data_6L6A # _entry.id 6L6A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6L6A pdb_00006l6a 10.2210/pdb6l6a/pdb WWPDB D_1300014289 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6L6A _pdbx_database_status.recvd_initial_deposition_date 2019-10-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Kamitori, S.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-3950-3372 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Structures of human galectin-10/monosaccharide complexes demonstrate potential of monosaccharides as effectors in forming Charcot-Leyden crystals. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2020.02.037 _citation.pdbx_database_id_PubMed 32081418 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Itoh, A.' 1 ? primary 'Nonaka, Y.' 2 ? primary 'Nakakita, S.I.' 3 ? primary 'Yoshida, H.' 4 ? primary 'Nishi, N.' 5 ? primary 'Nakamura, T.' 6 ? primary 'Kamitori, S.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6L6A _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.830 _cell.length_a_esd ? _cell.length_b 48.830 _cell.length_b_esd ? _cell.length_c 260.940 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6L6A _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Galectin-10 16644.016 1 ? ? ? ? 2 non-polymer man beta-D-mannopyranose 180.156 1 ? ? ? ? 3 water nat water 18.015 85 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Gal-10,Charcot-Leyden crystal protein,CLC,Eosinophil lysophospholipase,Lysolecithin acylhydrolase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMSLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVES KNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMSLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVES KNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 SER n 1 5 LEU n 1 6 LEU n 1 7 PRO n 1 8 VAL n 1 9 PRO n 1 10 TYR n 1 11 THR n 1 12 GLU n 1 13 ALA n 1 14 ALA n 1 15 SER n 1 16 LEU n 1 17 SER n 1 18 THR n 1 19 GLY n 1 20 SER n 1 21 THR n 1 22 VAL n 1 23 THR n 1 24 ILE n 1 25 LYS n 1 26 GLY n 1 27 ARG n 1 28 PRO n 1 29 LEU n 1 30 VAL n 1 31 CYS n 1 32 PHE n 1 33 LEU n 1 34 ASN n 1 35 GLU n 1 36 PRO n 1 37 TYR n 1 38 LEU n 1 39 GLN n 1 40 VAL n 1 41 ASP n 1 42 PHE n 1 43 HIS n 1 44 THR n 1 45 GLU n 1 46 MET n 1 47 LYS n 1 48 GLU n 1 49 GLU n 1 50 SER n 1 51 ASP n 1 52 ILE n 1 53 VAL n 1 54 PHE n 1 55 HIS n 1 56 PHE n 1 57 GLN n 1 58 VAL n 1 59 CYS n 1 60 PHE n 1 61 GLY n 1 62 ARG n 1 63 ARG n 1 64 VAL n 1 65 VAL n 1 66 MET n 1 67 ASN n 1 68 SER n 1 69 ARG n 1 70 GLU n 1 71 TYR n 1 72 GLY n 1 73 ALA n 1 74 TRP n 1 75 LYS n 1 76 GLN n 1 77 GLN n 1 78 VAL n 1 79 GLU n 1 80 SER n 1 81 LYS n 1 82 ASN n 1 83 MET n 1 84 PRO n 1 85 PHE n 1 86 GLN n 1 87 ASP n 1 88 GLY n 1 89 GLN n 1 90 GLU n 1 91 PHE n 1 92 GLU n 1 93 LEU n 1 94 SER n 1 95 ILE n 1 96 SER n 1 97 VAL n 1 98 LEU n 1 99 PRO n 1 100 ASP n 1 101 LYS n 1 102 TYR n 1 103 GLN n 1 104 VAL n 1 105 MET n 1 106 VAL n 1 107 ASN n 1 108 GLY n 1 109 GLN n 1 110 SER n 1 111 SER n 1 112 TYR n 1 113 THR n 1 114 PHE n 1 115 ASP n 1 116 