data_6L5Z # _entry.id 6L5Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6L5Z pdb_00006l5z 10.2210/pdb6l5z/pdb WWPDB D_1300014206 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6L5Z _pdbx_database_status.recvd_initial_deposition_date 2019-10-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Li, Y.' 1 ? 'Chen, G.' 2 ? 'Li, H.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 142 _citation.language ? _citation.page_first 21450 _citation.page_last 21459 _citation.title 'Selective Targeting of AF9 YEATS Domain by Cyclopeptide Inhibitors with Preorganized Conformation.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.0c10324 _citation.pdbx_database_id_PubMed 33306911 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jiang, Y.' 1 ? primary 'Chen, G.' 2 ? primary 'Li, X.M.' 3 ? primary 'Liu, S.' 4 ? primary 'Tian, G.' 5 ? primary 'Li, Y.' 6 ? primary 'Li, X.' 7 0000-0001-9698-1883 primary 'Li, H.' 8 ? primary 'Li, X.D.' 9 0000-0002-2797-4134 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6L5Z _cell.details ? _cell.formula_units_Z ? _cell.length_a 106.240 _cell.length_a_esd ? _cell.length_b 106.240 _cell.length_b_esd ? _cell.length_c 45.492 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6L5Z _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein AF-9' 16611.160 1 ? ? ? ? 2 polymer syn SC0-ALO-ALA-SC3-SC4-NH2 814.909 1 ? ? ? ? 3 water nat water 18.015 4 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 ;ALL1-fused gene from chromosome 9 protein,Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein,YEATS domain-containing protein 3 ; 2 'Cyclopeptide inhibitor' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSHMASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESG YAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA ; ;GSHMASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESG YAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA ; A ? 2 'polypeptide(L)' no yes '(EDX)(ALO)A(EE0)(EE3)(NH2)' XTAXXX C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 SER n 1 7 SER n 1 8 CYS n 1 9 ALA n 1 10 VAL n 1 11 GLN n 1 12 VAL n 1 13 LYS n 1 14 LEU n 1 15 GLU n 1 16 LEU n 1 17 GLY n 1 18 HIS n 1 19 ARG n 1 20 ALA n 1 21 GLN n 1 22 VAL n 1 23 ARG n 1 24 LYS n 1 25 LYS n 1 26 PRO n 1 27 THR n 1 28 VAL n 1 29 GLU n 1 30 GLY n 1 31 PHE n 1 32 THR n 1 33 HIS n 1 34 ASP n 1 35 TRP n 1 36 MET n 1 37 VAL n 1 38 PHE n 1 39 VAL n 1 40 ARG n 1 41 GLY n 1 42 PRO n 1 43 GLU n 1 44 HIS n 1 45 SER n 1 46 ASN n 1 47 ILE n 1 48 GLN n 1 49 HIS n 1 50 PHE n 1 51 VAL n 1 52 GLU n 1 53 LYS n 1 54 VAL n 1 55 VAL n 1 56 PHE n 1 57 HIS n 1 58 LEU n 1 59 HIS n 1 60 GLU n 1 61 SER n 1 62 PHE n 1 63 PRO n 1 64 ARG n 1 65 PRO n 1 66 LYS n 1 67 ARG n 1 68 VAL n 1 69 CYS n 1 70 LYS n 1 71 ASP n 1 72 PRO n 1 73 PRO n 1 74 TYR n 1 75 LYS n 1 76 VAL n 1 77 GLU n 1 78 GLU n 1 79 SER n 1 80 GLY n 1 81 TYR n 1 82 ALA n 1 83 GLY n 1 84 PHE n 1 85 ILE n 1 86 LEU n 1 87 PRO n 1 88 ILE n 1 89 GLU n 1 90 VAL n 1 91 TYR n 1 92 PHE n 1 93 LYS n 1 94 ASN n 1 95 LYS n 1 96 GLU n 1 97 GLU n 1 98 PRO n 1 99 ARG n 1 100 LYS n 1 101 VAL n 1 102 ARG n 1 103 PHE n 1 104 ASP n 1 105 TYR n 1 106 ASP n 1 107 LEU n 1 108 PHE n 1 109 LEU n 1 110 HIS n 1 111 LEU n 1 112 GLU n 1 113 GLY n 1 114 HIS n 1 115 PRO n 1 116 PRO n 1 117 VAL n 1 118 ASN n 1 119 HIS n 1 120 LEU n 1 121 ARG n 1 122 CYS n 1 123 GLU n 1 124 LYS n 1 125 LEU n 1 126 THR n 1 127 PHE n 1 128 ASN n 1 129 ASN n 1 130 PRO n 1 131 THR n 1 132 GLU n 1 133 ASP n 1 134 PHE n 1 135 ARG n 1 136 ARG n 1 137 LYS n 1 138 LEU n 1 139 LEU n 1 140 LYS n 1 141 ALA n 2 1 EDX n 2 2 ALO n 2 3 ALA n 2 4 EE0 n 2 5 EE3 n 2 6 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 138 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MLLT3, AF9, YEATS3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 6 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP AF9_HUMAN P42568 ? 1 ;MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAG FILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA ; 1 2 PDB 6L5Z 6L5Z ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6L5Z A 4 ? 141 ? P42568 1 ? 138 ? 1 138 2 2 6L5Z C 1 ? 6 ? 6L5Z 1 ? 6 ? 1 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ALO 'L-peptide linking' n ALLO-THREONINE ? 'C4 H9 N O3' 119.119 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDX non-polymer . '(2~{S})-6-carbamimidamido-2-(phenylmethoxycarbonylamino)hexanoic acid' ? 'C15 H22 N4 O4' 322.360 EE0 non-polymer . '(2~{R})-2-azanylpentanoic acid' ? 'C5 H11 N O2' 117.146 EE3 non-polymer . '(2~{S})-2-azanyl-6-(1,3-oxazol-5-ylcarbonylamino)hexanoic acid' ? 'C10 H15 N3 O4' 241.244 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6L5Z _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.21 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 70.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% (w/v)PEG 3350,0.2M Ammonium Nitrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR CCD 130 mm' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-10-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6L5Z _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.050 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5816 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.700 _reflns.pdbx_Rmerge_I_obs 0.098 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.628 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.103 _reflns.pdbx_Rpim_I_all 0.033 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 56564 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 3.050 3.100 ? ? ? ? ? ? 277 100.000 ? ? ? ? 0.800 ? ? ? ? ? ? ? ? 9.600 ? 0.425 ? ? 0.844 0.269 ? 1 1 0.899 ? ? 3.100 3.160 ? ? ? ? ? ? 280 100.000 ? ? ? ? 0.660 ? ? ? ? ? ? ? ? 9.400 ? 0.421 ? ? 0.697 0.224 ? 2 1 0.922 ? ? 3.160 3.220 ? ? ? ? ? ? 297 100.000 ? ? ? ? 0.587 ? ? ? ? ? ? ? ? 9.000 ? 0.450 ? ? 0.624 0.209 ? 3 1 0.934 ? ? 3.220 3.290 ? ? ? ? ? ? 288 99.700 ? ? ? ? 0.440 ? ? ? ? ? ? ? ? 8.700 ? 0.461 ? ? 0.469 0.159 ? 4 1 0.956 ? ? 3.290 3.360 ? ? ? ? ? ? 273 100.000 ? ? ? ? 0.361 ? ? ? ? ? ? ? ? 10.100 ? 0.433 ? ? 0.380 0.118 ? 5 1 0.973 ? ? 3.360 3.430 ? ? ? ? ? ? 290 100.000 ? ? ? ? 0.276 ? ? ? ? ? ? ? ? 10.400 ? 0.462 ? ? 0.290 0.089 ? 6 1 0.984 ? ? 3.430 3.520 ? ? ? ? ? ? 291 100.000 ? ? ? ? 0.209 ? ? ? ? ? ? ? ? 10.300 ? 0.515 ? ? 0.220 0.067 ? 7 1 0.988 ? ? 3.520 3.620 ? ? ? ? ? ? 279 100.000 ? ? ? ? 0.180 ? ? ? ? ? ? ? ? 10.600 ? 0.581 ? ? 0.190 0.058 ? 8 1 0.990 ? ? 3.620 3.720 ? ? ? ? ? ? 288 100.000 ? ? ? ? 0.144 ? ? ? ? ? ? ? ? 10.300 ? 0.582 ? ? 0.151 0.047 ? 9 1 0.995 ? ? 3.720 3.840 ? ? ? ? ? ? 299 100.000 ? ? ? ? 0.140 ? ? ? ? ? ? ? ? 10.200 ? 0.624 ? ? 0.147 0.046 ? 10 1 0.995 ? ? 3.840 3.980 ? ? ? ? ? ? 278 100.000 ? ? ? ? 0.121 ? ? ? ? ? ? ? ? 10.200 ? 0.667 ? ? 0.127 0.039 ? 11 1 0.995 ? ? 3.980 4.140 ? ? ? ? ? ? 299 100.000 ? ? ? ? 0.101 ? ? ? ? ? ? ? ? 9.900 ? 0.714 ? ? 0.106 0.033 ? 12 1 0.995 ? ? 4.140 4.330 ? ? ? ? ? ? 287 100.000 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 9.700 ? 0.861 ? ? 0.089 0.028 ? 13 1 0.997 ? ? 4.330 4.560 ? ? ? ? ? ? 293 99.300 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 9.400 ? 0.696 ? ? 0.083 0.027 ? 14 1 0.996 ? ? 4.560 4.840 ? ? ? ? ? ? 286 99.300 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 8.200 ? 0.741 ? ? 0.072 0.025 ? 15 1 0.997 ? ? 4.840 5.210 ? ? ? ? ? ? 291 100.000 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 10.000 ? 0.807 ? ? 0.072 0.022 ? 16 1 0.998 ? ? 5.210 5.740 ? ? ? ? ? ? 306 100.000 ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 10.200 ? 0.681 ? ? 0.074 0.023 ? 17 1 0.997 ? ? 5.740 6.570 ? ? ? ? ? ? 290 100.000 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 10.100 ? 0.755 ? ? 0.069 0.022 ? 18 1 0.998 ? ? 6.570 8.270 ? ? ? ? ? ? 304 100.000 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 9.600 ? 0.811 ? ? 0.063 0.020 ? 19 1 0.998 ? ? 8.270 50.000 ? ? ? ? ? ? 320 98.800 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 8.700 ? 0.841 ? ? 0.052 0.018 ? 20 1 0.997 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 135.790 _refine.B_iso_mean 77.0601 _refine.B_iso_min 39.310 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6L5Z _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.0500 _refine.ls_d_res_low 40.7800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5803 _refine.ls_number_reflns_R_free 620 _refine.ls_number_reflns_R_work 5183 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8100 _refine.ls_percent_reflns_R_free 10.6800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1937 _refine.ls_R_factor_R_free 0.2218 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1904 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4TMP _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.5000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.0500 _refine_hist.d_res_low 40.7800 _refine_hist.number_atoms_solvent 4 _refine_hist.number_atoms_total 1207 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 137 _refine_hist.pdbx_B_iso_mean_ligand 70.52 _refine_hist.pdbx_B_iso_mean_solvent 66.05 _refine_hist.pdbx_number_atoms_protein 1145 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 58 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.0500 3.3600 1415 . 135 1280 100.0000 . . . 0.3322 0.0000 0.2640 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.3600 3.8400 1444 . 141 1303 100.0000 . . . 0.2825 0.0000 0.2221 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.8400 4.8400 1440 . 166 1274 100.0000 . . . 0.2115 0.0000 0.1715 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 4.8400 40.7800 1504 . 