 isotropic 3 1 1 '3D HN(CA)CO' 1 isotropic 4 1 1 '3D HNCA' 1 isotropic 5 1 1 '3D HN(CO)CA' 1 isotropic 6 1 1 '3D CBCA(CO)NH' 1 isotropic 7 1 1 '3D HNCACB' 1 isotropic 8 1 1 '2D 1H-13C HSQC' 1 isotropic 9 1 2 '2D 1H-13C HSQC' 1 isotropic 11 1 3 '2D 1H-13C HSQC' 2 isotropic 13 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 10 1 1 '3D 15N-NOESY-HSQC' 1 isotropic 12 1 1 '3D 13C-NOESY' 1 isotropic 14 1 2 '3D 13C-NOESY' 1 isotropic 15 1 1 '3D 13C-aromatic-NOESY' 1 isotropic 16 1 1 '3D HCCH-TOCSY' 1 isotropic 17 1 2 '3D H(C)CH-TOCOSY' 1 isotropic 18 1 1 '3D HBHA(CO)NH' 1 isotropic # _pdbx_nmr_refine.entry_id 6L0L _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA 2.1 'Guntert P.' 2 'chemical shift assignment' Sparky ? Goddard 3 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 'peak picking' XEASY ? 'Bartels et al.' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 MET N N N N 200 MET CA C N S 201 MET C C N N 202 MET O O N N 203 MET CB C N N 204 MET CG C N N 205 MET SD S N N 206 MET CE C N N 207 MET OXT O N N 208 MET H H N N 209 MET H2 H N N 210 MET HA H N N 211 MET HB2 H N N 212 MET HB3 H N N 213 MET HG2 H N N 214 MET HG3 H N N 215 MET HE1 H N N 216 MET HE2 H N N 217 MET HE3 H N N 218 MET HXT H N N 219 PRO N N N N 220 PRO CA C N S 221 PRO C C N N 222 PRO O O N N 223 PRO CB C N N 224 PRO CG C N N 225 PRO CD C N N 226 PRO OXT O N N 227 PRO H H N N 228 PRO HA H N N 229 PRO HB2 H N N 230 PRO HB3 H N N 231 PRO HG2 H N N 232 PRO HG3 H N N 233 PRO HD2 H N N 234 PRO HD3 H N N 235 PRO HXT H N N 236 SER N N N N 237 SER CA C N S 238 SER C C N N 239 SER O O N N 240 SER CB C N N 241 SER OG O N N 242 SER OXT O N N 243 SER H H N N 244 SER H2 H N N 245 SER HA H N N 246 SER HB2 H N N 247 SER HB3 H N N 248 SER HG H N N 249 SER HXT H N N 250 THR N N N N 251 THR CA C N S 252 THR C C N N 253 THR O O N N 254 THR CB C N R 255 THR OG1 O N N 256 THR CG2 C N N 257 THR OXT O N N 258 THR H H N N 259 THR H2 H N N 260 THR HA H N N 261 THR HB H N N 262 THR HG1 H N N 263 THR HG21 H N N 264 THR HG22 H N N 265 THR HG23 H N N 266 THR HXT H N N 267 TYR N N N N 268 TYR CA C N S 269 TYR C C N N 270 TYR O O N N 271 TYR CB C N N 272 TYR CG C Y N 273 TYR CD1 C Y N 274 TYR CD2 C Y N 275 TYR CE1 C Y N 276 TYR CE2 C Y N 277 TYR CZ C Y N 278 TYR OH O N N 279 TYR OXT O N N 280 TYR H H N N 281 TYR H2 H N N 282 TYR HA H N N 283 TYR HB2 H N N 284 TYR HB3 H N N 285 TYR HD1 H N N 286 TYR HD2 H N N 287 TYR HE1 H N N 288 TYR HE2 H N N 289 TYR HH H N N 290 TYR HXT H N N 291 VAL N N N N 292 VAL CA C N S 293 VAL C C N N 294 VAL O O N N 295 VAL CB C N N 296 VAL CG1 C N N 297 VAL CG2 C N N 298 VAL OXT O N N 299 VAL H H N N 300 VAL H2 H N N 301 VAL HA H N N 302 VAL HB H N N 303 VAL HG11 H N N 304 VAL HG12 H N N 305 VAL HG13 H N N 306 VAL HG21 H N N 307 VAL HG22 H N N 308 VAL HG23 H N N 309 VAL HXT H N N 310 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 GLN N CA sing