HIS n 1 117 ARG n 1 118 ILE n 1 119 LYS n 1 120 PRO n 1 121 GLU n 1 122 ALA n 1 123 VAL n 1 124 LYS n 1 125 MET n 1 126 VAL n 1 127 GLN n 1 128 VAL n 1 129 TRP n 1 130 ARG n 1 131 ASP n 1 132 ILE n 1 133 SER n 1 134 LEU n 1 135 THR n 1 136 LYS n 1 137 PHE n 1 138 ASN n 1 139 VAL n 1 140 SER n 1 141 TYR n 1 142 LEU n 1 143 LYS n 1 144 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 144 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CLC, LGALS10, LGALS10A' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LEG10_HUMAN _struct_ref.pdbx_db_accession Q05315 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKN MPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6L6A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 144 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q05315 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 142 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 142 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6L6A GLY A 1 ? UNP Q05315 ? ? 'expression tag' -1 1 1 6L6A SER A 2 ? UNP Q05315 ? ? 'expression tag' 0 2 1 6L6A VAL A 30 ? UNP Q05315 ALA 28 variant 28 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BMA 'D-saccharide, beta linking' . beta-D-mannopyranose 'beta-D-mannose; D-mannose; mannose' 'C6 H12 O6' 180.156 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6L6A _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.70 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.6 M ammonium sulfate, 0.1 M MES monohydrate pH 6.5, 10 % (v/v) 1,4-dioxane' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type RIGAKU _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-10-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type RIGAKU _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6L6A _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.81 _reflns.d_resolution_low 19.34 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17615 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.81 _reflns_shell.d_res_low 1.86 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1196 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.918 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.004 _refine.aniso_B[1][2] -0.002 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -0.004 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 0.012 _refine.B_iso_max ? _refine.B_iso_mean 16.726 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.949 _refine.correlation_coeff_Fo_to_Fc_free 0.928 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6L6A _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.810 _refine.ls_d_res_low 19.338 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17615 _refine.ls_number_reflns_R_free 908 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.041 _refine.ls_percent_reflns_R_free 5.155 _refine.ls_R_factor_all 0.190 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2222 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1886 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1QKQ _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.115 _refine.pdbx_overall_ESU_R_Free 0.113 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.190 _refine.overall_SU_ML 0.068 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1159 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 85 _refine_hist.number_atoms_total 1256 _refine_hist.d_res_high 1.810 _refine_hist.d_res_low 19.338 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.013 1199 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.017 1095 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.442 1.662 1622 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.271 1.584 2550 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 9.076 5.000 141 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.900 22.500 64 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.198 15.000 212 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 23.579 15.000 7 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.072 0.200 153 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1313 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 256 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.175 0.150 158 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.168 0.150 954 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.162 0.150 547 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.074 0.150 574 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.092 0.150 58 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.126 0.150 10 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.177 0.150 26 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.125 0.150 14 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 1.070 1.572 567 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.071 1.569 566 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.712 2.343 707 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.711 2.346 708 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 1.986 1.862 632 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 1.986 1.862 632 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 3.121 2.681 915 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.119 2.683 916 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 4.193 17.841 1226 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 4.162 17.725 1216 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.810 1.857 1250 . 58 1113 93.6800 . 0.283 . 0.334 . 0.281 . . . . . 0.216 . 20 . 0.902 0.895 'X-RAY DIFFRACTION' 1.857 1.907 1241 . 72 1130 96.8574 . 0.205 . 0.205 . 0.205 . . . . . 0.174 . 20 . 0.936 0.936 'X-RAY DIFFRACTION' 1.907 1.962 1226 . 48 1143 97.1452 . 0.191 . 0.302 . 0.187 . . . . . 0.156 . 20 . 0.937 0.898 'X-RAY DIFFRACTION' 1.962 2.022 1181 . 67 1081 97.2058 . 0.192 . 0.225 . 0.190 . . . . . 0.163 . 20 . 0.944 0.940 'X-RAY DIFFRACTION' 2.022 2.087 1133 . 53 1050 97.3522 . 0.173 . 0.207 . 0.171 . . . . . 0.149 . 20 . 0.961 0.952 'X-RAY DIFFRACTION' 2.087 2.159 1109 . 59 1026 97.8359 . 