178 1326 100.0000 . . . 0.1845 0.0000 0.1716 . . . . . . . 4 . . . # _struct.entry_id 6L5Z _struct.title 'Crystal strucutre of AF9 YEATS domain in complex with a cyclopeptide inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6L5Z _struct_keywords.text 'YEATS domain, Complex, Cyclopeptide inhibitor, , TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 41 ? SER A 45 ? GLY A 38 SER A 42 5 ? 5 HELX_P HELX_P2 AA2 ASN A 46 ? HIS A 49 ? ASN A 43 HIS A 46 5 ? 4 HELX_P HELX_P3 AA3 THR A 131 ? LYS A 140 ? THR A 128 LYS A 137 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B EDX 1 C06 ? ? ? 1_555 B ALO 2 N ? ? C EDX 1 C ALO 2 1_555 ? ? ? ? ? ? ? 1.451 ? ? covale2 covale one ? B EDX 1 N26 ? ? ? 1_555 B EE0 4 C28 ? ? C EDX 1 C EE0 4 1_555 ? ? ? ? ? ? ? 1.453 ? ? covale3 covale both ? B ALO 2 C ? ? ? 1_555 B ALA 3 N ? ? C ALO 2 C ALA 3 1_555 ? ? ? ? ? ? ? 1.449 ? ? covale4 covale both ? B ALA 3 C ? ? ? 1_555 B EE0 4 N ? ? C ALA 3 C EE0 4 1_555 ? ? ? ? ? ? ? 1.459 ? ? covale5 covale both ? B EE0 4 C ? ? ? 1_555 B EE3 5 N ? ? C EE0 4 C EE3 5 1_555 ? ? ? ? ? ? ? 1.450 ? ? covale6 covale both ? B EE3 5 C ? ? ? 1_555 B NH2 6 N ? ? C EE3 5 C NH2 6 1_555 ? ? ? ? ? ? ? 1.450 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 72 A . ? PRO 69 A PRO 73 A ? PRO 70 A 1 -1.51 2 GLU 97 A . ? GLU 94 A PRO 98 A ? PRO 95 A 1 4.29 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 74 ? GLY A 80 ? TYR A 71 GLY A 77 AA1 2 HIS A 33 ? ARG A 40 ? HIS A 30 ARG A 37 AA1 3 ALA A 9 ? VAL A 22 ? ALA A 6 VAL A 19 AA1 4 VAL A 117 ? ASN A 128 ? VAL A 114 ASN A 125 AA2 1 LYS A 66 ? CYS A 69 ? LYS A 63 CYS A 66 AA2 2 VAL A 51 ? HIS A 57 ? VAL A 48 HIS A 54 AA2 3 PHE A 84 ? PHE A 92 ? PHE A 81 PHE A 89 AA2 4 LYS A 100 ? LEU A 107 ? LYS A 97 LEU A 104 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 78 ? O GLU A 75 N TRP A 35 ? N TRP A 32 AA1 2 3 O ASP A 34 ? O ASP A 31 N GLN A 21 ? N GLN A 18 AA1 3 4 N VAL A 10 ? N VAL A 7 O PHE A 127 ? O PHE A 124 AA2 1 2 O ARG A 67 ? O ARG A 64 N PHE A 56 ? N PHE A 53 AA2 2 3 N VAL A 55 ? N VAL A 52 O GLU A 89 ? O GLU A 86 AA2 3 4 N LEU A 86 ? N LEU A 83 O TYR A 105 ? O TYR A 102 # _atom_sites.entry_id 6L5Z _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009413 _atom_sites.fract_transf_matrix[1][2] 0.005434 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010869 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021982 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 ALA 5 2 2 ALA ALA A . n A 1 6 SER 6 3 3 SER SER A . n A 1 7 SER 7 4 4 SER SER A . n A 1 8 CYS 8 5 5 CYS CYS A . n A 1 9 ALA 9 6 6 ALA ALA A . n A 1 10 VAL 10 7 7 VAL VAL A . n A 1 11 GLN 11 8 8 GLN GLN A . n A 1 12 VAL 12 9 9 VAL VAL A . n A 1 13 LYS 13 10 10 LYS LYS A . n A 1 14 LEU 14 11 11 LEU LEU A . n A 1 15 GLU 15 12 12 GLU GLU A . n A 1 16 LEU 16 13 13 LEU LEU A . n A 1 17 GLY 17 14 14 GLY GLY A . n A 1 18 HIS 18 15 15 HIS HIS A . n A 1 19 ARG 19 16 16 ARG ARG A . n A 1 20 ALA 20 17 17 ALA ALA A . n A 1 21 GLN 21 18 18 GLN GLN A . n A 1 22 VAL 22 19 19 VAL VAL A . n A 1 23 ARG 23 20 20 ARG ARG A . n A 1 24 LYS 24 21 21 LYS LYS A . n A 1 25 LYS 25 22 22 LYS LYS A . n A 1 26 PRO 26 23 23 PRO PRO A . n A 1 27 THR 27 24 24 THR THR A . n A 1 28 VAL 28 25 25 VAL VAL A . n A 1 29 GLU 29 26 26 GLU GLU A . n A 1 30 GLY 30 27 27 GLY GLY A . n A 1 31 PHE 31 28 28 PHE PHE A . n A 1 32 THR 32 29 29 THR THR A . n A 1 33 HIS 33 30 30 HIS HIS A . n A 1 34 ASP 34 31 31 ASP ASP A . n A 1 35 TRP 35 32 32 TRP TRP A . n A 1 36 MET 36 33 33 MET MET A . n A 1 37 VAL 37 34 34 VAL VAL A . n A 1 38 PHE 38 35 35 PHE PHE A . n A 1 39 VAL 39 36 36 VAL VAL A . n A 1 40 ARG 40 37 37 ARG ARG A . n A 1 41 GLY 41 38 38 GLY GLY A . n A 1 42 PRO 42 39 39 PRO PRO A . n A 1 43 GLU 43 40 40 GLU GLU A . n A 1 44 HIS 44 41 41 HIS HIS A . n A 1 45 SER 45 42 42 SER SER A . n A 1 46 ASN 46 43 43 ASN ASN A . n A 1 47 ILE 47 44 44 ILE ILE A . n A 1 48 GLN 48 45 45 GLN GLN A . n A 1 49 HIS 49 46 46 HIS HIS A . n A 1 50 PHE 50 47 47 PHE PHE A . n A 1 51 VAL 51 48 48 VAL VAL A . n A 1 52 GLU 52 49 49 GLU GLU A . n A 1 53 LYS 53 50 50 LYS LYS A . n A 1 54 VAL 54 51 51 VAL VAL A . n A 1 55 VAL 55 52 52 VAL VAL A . n A 1 56 PHE 56 53 53 PHE PHE A . n A 1 57 HIS 57 54 54 HIS HIS A . n A 1 58 LEU 58 55 55 LEU LEU A . n A 1 59 HIS 59 56 56 HIS HIS A . n A 1 60 GLU 60 57 57 GLU GLU A . n A 1 61 SER 61 58 58 SER SER A . n A 1 62 PHE 62 59 59 PHE PHE A . n A 1 63 PRO 63 60 60 PRO PRO A . n A 1 64 ARG 64 61 61 ARG ARG A . n A 1 65 PRO 65 62 62 PRO PRO A . n A 1 66 LYS 66 63 63 LYS LYS A . n A 1 67 ARG 67 64 64 ARG ARG A . n A 1 68 VAL 68 65 65 VAL VAL A . n A 1 69 CYS 69 66 66 CYS CYS A . n A 1 70 LYS 70 67 67 LYS LYS A . n A 1 71 ASP 71 68 68 ASP ASP A . n A 1 72 PRO 72 69 69 PRO PRO A . n