N N 58 GLN N H sing N N 59 GLN N H2 sing N N 60 GLN CA C sing N N 61 GLN CA CB sing N N 62 GLN CA HA sing N N 63 GLN C O doub N N 64 GLN C OXT sing N N 65 GLN CB CG sing N N 66 GLN CB HB2 sing N N 67 GLN CB HB3 sing N N 68 GLN CG CD sing N N 69 GLN CG HG2 sing N N 70 GLN CG HG3 sing N N 71 GLN CD OE1 doub N N 72 GLN CD NE2 sing N N 73 GLN NE2 HE21 sing N N 74 GLN NE2 HE22 sing N N 75 GLN OXT HXT sing N N 76 GLU N CA sing N N 77 GLU N H sing N N 78 GLU N H2 sing N N 79 GLU CA C sing N N 80 GLU CA CB sing N N 81 GLU CA HA sing N N 82 GLU C O doub N N 83 GLU C OXT sing N N 84 GLU CB CG sing N N 85 GLU CB HB2 sing N N 86 GLU CB HB3 sing N N 87 GLU CG CD sing N N 88 GLU CG HG2 sing N N 89 GLU CG HG3 sing N N 90 GLU CD OE1 doub N N 91 GLU CD OE2 sing N N 92 GLU OE2 HE2 sing N N 93 GLU OXT HXT sing N N 94 GLY N CA sing N N 95 GLY N H sing N N 96 GLY N H2 sing N N 97 GLY CA C sing N N 98 GLY CA HA2 sing N N 99 GLY CA HA3 sing N N 100 GLY C O doub N N 101 GLY C OXT sing N N 102 GLY OXT HXT sing N N 103 HIS N CA sing N N 104 HIS N H sing N N 105 HIS N H2 sing N N 106 HIS CA C sing N N 107 HIS CA CB sing N N 108 HIS CA HA sing N N 109 HIS C O doub N N 110 HIS C OXT sing N N 111 HIS CB CG sing N N 112 HIS CB HB2 sing N N 113 HIS CB HB3 sing N N 114 HIS CG ND1 sing Y N 115 HIS CG CD2 doub Y N 116 HIS ND1 CE1 doub Y N 117 HIS ND1 HD1 sing N N 118 HIS CD2 NE2 sing Y N 119 HIS CD2 HD2 sing N N 120 HIS CE1 NE2 sing Y N 121 HIS CE1 HE1 sing N N 122 HIS NE2 HE2 sing N N 123 HIS OXT HXT sing N N 124 ILE N CA sing N N 125 ILE N H sing N N 126 ILE N H2 sing N N 127 ILE CA C sing N N 128 ILE CA CB sing N N 129 ILE CA HA sing N N 130 ILE C O doub N N 131 ILE C OXT sing N N 132 ILE CB CG1 sing N N 133 ILE CB CG2 sing N N 134 ILE CB HB sing N N 135 ILE CG1 CD1 sing N N 136 ILE CG1 HG12 sing N N 137 ILE CG1 HG13 sing N N 138 ILE CG2 HG21 sing N N 139 ILE CG2 HG22 sing N N 140 ILE CG2 HG23 sing N N 141 ILE CD1 HD11 sing N N 142 ILE CD1 HD12 sing N N 143 ILE CD1 HD13 sing N N 144 ILE OXT HXT sing N N 145 LEU N CA sing N N 146 LEU N H sing N N 147 LEU N H2 sing N N 148 LEU CA C sing N N 149 LEU CA CB sing N N 150 LEU CA HA sing N N 151 LEU C O doub N N 152 LEU C OXT sing N N 153 LEU CB CG sing N N 154 LEU CB HB2 sing N N 155 LEU CB HB3 sing N N 156 LEU CG CD1 sing N N 157 LEU CG CD2 sing N N 158 LEU CG HG sing N N 159 LEU CD1 HD11 sing N N 160 LEU CD1 HD12 sing N N 161 LEU CD1 HD13 sing N N 162 LEU CD2 HD21 sing N N 163 LEU CD2 HD22 sing N N 164 LEU CD2 HD23 sing N N 165 LEU OXT HXT sing N N 166 LYS N CA sing N N 167 LYS N H sing N N 168 LYS N H2 sing N N 169 LYS CA C sing N N 170 LYS CA CB sing N N 171 LYS CA HA sing N N 172 LYS C O doub N N 173 LYS C OXT sing N N 174 LYS CB CG sing N N 175 LYS CB HB2 sing N N 176 LYS CB HB3 sing N N 177 LYS CG CD sing N N 178 LYS CG HG2 sing N N 179 LYS CG HG3 sing N N 180 LYS CD CE sing N N 181 LYS CD HD2 sing N N 182 