0.162 . 0.171 . 0.162 . . . . . 0.144 . 20 . 0.966 0.969 'X-RAY DIFFRACTION' 2.159 2.240 1089 . 51 1018 98.1635 . 0.188 . 0.228 . 0.186 . . . . . 0.164 . 20 . 0.958 0.937 'X-RAY DIFFRACTION' 2.240 2.330 1034 . 57 960 98.3559 . 0.182 . 0.220 . 0.180 . . . . . 0.162 . 20 . 0.956 0.952 'X-RAY DIFFRACTION' 2.330 2.432 1009 . 45 949 98.5134 . 0.188 . 0.235 . 0.186 . . . . . 0.164 . 20 . 0.954 0.946 'X-RAY DIFFRACTION' 2.432 2.549 959 . 46 903 98.9572 . 0.196 . 0.256 . 0.194 . . . . . 0.177 . 20 . 0.949 0.921 'X-RAY DIFFRACTION' 2.549 2.684 920 . 55 857 99.1304 . 0.199 . 0.248 . 0.195 . . . . . 0.178 . 20 . 0.948 0.937 'X-RAY DIFFRACTION' 2.684 2.843 882 . 39 836 99.2063 . 0.191 . 0.252 . 0.188 . . . . . 0.178 . 20 . 0.957 0.942 'X-RAY DIFFRACTION' 2.843 3.035 840 . 48 790 99.7619 . 0.210 . 0.229 . 0.209 . . . . . 0.200 . 20 . 0.947 0.947 'X-RAY DIFFRACTION' 3.035 3.272 781 . 47 732 99.7439 . 0.210 . 0.211 . 0.209 . . . . . 0.209 . 20 . 0.954 0.955 'X-RAY DIFFRACTION' 3.272 3.574 722 . 31 690 99.8615 . 0.190 . 0.252 . 0.188 . . . . . 0.193 . 20 . 0.964 0.938 'X-RAY DIFFRACTION' 3.574 3.978 668 . 35 632 99.8503 . 0.186 . 0.186 . 0.186 . . . . . 0.197 . 20 . 0.965 0.966 'X-RAY DIFFRACTION' 3.978 4.562 606 . 31 575 100.0000 . 0.150 . 0.154 . 0.150 . . . . . 0.167 . 20 . 0.982 0.983 'X-RAY DIFFRACTION' 4.562 5.511 540 . 24 516 100.0000 . 0.171 . 0.221 . 0.169 . . . . . 0.190 . 20 . 0.978 0.961 'X-RAY DIFFRACTION' 5.511 7.495 435 . 20 415 100.0000 . 0.212 . 0.251 . 0.210 . . . . . 0.221 . 20 . 0.965 0.947 'X-RAY DIFFRACTION' 7.495 19.338 313 . 22 291 100.0000 . 0.208 . 0.237 . 0.206 . . . . . 0.235 . 20 . 0.969 0.963 # _struct.entry_id 6L6A _struct.title 'X-ray structure of human galectin-10 in complex with D-mannose' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6L6A _struct_keywords.text 'beta-sandwich structure, lectin, SUGAR BINDING PROTEIN' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS A 31 ? GLU A 35 ? CYS A 29 GLU A 33 5 ? 5 HELX_P HELX_P2 AA2 LYS A 119 ? VAL A 123 ? LYS A 117 VAL A 121 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 8 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 6 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 9 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 7 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.22 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 6 ? AA3 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 10 ? ALA A 13 ? TYR A 8 ALA A 11 AA1 2 MET A 125 ? ARG A 130 ? MET A 123 ARG A 128 AA1 3 TYR A 37 ? HIS A 43 ? TYR A 35 HIS A 41 AA1 4 ILE A 52 ? CYS A 59 ? ILE A 50 CYS A 57 AA1 5 ARG A 63 ? GLU A 70 ? ARG A 61 GLU A 68 AA1 6 ALA A 73 ? TRP A 74 ? ALA A 71 TRP A 72 AA2 1 TYR A 10 ? ALA A 13 ? TYR A 8 ALA A 11 AA2 2 MET A 125 ? ARG A 130 ? MET A 123 ARG A 128 AA2 3 TYR A 37 ? HIS A 43 ? TYR A 35 HIS A 41 AA2 4 ILE A 52 ? CYS A 59 ? ILE A 50 CYS A 57 AA2 5 ARG A 63 ? GLU A 70 ? ARG A 61 GLU A 68 AA2 6 VAL A 78 ? SER A 80 ? VAL A 76 SER A 78 AA3 1 GLN A 109 ? ASP A 115 ? GLN A 107 