A 1 73 PRO 73 70 70 PRO PRO A . n A 1 74 TYR 74 71 71 TYR TYR A . n A 1 75 LYS 75 72 72 LYS LYS A . n A 1 76 VAL 76 73 73 VAL VAL A . n A 1 77 GLU 77 74 74 GLU GLU A . n A 1 78 GLU 78 75 75 GLU GLU A . n A 1 79 SER 79 76 76 SER SER A . n A 1 80 GLY 80 77 77 GLY GLY A . n A 1 81 TYR 81 78 78 TYR TYR A . n A 1 82 ALA 82 79 79 ALA ALA A . n A 1 83 GLY 83 80 80 GLY GLY A . n A 1 84 PHE 84 81 81 PHE PHE A . n A 1 85 ILE 85 82 82 ILE ILE A . n A 1 86 LEU 86 83 83 LEU LEU A . n A 1 87 PRO 87 84 84 PRO PRO A . n A 1 88 ILE 88 85 85 ILE ILE A . n A 1 89 GLU 89 86 86 GLU GLU A . n A 1 90 VAL 90 87 87 VAL VAL A . n A 1 91 TYR 91 88 88 TYR TYR A . n A 1 92 PHE 92 89 89 PHE PHE A . n A 1 93 LYS 93 90 90 LYS LYS A . n A 1 94 ASN 94 91 91 ASN ASN A . n A 1 95 LYS 95 92 92 LYS LYS A . n A 1 96 GLU 96 93 93 GLU GLU A . n A 1 97 GLU 97 94 94 GLU GLU A . n A 1 98 PRO 98 95 95 PRO PRO A . n A 1 99 ARG 99 96 96 ARG ARG A . n A 1 100 LYS 100 97 97 LYS LYS A . n A 1 101 VAL 101 98 98 VAL VAL A . n A 1 102 ARG 102 99 99 ARG ARG A . n A 1 103 PHE 103 100 100 PHE PHE A . n A 1 104 ASP 104 101 101 ASP ASP A . n A 1 105 TYR 105 102 102 TYR TYR A . n A 1 106 ASP 106 103 103 ASP ASP A . n A 1 107 LEU 107 104 104 LEU LEU A . n A 1 108 PHE 108 105 105 PHE PHE A . n A 1 109 LEU 109 106 106 LEU LEU A . n A 1 110 HIS 110 107 107 HIS HIS A . n A 1 111 LEU 111 108 108 LEU LEU A . n A 1 112 GLU 112 109 109 GLU GLU A . n A 1 113 GLY 113 110 110 GLY GLY A . n A 1 114 HIS 114 111 111 HIS HIS A . n A 1 115 PRO 115 112 112 PRO PRO A . n A 1 116 PRO 116 113 113 PRO PRO A . n A 1 117 VAL 117 114 114 VAL VAL A . n A 1 118 ASN 118 115 115 ASN ASN A . n A 1 119 HIS 119 116 116 HIS HIS A . n A 1 120 LEU 120 117 117 LEU LEU A . n A 1 121 ARG 121 118 118 ARG ARG A . n A 1 122 CYS 122 119 119 CYS CYS A . n A 1 123 GLU 123 120 120 GLU GLU A . n A 1 124 LYS 124 121 121 LYS LYS A . n A 1 125 LEU 125 122 122 LEU LEU A . n A 1 126 THR 126 123 123 THR THR A . n A 1 127 PHE 127 124 124 PHE PHE A . n A 1 128 ASN 128 125 125 ASN ASN A . n A 1 129 ASN 129 126 126 ASN ASN A . n A 1 130 PRO 130 127 127 PRO PRO A . n A 1 131 THR 131 128 128 THR THR A . n A 1 132 GLU 132 129 129 GLU GLU A . n A 1 133 ASP 133 130 130 ASP ASP A . n A 1 134 PHE 134 131 131 PHE PHE A . n A 1 135 ARG 135 132 132 ARG ARG A . n A 1 136 ARG 136 133 133 ARG ARG A . n A 1 137 LYS 137 134 134 LYS LYS A . n A 1 138 LEU 138 135 135 LEU LEU A . n A 1 139 LEU 139 136 136 LEU LEU A . n A 1 140 LYS 140 137 137 LYS LYS A . n A 1 141 ALA 141 138 138 ALA ALA A . n B 2 1 EDX 1 1 1 EDX LIG C . n B 2 2 ALO 2 2 1 ALO LIG C . n B 2 3 ALA 3 3 1 ALA LIG C . n B 2 4 EE0 4 4 1 EE0 LIG C . n B 2 5 EE3 5 5 1 EE3 LIG C . n B 2 6 NH2 6 6 1 NH2 LIG C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 201 3 HOH HOH A . C 3 HOH 2 202 4 HOH HOH A . C 3 HOH 3 203 1 HOH HOH A . C 3 HOH 4 204 2 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-10-28 2 'Structure model' 1 1 2021-05-05 3 'Structure model' 2 0 2023-11-15 4 'Structure model' 2 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' atom_site 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 7 3 'Structure model' struct_conn 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_atom_site.auth_atom_id' 14 3 'Structure model' '_atom_site.label_atom_id' 15 3 'Structure model' '_database_2.pdbx_DOI' 16 3 'Structure model' '_database_2.pdbx_database_accession' 17 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 18 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _pdbx_entry_details.entry_id 6L5Z _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 137 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -91.15 _pdbx_validate_torsion.psi 43.92 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 1 Y 1 A MET 1 ? A MET 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ALO N N N N 14 ALO CA C N S 15 ALO CB C N S 16 ALO CG2 C N N 17 ALO OG1 O N N 18 ALO C C N N 19 ALO O O N N 20 ALO OXT O N N 21 ALO H H N N 22 ALO H2 H N N 23 ALO HA H N N 24 ALO HB H N N 25 ALO HG21 H N N 26 ALO HG22 H N N 27 ALO HG23 H N N 28 ALO HG1 H N N 29 ALO HXT H N N 30 ARG N N N N 31 ARG CA C N S 32 ARG C C N N 33 ARG O O N N 34 ARG CB C N N 35 ARG CG C N N 36 ARG CD C N N 37 ARG NE N N N 38 ARG CZ C N N 39 ARG NH1 N N N 40 ARG NH2 N N N 41 ARG OXT O N N 42 ARG H H N N 43 ARG H2 H N N 44 ARG HA H N N 45 ARG HB2 H N N 46 ARG HB3 H N N 47 ARG HG2 H N N 48 ARG HG3 H N N 49 ARG HD2 H N N 50 ARG HD3 H N N 51 ARG HE H N N 52 ARG HH11 H N N 53 ARG HH12 H N N 54 ARG HH21 H N N 55 ARG HH22 H N N 56 ARG HXT H N N 57 ASN N N N N 58 ASN CA C N S 59 ASN C C N N 60 ASN O O N N 61 ASN CB C N N 62 ASN CG C N N 63 ASN OD1 O N N 64 ASN ND2 N N N 65 ASN OXT O N N 66 ASN H H N N 67 ASN H2 H N N 68 ASN HA H N N 69 ASN HB2 H N N 70 ASN HB3 H N N 71 ASN HD21 H N N 