LYS CD HD3 sing N N 183 LYS CE NZ sing N N 184 LYS CE HE2 sing N N 185 LYS CE HE3 sing N N 186 LYS NZ HZ1 sing N N 187 LYS NZ HZ2 sing N N 188 LYS NZ HZ3 sing N N 189 LYS OXT HXT sing N N 190 MET N CA sing N N 191 MET N H sing N N 192 MET N H2 sing N N 193 MET CA C sing N N 194 MET CA CB sing N N 195 MET CA HA sing N N 196 MET C O doub N N 197 MET C OXT sing N N 198 MET CB CG sing N N 199 MET CB HB2 sing N N 200 MET CB HB3 sing N N 201 MET CG SD sing N N 202 MET CG HG2 sing N N 203 MET CG HG3 sing N N 204 MET SD CE sing N N 205 MET CE HE1 sing N N 206 MET CE HE2 sing N N 207 MET CE HE3 sing N N 208 MET OXT HXT sing N N 209 PRO N CA sing N N 210 PRO N CD sing N N 211 PRO N H sing N N 212 PRO CA C sing N N 213 PRO CA CB sing N N 214 PRO CA HA sing N N 215 PRO C O doub N N 216 PRO C OXT sing N N 217 PRO CB CG sing N N 218 PRO CB HB2 sing N N 219 PRO CB HB3 sing N N 220 PRO CG CD sing N N 221 PRO CG HG2 sing N N 222 PRO CG HG3 sing N N 223 PRO CD HD2 sing N N 224 PRO CD HD3 sing N N 225 PRO OXT HXT sing N N 226 SER N CA sing N N 227 SER N H sing N N 228 SER N H2 sing N N 229 SER CA C sing N N 230 SER CA CB sing N N 231 SER CA HA sing N N 232 SER C O doub N N 233 SER C OXT sing N N 234 SER CB OG sing N N 235 SER CB HB2 sing N N 236 SER CB HB3 sing N N 237 SER OG HG sing N N 238 SER OXT HXT sing N N 239 THR N CA sing N N 240 THR N H sing N N 241 THR N H2 sing N N 242 THR CA C sing N N 243 THR CA CB sing N N 244 THR CA HA sing N N 245 THR C O doub N N 246 THR C OXT sing N N 247 THR CB OG1 sing N N 248 THR CB CG2 sing N N 249 THR CB HB sing N N 250 THR OG1 HG1 sing N N 251 THR CG2 HG21 sing N N 252 THR CG2 HG22 sing N N 253 THR CG2 HG23 sing N N 254 THR OXT HXT sing N N 255 TYR N CA sing N N 256 TYR N H sing N N 257 TYR N H2 sing N N 258 TYR CA C sing N N 259 TYR CA CB sing N N 260 TYR CA HA sing N N 261 TYR C O doub N N 262 TYR C OXT sing N N 263 TYR CB CG sing N N 264 TYR CB HB2 sing N N 265 TYR CB HB3 sing N N 266 TYR CG CD1 doub Y N 267 TYR CG CD2 sing Y N 268 TYR CD1 CE1 sing Y N 269 TYR CD1 HD1 sing N N 270 TYR CD2 CE2 doub Y N 271 TYR CD2 HD2 sing N N 272 TYR CE1 CZ doub Y N 273 TYR CE1 HE1 sing N N 274 TYR CE2 CZ sing Y N 275 TYR CE2 HE2 sing N N 276 TYR CZ OH sing N N 277 TYR OH HH sing N N 278 TYR OXT HXT sing N N 279 VAL N CA sing N N 280 VAL N H sing N N 281 VAL N H2 sing N N 282 VAL CA C sing N N 283 VAL CA CB sing N N 284 VAL CA HA sing N N 285 VAL C O doub N N 286 VAL C OXT sing N N 287 VAL CB CG1 sing N N 288 VAL CB CG2 sing N N 289 VAL CB HB sing N N 290 VAL CG1 HG11 sing N N 291 VAL CG1 HG12 sing N N 292 VAL CG1 HG13 sing N N 293 VAL CG2 HG21 sing N N 294 VAL CG2 HG22 sing N N 295 VAL CG2 HG23 sing N N 296 VAL OXT HXT sing N N 297 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 UNITYPLUS ? Varian 600 ? 2 UNITYPLUS ? Varian 700 ? # _atom_sites.entry_id 6L0L _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_