ASP A 113 AA3 2 LYS A 101 ? VAL A 106 ? LYS A 99 VAL A 104 AA3 3 PHE A 91 ? VAL A 97 ? PHE A 89 VAL A 95 AA3 4 THR A 21 ? PRO A 28 ? THR A 19 PRO A 26 AA3 5 ILE A 132 ? VAL A 139 ? ILE A 130 VAL A 137 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 10 ? N TYR A 8 O VAL A 128 ? O VAL A 126 AA1 2 3 O MET A 125 ? O MET A 123 N HIS A 43 ? N HIS A 41 AA1 3 4 N LEU A 38 ? N LEU A 36 O VAL A 58 ? O VAL A 56 AA1 4 5 N CYS A 59 ? N CYS A 57 O ARG A 63 ? O ARG A 61 AA1 5 6 N GLU A 70 ? N GLU A 68 O ALA A 73 ? O ALA A 71 AA2 1 2 N TYR A 10 ? N TYR A 8 O VAL A 128 ? O VAL A 126 AA2 2 3 O MET A 125 ? O MET A 123 N HIS A 43 ? N HIS A 41 AA2 3 4 N LEU A 38 ? N LEU A 36 O VAL A 58 ? O VAL A 56 AA2 4 5 N CYS A 59 ? N CYS A 57 O ARG A 63 ? O ARG A 61 AA2 5 6 N VAL A 64 ? N VAL A 62 O SER A 80 ? O SER A 78 AA3 1 2 O TYR A 112 ? O TYR A 110 N VAL A 104 ? N VAL A 102 AA3 2 3 O MET A 105 ? O MET A 103 N SER A 94 ? N SER A 92 AA3 3 4 O LEU A 93 ? O LEU A 91 N ILE A 24 ? N ILE A 22 AA3 4 5 N THR A 23 ? N THR A 21 O ASN A 138 ? O ASN A 136 # _atom_sites.entry_id 6L6A _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020479 _atom_sites.fract_transf_matrix[1][2] 0.011824 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023647 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003832 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.184 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 SER 2 0 ? ? ? A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 SER 4 2 2 SER SER A . n A 1 5 LEU 5 3 3 LEU LEU A . n A 1 6 LEU 6 4 4 LEU LEU A . n A 1 7 PRO 7 5 5 PRO PRO A . n A 1 8 VAL 8 6 6 VAL VAL A . n A 1 9 PRO 9 7 7 PRO PRO A . n A 1 10 TYR 10 8 8 TYR TYR A . n A 1 11 THR 11 9 9 THR THR A . n A 1 12 GLU 12 10 10 GLU GLU A . n A 1 13 ALA 13 11 11 ALA ALA A . n A 1 14 ALA 14 12 12 ALA ALA A . n A 1 15 SER 15 13 13 SER SER A . n A 1 16 LEU 16 14 14 LEU LEU A . n A 1 17 SER 17 15 15 SER SER A . n A 1 18 THR 18 16 16 THR THR A . n A 1 19 GLY 19 17 17 GLY GLY A . n A 1 20 SER 20 18 18 SER SER A . n A 1 21 THR 21 19 19 THR THR A . n A 1 22 VAL 22 20 20 VAL VAL A . n A 1 23 THR 23 21 21 THR THR A . n A 1 24 ILE 24 22 22 ILE ILE A . n A 1 25 LYS 25 23 23 LYS LYS A . n A 1 26 GLY 26 24 24 GLY GLY A . n A 1 27 ARG 27 25 25 ARG ARG A . n A 1 28 PRO 28 26 26 PRO PRO A . n A 1 29 LEU 29 27 27 LEU LEU A . n A 1 30 VAL 30 28 28 VAL VAL A . n A 1 31 CYS 31 29 29 CYS CYS A . n A 1 32 PHE 32 30 30 PHE PHE A . n A 1 33 LEU 33 31 31 LEU LEU A . n A 1 34 ASN 34 32 32 ASN ASN A . n A 1 35 GLU 35 33 33 GLU GLU A . n A 1 36 PRO 36 34 34 PRO PRO A . n A 1 37 TYR 37 35 35 TYR TYR A . n A 1 38 LEU 38 36 36 LEU LEU A . n A 1 39 GLN 39 37 37 GLN GLN A . n A 1 40 VAL 40 38 38 VAL VAL A . n A 1 41 ASP 41 39 39 ASP ASP A . n A 1 42 PHE 42 40 40 PHE PHE A . n A 1 43 HIS 43 41 41 HIS HIS A . n A 1 44 THR 44 42 42 THR THR A . n A 1 45 GLU 45 43 43 GLU GLU A . n A 1 46 MET 46 44 44 MET MET A . n A 1 47 LYS 47 45 45 LYS LYS A . n A 1 48 GLU 48 46 46 GLU GLU A . n A 1 49 GLU 49 47 47 GLU GLU A . n A 1 50 SER 50 48 