72 ASN HD22 H N N 73 ASN HXT H N N 74 ASP N N N N 75 ASP CA C N S 76 ASP C C N N 77 ASP O O N N 78 ASP CB C N N 79 ASP CG C N N 80 ASP OD1 O N N 81 ASP OD2 O N N 82 ASP OXT O N N 83 ASP H H N N 84 ASP H2 H N N 85 ASP HA H N N 86 ASP HB2 H N N 87 ASP HB3 H N N 88 ASP HD2 H N N 89 ASP HXT H N N 90 CYS N N N N 91 CYS CA C N R 92 CYS C C N N 93 CYS O O N N 94 CYS CB C N N 95 CYS SG S N N 96 CYS OXT O N N 97 CYS H H N N 98 CYS H2 H N N 99 CYS HA H N N 100 CYS HB2 H N N 101 CYS HB3 H N N 102 CYS HG H N N 103 CYS HXT H N N 104 EDX C20 C N N 105 EDX C21 C N N 106 EDX C22 C N N 107 EDX C06 C N N 108 EDX C08 C N S 109 EDX C23 C N N 110 EDX C25 C N N 111 EDX N09 N N N 112 EDX N24 N N N 113 EDX N26 N N N 114 EDX N27 N N N 115 EDX O07 O N N 116 EDX O1 O N N 117 EDX H1 H N N 118 EDX H2 H N N 119 EDX H3 H N N 120 EDX H4 H N N 121 EDX H5 H N N 122 EDX H6 H N N 123 EDX H7 H N N 124 EDX H8 H N N 125 EDX H9 H N N 126 EDX H10 H N N 127 EDX H13 H N N 128 EDX H14 H N N 129 EDX H15 H N N 130 EDX H16 H N N 131 EDX H17 H N N 132 EDX C1 C N N 133 EDX O2 O N N 134 EDX O3 O N N 135 EDX C2 C N N 136 EDX C3 C Y N 137 EDX C4 C Y N 138 EDX C5 C Y N 139 EDX C6 C Y N 140 EDX C7 C Y N 141 EDX C8 C Y N 142 EDX H11 H N N 143 EDX H12 H N N 144 EDX H18 H N N 145 EDX H19 H N N 146 EDX H20 H N N 147 EDX H21 H N N 148 EDX H22 H N N 149 EE0 C28 C N N 150 EE0 C29 C N N 151 EE0 C30 C N N 152 EE0 CA C N R 153 EE0 C C N N 154 EE0 N N N N 155 EE0 O O N N 156 EE0 OXT O N N 157 EE0 H1 H N N 158 EE0 H8 H N N 159 EE0 H3 H N N 160 EE0 H4 H N N 161 EE0 H5 H N N 162 EE0 H6 H N N 163 EE0 H7 H N N 164 EE0 HA H N N 165 EE0 H H N N 166 EE0 H2 H N N 167 EE0 HXT H N N 168 EE3 CA C N S 169 EE3 C36 C N N 170 EE3 C37 C N N 171 EE3 C38 C N N 172 EE3 C39 C N N 173 EE3 C41 C N N 174 EE3 C43 C Y N 175 EE3 C44 C Y N 176 EE3 C46 C Y N 177 EE3 C C N N 178 EE3 N N N N 179 EE3 N40 N N N 180 EE3 N45 N Y N 181 EE3 O42 O N N 182 EE3 O47 O Y N 183 EE3 O O N N 184 EE3 HA H N N 185 EE3 H1 H N N 186 EE3 H3 H N N 187 EE3 H4 H N N 188 EE3 H5 H N N 189 EE3 H6 H N N 190 EE3 H7 H N N 191 EE3 H8 H N N 192 EE3 H9 H N N 193 EE3 H10 H N N 194 EE3 H11 H N N 195 EE3 H H N N 196 EE3 H2 H N N 197 EE3 H16 H N N 198 EE3 OXT O N N 199 EE3 HXT H N N 200 GLN N N N N 201 GLN CA C N S 202 GLN C C N N 203 GLN O O N N 204 GLN CB C N N 205 GLN CG C N N 206 GLN CD C N N 207 GLN OE1 O N N 208 GLN NE2 N N N 209 GLN OXT O N N 210 GLN H H N N 211 GLN H2 H N N 212 GLN HA H N N 213 GLN HB2 H N N 214 GLN HB3 H N N 215 GLN HG2 H N N 216 GLN HG3 H N N 217 GLN HE21 H N N 218 GLN HE22 H N N 219 GLN HXT H N N 220 GLU N N N N 221 GLU CA C N S 222 GLU C C N N 223 GLU O O N N 224 GLU CB C N N 225 GLU CG C N N 226 GLU CD C N N 227 GLU OE1 O N N 228 GLU OE2 O N N 229 GLU OXT O N N 230 GLU H H N N 231 GLU H2 H N N 232 GLU HA H N N 233 GLU HB2 H N N 234 GLU HB3 H N N 235 GLU HG2 H N N 236 GLU HG3 H N N 237 GLU HE2 H N N 238 GLU HXT H N N 239 GLY N N N N 240 GLY CA C N N 241 GLY C C N N 242 GLY O O N N 243 GLY OXT O N N 244 GLY H H N N 245 GLY H2 H N N 246 GLY HA2 H N N 247 GLY HA3 H N N 248 GLY HXT H N N 249 HIS N N N N 250 HIS CA C N S 251 HIS C C N N 252 HIS O O N N 253 HIS CB C N N 254 HIS CG C Y N 255 HIS ND1 N Y N 256 HIS CD2 C Y N 257 HIS CE1 C Y N 258 HIS NE2 N Y N 259 HIS OXT O N N 260 HIS H H N N 261 HIS H2 H N N 262 HIS HA H N N 263 HIS HB2 H N N 264 HIS HB3 H N N 265 HIS HD1 H N N 266 HIS HD2 H N N 267 HIS HE1 H N N 268 HIS HE2 H N N 269 HIS HXT H N N 270 HOH O O N N 271 HOH H1 H N N 272 HOH H2 H N N 273 ILE N N N N 274 ILE CA C N S 275 ILE C C N N 276 ILE O O N N 277 ILE CB C N S 278 ILE CG1 C N N 279 ILE CG2 C N N 280 ILE CD1 C N N 281 ILE OXT O N N 282 ILE H H N N 283 ILE H2 H N N 284 ILE HA H N N 285 ILE HB H N N 286 ILE HG12 H N N 287 ILE HG13 H N N 288 ILE HG21 H N N 289 ILE HG22 H N N 290 ILE HG23 H N N 291 ILE HD11 H N N 292 ILE HD12 H N N 293 ILE HD13 H N N 294 ILE HXT H N N 295 LEU N N N N 296 LEU CA C N S 297 LEU C C N N 298 LEU O O N N 299 LEU CB C N N 300 LEU CG C N N 301 LEU CD1 C N N 302 LEU CD2 C N N 303 LEU OXT O N N 304 LEU H H N N 305 LEU H2 H N N 306 LEU HA H N N 307 LEU HB2 H N N 308 LEU HB3 H N N 309 LEU HG H N N 310 LEU HD11 H N N 311 LEU HD12 H N N 312 LEU HD13 H N N 313 LEU HD21 H N N 314 LEU HD22 H N N 315 LEU HD23 H N N 316 LEU HXT H N N 317 LYS N N N N 318 LYS CA C N S 319 LYS C C N N 320 LYS O O N N 321 LYS CB C N N 322 LYS CG C N N 323 LYS CD C N N 324 LYS CE C N N 325 LYS NZ N N N 326 LYS OXT O N N 327 LYS H H N N 328 LYS H2 H N N 329 LYS HA H N N 330 LYS HB2 H N N 331 LYS HB3 H N N 332 LYS HG2 H N N 333 LYS HG3 H N N 334 LYS HD2 H N N 335 LYS HD3 H N N 336 LYS HE2 H N N 337 LYS HE3 H N N 338 LYS HZ1 H N N 339 LYS HZ2 H N N 340 LYS HZ3 H N N 341 LYS HXT H N N 342 MET N N N N 343 MET CA C N S 344 MET C C N N 345 MET O O N N 346 MET CB C N N 347 MET CG C N N 348 MET SD S N N 349 MET CE C N N 350 MET OXT O N N 351 MET H H N N 352 MET H2 H N N 353 MET HA H N N 354 MET HB2 H N N 355 MET HB3 H N N 356 MET HG2 H N N 357 MET HG3 H N N 358 MET HE1 H N N 359 MET HE2 H N N 360 MET HE3 H N N 361 MET HXT H N N 362 NH2 N N N N 363 NH2 HN1 H N N 364 NH2 HN2 H N N 365 PHE N N N N 366 PHE CA C N S 367 PHE C C N N 368 PHE O O N N 369 PHE CB C N N 370 PHE CG C Y N 371 PHE CD1 C Y N 372 PHE CD2 C Y N 373 PHE CE1 C Y N 374 PHE CE2 C Y N 375 PHE CZ C Y N 376 PHE OXT O N N 377 PHE H H N N 378 PHE H2 H N N 379 PHE HA H N N 380 PHE HB2 H N N 381 PHE HB3 H N N 382 PHE HD1 H N N 383 PHE HD2 H N N 384 PHE HE1 H N N 385 PHE HE2 H N N 386 PHE HZ H N N 387 PHE HXT H N N 388 PRO N N N N 389 PRO CA C N S 390 PRO C C N N 391 PRO O O N N 392 PRO CB C N N 393 PRO CG C N N 394 PRO CD C N N 395 PRO OXT O N N 396 PRO H H N N 397 PRO HA H N N 398 PRO HB2 H N N 399 PRO HB3 H N N 400 PRO HG2 H N N 401 PRO HG3 H N N 402 PRO HD2 H N N 403 PRO HD3 H N N 404 PRO HXT H N N 405 SER N N N N 406 SER CA C N S 407 SER C C N N 408 SER O O N N 409 SER CB C N N 410 SER OG O N N 411 SER OXT O N N 412 SER H H N N 413 SER H2 H N N 414 SER HA H N N 415 SER HB2 H N N 416 SER HB3 H N N 417 SER HG H N N 418 SER HXT H N N 419 THR N N N N 420 THR CA C N S 421 THR C C N N 422 THR O O N N 423 THR CB C N R 424 THR OG1 O N N 425 THR CG2 C N N 426 THR OXT O N N 427 THR H H N N 428 THR H2 H N N 429 THR HA H N N 430 THR HB H N N 431 THR HG1 H N N 432 THR HG21 H N N 433 THR HG22 H N N 434 THR HG23 H N N 435 THR HXT H N N 436 TRP N N N N 437 TRP CA C N S 438 TRP C C N N 439 TRP O O N N 440 TRP CB C N N 441 TRP CG C Y N 442 TRP CD1 C Y N 443 TRP CD2 C Y N 444 TRP NE1 N Y N 445 TRP CE2 C Y N 446 TRP CE3 C Y N 447 TRP CZ2 C Y N 448 TRP CZ3 C Y N 449 TRP CH2 C Y N 450 TRP OXT O N N 451 TRP H H N N 452 TRP H2 H N N 453 TRP HA H N N 454 TRP HB2 H N N 455 TRP HB3 H N N 456 TRP HD1 H N N 457 TRP HE1 H N N 458 TRP HE3 H N N 459 TRP HZ2 H N N 460 TRP HZ3 H N N 461 TRP HH2 H N N 462 TRP HXT H N N 463 TYR N N N N 464 TYR CA C N S 465 TYR C C N N 466 TYR O O N N 467 TYR CB C N N 468 TYR CG C Y N 469 TYR CD1 C Y N 470 TYR CD2 C Y N 471 TYR CE1 C Y N 472 TYR CE2 C Y N 473 TYR CZ C Y N 474 TYR OH O N N 475 TYR OXT O N N 476 TYR H H N N 477 TYR H2 H N N 478 TYR HA H N N 479 TYR HB2 H N N 480 TYR HB3 H N N 481 TYR HD1 H N N 482 TYR HD2 H N N 483 TYR HE1 H N N 484 TYR HE2 H N N 485 TYR HH H N N 486 TYR HXT H N N 487 VAL N N N N 488 VAL CA C N S 489 VAL C C N N 490 VAL O O N N 491 VAL CB C N N 492 VAL CG1 C N N 493 VAL CG2 C N N 494 VAL OXT O N N 495 VAL H H N N 496 VAL H2 H N N 497 VAL HA H N N 498 VAL HB H N N 499 VAL HG11 H N N 500 VAL HG12 H N N 501 VAL HG13 H N N 502 VAL HG21 H N N 503 VAL HG22 H N N 504 VAL HG23 H N N 505 VAL HXT H N N 506 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ALO N CA sing N N 13 ALO N H sing N N 14 ALO N H2 sing N N 15 ALO CA CB sing N N 16 ALO CA C sing N N 17 ALO CA HA sing N N 18 ALO CB CG2 sing N N 19 ALO CB OG1 sing N N 20 ALO CB HB sing N N 21 ALO CG2 HG21 sing N N 22 ALO CG2 HG22 sing N N 23 ALO CG2 HG23 sing N N 24 ALO OG1 HG1 sing N N 25 ALO C O doub N N 26 ALO C OXT sing N N 27 ALO OXT HXT sing N N 28 ARG N CA sing N N 29 ARG N H sing N N 30 ARG N H2 sing N N 31 ARG CA C sing N N 32 ARG CA CB sing N N 33 ARG CA HA sing N N 34 ARG C O doub N N 35 ARG C OXT sing N N 36 ARG CB CG sing N N 37 ARG CB HB2 sing N N 38 ARG CB HB3 sing N N 39 ARG CG CD sing N N 40 ARG CG HG2 sing N N 41 ARG CG HG3 sing N N 42 ARG CD NE sing N N 43 ARG CD HD2 sing N N 44 ARG CD HD3 sing N N 45 ARG NE CZ sing N N 46 ARG NE HE sing N N 47 ARG CZ NH1 sing N N 48 ARG CZ NH2 doub N N 49 ARG NH1 HH11 sing N N 50 ARG NH1 HH12 sing N N 51 ARG NH2 HH21 sing N N 52 ARG NH2 HH22 sing N N 53 ARG OXT HXT sing N N 54 ASN N CA sing N N 55 ASN N H sing N N 56 ASN N H2 sing N N 57 ASN CA C sing N N 58 ASN CA CB sing N N 59 ASN CA HA sing N N 60 ASN C O doub N N 61 ASN C OXT sing N N 62 ASN CB CG sing N N 63 ASN CB HB2 sing N N 64 ASN CB HB3 sing N N 65 ASN CG OD1 doub N N 66 ASN CG ND2 sing N N 67 ASN ND2 HD21 sing N N 68 ASN ND2 HD22 sing N N 69 ASN OXT HXT sing N N 70 ASP N CA sing N N 71 ASP N H sing N N 72 ASP N H2 sing N N 73 ASP CA C sing N N 74 ASP CA CB sing N N 75 ASP CA HA sing N N 76 ASP C O doub N N 77 ASP C OXT sing N N 78 ASP CB CG sing N N 79 ASP CB HB2 sing N N 80 ASP CB HB3 sing N N 81 ASP CG OD1 doub N N 82 ASP CG OD2 sing N N 83 ASP OD2 HD2 sing N N 84 ASP OXT HXT sing N N 85 CYS N CA sing N N 86 CYS N H sing N N 87 CYS N H2 sing N N 88 CYS CA C sing N N 89 CYS CA CB sing N N 90 CYS CA HA sing N N 91 CYS C O doub N N 92 CYS C OXT sing N N 93 CYS CB SG sing N N 94 CYS CB HB2 sing N N 95 CYS CB HB3 sing N N 96 CYS SG HG sing N N 97 CYS OXT HXT sing N N 98 EDX N27 C25 doub N N 99 EDX C25 