48 SER SER A . n A 1 51 ASP 51 49 49 ASP ASP A . n A 1 52 ILE 52 50 50 ILE ILE A . n A 1 53 VAL 53 51 51 VAL VAL A . n A 1 54 PHE 54 52 52 PHE PHE A . n A 1 55 HIS 55 53 53 HIS HIS A . n A 1 56 PHE 56 54 54 PHE PHE A . n A 1 57 GLN 57 55 55 GLN GLN A . n A 1 58 VAL 58 56 56 VAL VAL A . n A 1 59 CYS 59 57 57 CYS CYS A . n A 1 60 PHE 60 58 58 PHE PHE A . n A 1 61 GLY 61 59 59 GLY GLY A . n A 1 62 ARG 62 60 60 ARG ARG A . n A 1 63 ARG 63 61 61 ARG ARG A . n A 1 64 VAL 64 62 62 VAL VAL A . n A 1 65 VAL 65 63 63 VAL VAL A . n A 1 66 MET 66 64 64 MET MET A . n A 1 67 ASN 67 65 65 ASN ASN A . n A 1 68 SER 68 66 66 SER SER A . n A 1 69 ARG 69 67 67 ARG ARG A . n A 1 70 GLU 70 68 68 GLU GLU A . n A 1 71 TYR 71 69 69 TYR TYR A . n A 1 72 GLY 72 70 70 GLY GLY A . n A 1 73 ALA 73 71 71 ALA ALA A . n A 1 74 TRP 74 72 72 TRP TRP A . n A 1 75 LYS 75 73 73 LYS LYS A . n A 1 76 GLN 76 74 74 GLN GLN A . n A 1 77 GLN 77 75 75 GLN GLN A . n A 1 78 VAL 78 76 76 VAL VAL A . n A 1 79 GLU 79 77 77 GLU GLU A . n A 1 80 SER 80 78 78 SER SER A . n A 1 81 LYS 81 79 79 LYS LYS A . n A 1 82 ASN 82 80 80 ASN ASN A . n A 1 83 MET 83 81 81 MET MET A . n A 1 84 PRO 84 82 82 PRO PRO A . n A 1 85 PHE 85 83 83 PHE PHE A . n A 1 86 GLN 86 84 84 GLN GLN A . n A 1 87 ASP 87 85 85 ASP ASP A . n A 1 88 GLY 88 86 86 GLY GLY A . n A 1 89 GLN 89 87 87 GLN GLN A . n A 1 90 GLU 90 88 88 GLU GLU A . n A 1 91 PHE 91 89 89 PHE PHE A . n A 1 92 GLU 92 90 90 GLU GLU A . n A 1 93 LEU 93 91 91 LEU LEU A . n A 1 94 SER 94 92 92 SER SER A . n A 1 95 ILE 95 93 93 ILE ILE A . n A 1 96 SER 96 94 94 SER SER A . n A 1 97 VAL 97 95 95 VAL VAL A . n A 1 98 LEU 98 96 96 LEU LEU A . n A 1 99 PRO 99 97 97 PRO PRO A . n A 1 100 ASP 100 98 98 ASP ASP A . n A 1 101 LYS 101 99 99 LYS LYS A . n A 1 102 TYR 102 100 100 TYR TYR A . n A 1 103 GLN 103 101 101 GLN GLN A . n A 1 104 VAL 104 102 102 VAL VAL A . n A 1 105 MET 105 103 103 MET MET A . n A 1 106 VAL 106 104 104 VAL VAL A . n A 1 107 ASN 107 105 105 ASN ASN A . n A 1 108 GLY 108 106 106 GLY GLY A . n A 1 109 GLN 109 107 107 GLN GLN A . n A 1 110 SER 110 108 108 SER SER A . n A 1 111 SER 111 109 109 SER SER A . n A 1 112 TYR 112 110 110 TYR TYR A . n A 1 113 THR 113 111 111 THR THR A . n A 1 114 PHE 114 112 112 PHE PHE A . n A 1 115 ASP 115 113 113 ASP ASP A . n A 1 116 HIS 116 114 114 HIS HIS A . n A 1 117 ARG 117 115 115 ARG ARG A . n A 1 118 ILE 118 116 116 ILE ILE A . n A 1 119 LYS 119 117 117 LYS LYS A . n A 1 120 PRO 120 118 118 PRO PRO A . n A 1 121 GLU 121 119 119 GLU GLU A . n A 1 122 ALA 122 120 120 ALA ALA A . n A 1 123 VAL 123 121 121 VAL VAL A . n A 1 124 LYS 124 122 122 LYS LYS A . n A 1 125 MET 125 123 123 MET MET A . n A 1 126 VAL 126 124 124 VAL VAL A . n A 1 127 GLN 127 125 125 GLN GLN A . n A 1 128 VAL 128 126 126 VAL VAL A . n A 1 129 TRP 129 127 127 TRP TRP A . n A 1 130 ARG 130 128 128 ARG ARG A . n A 1 131 ASP 131 129 129 ASP ASP A . n A 1 132 ILE 132 130 130 ILE ILE A . n A 1 133 SER 133 131 131 SER SER A . n A 1 134 LEU 134 132 132 LEU LEU A . n A 1 135 THR 