N26 sing N N 100 EDX C25 N24 sing N N 101 EDX N24 C23 sing N N 102 EDX C23 C22 sing N N 103 EDX C22 C21 sing N N 104 EDX C20 C21 sing N N 105 EDX C20 C08 sing N N 106 EDX O07 C06 doub N N 107 EDX C06 C08 sing N N 108 EDX C08 N09 sing N N 109 EDX C06 O1 sing N N 110 EDX C20 H1 sing N N 111 EDX C20 H2 sing N N 112 EDX C21 H3 sing N N 113 EDX C21 H4 sing N N 114 EDX C22 H5 sing N N 115 EDX C22 H6 sing N N 116 EDX C08 H7 sing N N 117 EDX C23 H8 sing N N 118 EDX C23 H9 sing N N 119 EDX N09 H10 sing N N 120 EDX N24 H13 sing N N 121 EDX N26 H14 sing N N 122 EDX N26 H15 sing N N 123 EDX N27 H16 sing N N 124 EDX O1 H17 sing N N 125 EDX N09 C1 sing N N 126 EDX C1 O2 doub N N 127 EDX C1 O3 sing N N 128 EDX O3 C2 sing N N 129 EDX C2 C3 sing N N 130 EDX C3 C4 sing Y N 131 EDX C4 C5 doub Y N 132 EDX C5 C6 sing Y N 133 EDX C6 C7 doub Y N 134 EDX C7 C8 sing Y N 135 EDX C8 C3 doub Y N 136 EDX C2 H11 sing N N 137 EDX C2 H12 sing N N 138 EDX C4 H18 sing N N 139 EDX C5 H19 sing N N 140 EDX C6 H20 sing N N 141 EDX C7 H21 sing N N 142 EDX C8 H22 sing N N 143 EE0 O C doub N N 144 EE0 C CA sing N N 145 EE0 CA C30 sing N N 146 EE0 CA N sing N N 147 EE0 C30 C29 sing N N 148 EE0 C28 C29 sing N N 149 EE0 C OXT sing N N 150 EE0 C28 H1 sing N N 151 EE0 C28 H8 sing N N 152 EE0 C28 H3 sing N N 153 EE0 C29 H4 sing N N 154 EE0 C29 H5 sing N N 155 EE0 C30 H6 sing N N 156 EE0 C30 H7 sing N N 157 EE0 CA HA sing N N 158 EE0 N H sing N N 159 EE0 N H2 sing N N 160 EE0 OXT HXT sing N N 161 EE3 O C doub N N 162 EE3 C CA sing N N 163 EE3 CA C36 sing N N 164 EE3 CA N sing N N 165 EE3 C36 C37 sing N N 166 EE3 C37 C38 sing N N 167 EE3 C38 C39 sing N N 168 EE3 C39 N40 sing N N 169 EE3 N40 C41 sing N N 170 EE3 O47 C46 sing Y N 171 EE3 O47 C43 sing Y N 172 EE3 C46 N45 doub Y N 173 EE3 C43 C41 sing N N 174 EE3 C43 C44 doub Y N 175 EE3 C41 O42 doub N N 176 EE3 N45 C44 sing Y N 177 EE3 CA HA sing N N 178 EE3 C36 H1 sing N N 179 EE3 C36 H3 sing N N 180 EE3 C37 H4 sing N N 181 EE3 C37 H5 sing N N 182 EE3 C38 H6 sing N N 183 EE3 C38 H7 sing N N 184 EE3 C39 H8 sing N N 185 EE3 C39 H9 sing N N 186 EE3 C44 H10 sing N N 187 EE3 C46 H11 sing N N 188 EE3 N H sing N N 189 EE3 N H2 sing N N 190 EE3 N40 H16 sing N N 191 EE3 C OXT sing N N 192 EE3 OXT HXT sing N N 193 GLN N CA sing N N 194 GLN N H sing N N 195 GLN N H2 sing N N 196 GLN CA C sing N N 197 GLN CA CB sing N N 198 GLN CA HA sing N N 199 GLN C O doub N N 200 GLN C OXT sing N N 201 GLN CB CG sing N N 202 GLN CB HB2 sing N N 203 GLN CB HB3 sing N N 204 GLN CG CD sing N N 205 GLN CG HG2 sing N N 206 GLN CG HG3 sing N N 207 GLN CD OE1 doub N N 208 GLN CD NE2 sing N N 209 GLN NE2 HE21 sing N N 210 GLN NE2 HE22 sing N N 211 GLN OXT HXT sing N N 212 GLU N CA sing N N 213 GLU N H sing N N 214 GLU N H2 sing N N 215 GLU CA C sing N N 216 GLU CA CB sing N N 217 GLU CA HA sing N N 218 GLU C O doub N N 219 GLU C OXT sing N N 220 GLU CB CG sing N N 221 GLU CB HB2 sing N N 222 GLU CB HB3 sing N N 223 GLU CG CD sing N N 224 GLU CG HG2 sing N N 225 GLU CG HG3 sing N N 226 GLU CD OE1 doub N N 227 GLU CD OE2 sing N N 228 GLU OE2 HE2 sing N N 229 GLU OXT HXT sing N N 230 GLY N CA sing N N 231 GLY N H sing N N 232 GLY N H2 sing N N 233 GLY CA C sing N N 234 GLY CA HA2 sing N N 235 GLY CA HA3 sing N N 236 GLY C O doub N N 237 GLY C OXT sing N N 238 GLY OXT HXT sing N N 239 HIS N CA sing N N 240 HIS N H sing N N 241 HIS N H2 sing N N 242 HIS CA C sing N N 243 HIS CA CB sing N N 244 HIS CA HA sing N N 245 HIS C O doub N N 246 HIS C OXT sing N N 247 HIS CB CG sing N N 248 HIS CB HB2 sing N N 249 HIS CB HB3 sing N N 250 HIS CG ND1 sing Y N 251 HIS CG CD2 doub Y N 252 HIS ND1 CE1 doub Y N 253 HIS ND1 HD1 sing N N 254 HIS CD2 NE2 sing Y N 255 HIS CD2 HD2 sing N N 256 HIS CE1 NE2 sing Y N 257 HIS CE1 HE1 sing N N 258 HIS NE2 HE2 sing N N 259 HIS OXT HXT sing N N 260 HOH O H1 sing N N 261 HOH O H2 sing N N 262 ILE N CA sing N N 263 ILE N H sing N N 264 ILE N H2 sing N N 265 ILE CA C sing N N 266 ILE CA CB sing N N 267 ILE CA HA sing N N 268 ILE C O doub N N 269 ILE C OXT sing N N 270 ILE CB CG1 sing N N 271 ILE CB CG2 sing N N 272 ILE CB HB sing N N 273 ILE CG1 CD1 sing N N 274 ILE CG1 HG12 sing N N 275 ILE CG1 HG13 sing N N 276 ILE CG2 HG21 sing N N 277 ILE CG2 HG22 sing N N 278 ILE CG2 HG23 sing N N 279 ILE CD1 HD11 sing N N 280 ILE CD1 HD12 sing N N 281 ILE CD1 HD13 sing N N 282 ILE OXT HXT sing N N 283 LEU N CA sing N N 284 LEU N H sing N N 285 LEU N H2 sing N N 286 LEU CA C sing N N 287 LEU CA CB sing N N 288 LEU CA HA sing N N 289 LEU C O doub N N 290 LEU C OXT sing N N 291 LEU CB CG sing N N 292 LEU CB HB2 sing N N 293 LEU CB HB3 sing N N 294 LEU CG CD1 sing N N 295 LEU CG CD2 sing N N 296 LEU CG HG sing N N 297 LEU CD1 HD11 sing N N 298 LEU CD1 HD12 sing N N 299 LEU CD1 HD13 sing N N 300 LEU CD2 HD21 