135 133 133 THR THR A . n A 1 136 LYS 136 134 134 LYS LYS A . n A 1 137 PHE 137 135 135 PHE PHE A . n A 1 138 ASN 138 136 136 ASN ASN A . n A 1 139 VAL 139 137 137 VAL VAL A . n A 1 140 SER 140 138 138 SER SER A . n A 1 141 TYR 141 139 139 TYR TYR A . n A 1 142 LEU 142 140 140 LEU LEU A . n A 1 143 LYS 143 141 141 LYS LYS A . n A 1 144 ARG 144 142 142 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BMA 1 201 201 BMA BMA A . C 3 HOH 1 301 65 HOH HOH A . C 3 HOH 2 302 2 HOH HOH A . C 3 HOH 3 303 43 HOH HOH A . C 3 HOH 4 304 80 HOH HOH A . C 3 HOH 5 305 58 HOH HOH A . C 3 HOH 6 306 81 HOH HOH A . C 3 HOH 7 307 82 HOH HOH A . C 3 HOH 8 308 39 HOH HOH A . C 3 HOH 9 309 17 HOH HOH A . C 3 HOH 10 310 19 HOH HOH A . C 3 HOH 11 311 34 HOH HOH A . C 3 HOH 12 312 18 HOH HOH A . C 3 HOH 13 313 41 HOH HOH A . C 3 HOH 14 314 31 HOH HOH A . C 3 HOH 15 315 60 HOH HOH A . C 3 HOH 16 316 59 HOH HOH A . C 3 HOH 17 317 46 HOH HOH A . C 3 HOH 18 318 3 HOH HOH A . C 3 HOH 19 319 11 HOH HOH A . C 3 HOH 20 320 13 HOH HOH A . C 3 HOH 21 321 30 HOH HOH A . C 3 HOH 22 322 6 HOH HOH A . C 3 HOH 23 323 33 HOH HOH A . C 3 HOH 24 324 56 HOH HOH A . C 3 HOH 25 325 21 HOH HOH A . C 3 HOH 26 326 79 HOH HOH A . C 3 HOH 27 327 26 HOH HOH A . C 3 HOH 28 328 42 HOH HOH A . C 3 HOH 29 329 28 HOH HOH A . C 3 HOH 30 330 40 HOH HOH A . C 3 HOH 31 331 55 HOH HOH A . C 3 HOH 32 332 45 HOH HOH A . C 3 HOH 33 333 70 HOH HOH A . C 3 HOH 34 334 20 HOH HOH A . C 3 HOH 35 335 35 HOH HOH A . C 3 HOH 36 336 71 HOH HOH A . C 3 HOH 37 337 38 HOH HOH A . C 3 HOH 38 338 48 HOH HOH A . C 3 HOH 39 339 83 HOH HOH A . C 3 HOH 40 340 53 HOH HOH A . C 3 HOH 41 341 7 HOH HOH A . C 3 HOH 42 342 69 HOH HOH A . C 3 HOH 43 343 9 HOH HOH A . C 3 HOH 44 344 24 HOH HOH A . C 3 HOH 45 345 36 HOH HOH A . C 3 HOH 46 346 64 HOH HOH A . C 3 HOH 47 347 29 HOH HOH A . C 3 HOH 48 348 5 HOH HOH A . C 3 HOH 49 349 32 HOH HOH A . C 3 HOH 50 350 72 HOH HOH A . C 3 HOH 51 351 12 HOH HOH A . C 3 HOH 52 352 84 HOH HOH A . C 3 HOH 53 353 22 HOH HOH A . C 3 HOH 54 354 25 HOH HOH A . C 3 HOH 55 355 10 HOH HOH A . C 3 HOH 56 356 54 HOH HOH A . C 3 HOH 57 357 4 HOH HOH A . C 3 HOH 58 358 14 HOH HOH A . C 3 HOH 59 359 44 HOH HOH A . C 3 HOH 60 360 15 HOH HOH A . C 3 HOH 61 361 47 HOH HOH A . C 3 HOH 62 362 73 HOH HOH A . C 3 HOH 63 363 16 HOH HOH A . C 3 HOH 64 364 75 HOH HOH A . C 3 HOH 65 365 67 HOH HOH A . C 3 HOH 66 366 57 HOH HOH A . C 3 HOH 67 367 1 HOH HOH A . C 3 HOH 68 368 77 HOH HOH A . C 3 HOH 69 369 74 HOH HOH A . C 3 HOH 70 370 68 HOH HOH A . C 3 HOH 71 371 76 HOH HOH A . C 3 HOH 72 372 8 HOH HOH A . C 3 HOH 73 373 52 HOH HOH A . C 3 HOH 74 374 51 HOH HOH A . C 3 HOH 75 375 63 HOH HOH A . C 3 HOH 76 376 37 HOH HOH A . C 3 HOH 77 377 66 HOH HOH A . C 3 HOH 78 378 50 HOH HOH A . C 3 HOH 79 379 78 HOH HOH A . C 3 HOH 80 380 62 HOH HOH A . C 3 HOH 81 381 23 HOH HOH A . C 3 HOH 82 382 49 HOH HOH A . C 3 HOH 83 383 61 HOH HOH A . C 3 HOH 84 384 27 HOH HOH A . C 3 HOH 85 385 85 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 1 2 A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 11_555 -x+y,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 130.4700000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 356 ? C HOH . 