sing N N 301 LEU CD2 HD22 sing N N 302 LEU CD2 HD23 sing N N 303 LEU OXT HXT sing N N 304 LYS N CA sing N N 305 LYS N H sing N N 306 LYS N H2 sing N N 307 LYS CA C sing N N 308 LYS CA CB sing N N 309 LYS CA HA sing N N 310 LYS C O doub N N 311 LYS C OXT sing N N 312 LYS CB CG sing N N 313 LYS CB HB2 sing N N 314 LYS CB HB3 sing N N 315 LYS CG CD sing N N 316 LYS CG HG2 sing N N 317 LYS CG HG3 sing N N 318 LYS CD CE sing N N 319 LYS CD HD2 sing N N 320 LYS CD HD3 sing N N 321 LYS CE NZ sing N N 322 LYS CE HE2 sing N N 323 LYS CE HE3 sing N N 324 LYS NZ HZ1 sing N N 325 LYS NZ HZ2 sing N N 326 LYS NZ HZ3 sing N N 327 LYS OXT HXT sing N N 328 MET N CA sing N N 329 MET N H sing N N 330 MET N H2 sing N N 331 MET CA C sing N N 332 MET CA CB sing N N 333 MET CA HA sing N N 334 MET C O doub N N 335 MET C OXT sing N N 336 MET CB CG sing N N 337 MET CB HB2 sing N N 338 MET CB HB3 sing N N 339 MET CG SD sing N N 340 MET CG HG2 sing N N 341 MET CG HG3 sing N N 342 MET SD CE sing N N 343 MET CE HE1 sing N N 344 MET CE HE2 sing N N 345 MET CE HE3 sing N N 346 MET OXT HXT sing N N 347 NH2 N HN1 sing N N 348 NH2 N HN2 sing N N 349 PHE N CA sing N N 350 PHE N H sing N N 351 PHE N H2 sing N N 352 PHE CA C sing N N 353 PHE CA CB sing N N 354 PHE CA HA sing N N 355 PHE C O doub N N 356 PHE C OXT sing N N 357 PHE CB CG sing N N 358 PHE CB HB2 sing N N 359 PHE CB HB3 sing N N 360 PHE CG CD1 doub Y N 361 PHE CG CD2 sing Y N 362 PHE CD1 CE1 sing Y N 363 PHE CD1 HD1 sing N N 364 PHE CD2 CE2 doub Y N 365 PHE CD2 HD2 sing N N 366 PHE CE1 CZ doub Y N 367 PHE CE1 HE1 sing N N 368 PHE CE2 CZ sing Y N 369 PHE CE2 HE2 sing N N 370 PHE CZ HZ sing N N 371 PHE OXT HXT sing N N 372 PRO N CA sing N N 373 PRO N CD sing N N 374 PRO N H sing N N 375 PRO CA C sing N N 376 PRO CA CB sing N N 377 PRO CA HA sing N N 378 PRO C O doub N N 379 PRO C OXT sing N N 380 PRO CB CG sing N N 381 PRO CB HB2 sing N N 382 PRO CB HB3 sing N N 383 PRO CG CD sing N N 384 PRO CG HG2 sing N N 385 PRO CG HG3 sing N N 386 PRO CD HD2 sing N N 387 PRO CD HD3 sing N N 388 PRO OXT HXT sing N N 389 SER N CA sing N N 390 SER N H sing N N 391 SER N H2 sing N N 392 SER CA C sing N N 393 SER CA CB sing N N 394 SER CA HA sing N N 395 SER C O doub N N 396 SER C OXT sing N N 397 SER CB OG sing N N 398 SER CB HB2 sing N N 399 SER CB HB3 sing N N 400 SER OG HG sing N N 401 SER OXT HXT sing N N 402 THR N CA sing N N 403 THR N H sing N N 404 THR N H2 sing N N 405 THR CA C sing N N 406 THR CA CB sing N N 407 THR CA HA sing N N 408 THR C O doub N N 409 THR C OXT sing N N 410 THR CB OG1 sing N N 411 THR CB CG2 sing N N 412 THR CB HB sing N N 413 THR OG1 HG1 sing N N 414 THR CG2 HG21 sing N N 415 THR CG2 HG22 sing N N 416 THR CG2 HG23 sing N N 417 THR OXT HXT sing N N 418 TRP N CA sing N N 419 TRP N H sing N N 420 TRP N H2 sing N N 421 TRP CA C sing N N 422 TRP CA CB sing N N 423 TRP CA HA sing N N 424 TRP C O doub N N 425 TRP C OXT sing N N 426 TRP CB CG sing N N 427 TRP CB HB2 sing N N 428 TRP CB HB3 sing N N 429 TRP CG CD1 doub Y N 430 TRP CG CD2 sing Y N 431 TRP CD1 NE1 sing Y N 432 TRP CD1 HD1 sing N N 433 TRP CD2 CE2 doub Y N 434 TRP CD2 CE3 sing Y N 435 TRP NE1 CE2 sing Y N 436 TRP NE1 HE1 sing N N 437 TRP CE2 CZ2 sing Y N 438 TRP CE3 CZ3 doub Y N 439 TRP CE3 HE3 sing N N 440 TRP CZ2 CH2 doub Y N 441 TRP CZ2 HZ2 sing N N 442 TRP CZ3 CH2 sing Y N 443 TRP CZ3 HZ3 sing N N 444 TRP CH2 HH2 sing N N 445 TRP OXT HXT sing N N 446 TYR N CA sing N N 447 TYR N H sing N N 448 TYR N H2 sing N N 449 TYR CA C sing N N 450 TYR CA CB sing N N 451 TYR CA HA sing N N 452 TYR C O doub N N 453 TYR C OXT sing N N 454 TYR CB CG sing N N 455 TYR CB HB2 sing N N 456 TYR CB HB3 sing N N 457 TYR CG CD1 doub Y N 458 TYR CG CD2 sing Y N 459 TYR CD1 CE1 sing Y N 460 TYR CD1 HD1 sing N N 461 TYR CD2 CE2 doub Y N 462 TYR CD2 HD2 sing N N 463 TYR CE1 CZ doub Y N 464 TYR CE1 HE1 sing N N 465 TYR CE2 CZ sing Y N 466 TYR CE2 HE2 sing N N 467 TYR CZ OH sing N N 468 TYR OH HH sing N N 469 TYR OXT HXT sing N N 470 VAL N CA sing N N 471 VAL N H sing N N 472 VAL N H2 sing N N 473 VAL CA C sing N N 474 VAL CA CB sing N N 475 VAL CA HA sing N N 476 VAL C O doub N N 477 VAL C OXT sing N N 478 VAL CB CG1 sing N N 479 VAL CB CG2 sing N N 480 VAL CB HB sing N N 481 VAL CG1 HG11 sing N N 482 VAL CG1 HG12 sing N N 483 VAL CG1 HG13 sing N N 484 VAL CG2 HG21 sing N N 485 VAL CG2 HG22 sing N N 486 VAL CG2 HG23 sing N N 487 VAL OXT HXT sing N N 488 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China (NSFC)' China 91753203 1 'National Natural Science Foundation of China (NSFC)' China 31922016 2 'National Natural Science Foundation of China (NSFC)' China 31871283 3 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4TMP _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details monomer #