2 1 A HOH 367 ? C HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-03-04 2 'Structure model' 1 1 2020-07-29 3 'Structure model' 1 2 2023-11-22 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' 'Structure summary' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Derived calculations' 7 3 'Structure model' 'Refinement description' 8 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp 2 2 'Structure model' entity 3 2 'Structure model' pdbx_chem_comp_identifier 4 2 'Structure model' pdbx_entity_nonpoly 5 3 'Structure model' atom_type 6 3 'Structure model' chem_comp 7 3 'Structure model' chem_comp_atom 8 3 'Structure model' chem_comp_bond 9 3 'Structure model' database_2 10 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_chem_comp.name' 2 2 'Structure model' '_entity.pdbx_description' 3 2 'Structure model' '_pdbx_entity_nonpoly.name' 4 3 'Structure model' '_atom_type.pdbx_N_electrons' 5 3 'Structure model' '_atom_type.pdbx_scat_Z' 6 3 'Structure model' '_chem_comp.pdbx_synonyms' 7 3 'Structure model' '_database_2.pdbx_DOI' 8 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0253 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_entry_details.entry_id 6L6A _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 60 ? ? -126.09 -68.67 2 1 LYS A 73 ? ? -99.04 -146.80 3 1 SER A 109 ? ? -130.33 -34.13 4 1 ARG A 128 ? ? 84.27 -148.27 5 1 ASP A 129 ? ? -94.02 57.94 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A SER 0 ? A SER 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BMA C1 C N R 74 BMA C2 C N S 75 BMA C3 C N S 76 BMA C4 C N S 77 BMA C5 C N R 78 BMA C6 C N N 79 BMA O1 O N N 80 BMA O2 O N N 81 BMA O3 O N N 82 BMA O4 O N N 83 BMA O5 O N N 84 BMA O6 O N N 85 BMA H1 H N N 86 BMA H2 H N N 87 BMA H3 H N N 88 BMA H4 H N N 89 BMA H5 H N N 90 BMA H61 H N N 91 BMA H62 H N N 92 BMA HO1 H N N 93 BMA HO2 H N N 94 BMA HO3 H N N 95 BMA HO4 H N N 96 BMA HO6 H N N 97 CYS N N N N 98 CYS CA C N R 99 CYS C C N N 100 CYS O O N N 101 CYS CB C N N 102 CYS SG S N N 103 CYS OXT O N N 104 CYS H H N N 105 CYS H2 H N N 106 CYS HA H N N 107 CYS HB2 H N N 108 CYS HB3 H N N 109 CYS HG H N N 110 CYS HXT H N N 111 GLN N N N N 112 GLN CA C N S 113 GLN C C N N 114 GLN O O N N 115 GLN CB C N N 116 GLN CG C N N 117 GLN CD C N N 118 GLN OE1 O N N 119 GLN NE2 N N N 120 GLN OXT O N N 121 GLN H H N N 122 GLN H2 H N N 123 GLN HA H N N 124 GLN HB2 H N N 125 GLN HB3 H N N 126 GLN HG2 H N N 127 GLN HG3 H N N 128 GLN HE21 H N N 129 GLN HE22 H N N 130 GLN HXT H N N 131 GLU N N N N 132 GLU CA C N S 133 GLU C C N N 134 GLU O O N N 135 GLU CB C N N 136 GLU CG C N N 137 GLU CD C N N 138 GLU OE1 O N N 139 GLU OE2 O N N 140 GLU OXT O N N 141 GLU H H N N 142 GLU H2 H N N 143 GLU HA H N N 144 GLU HB2 H N N 145 GLU HB3 H N N 146 GLU HG2 H N N 147 GLU HG3 H N N 148 GLU HE2 H N N 149 GLU HXT H N N 150 GLY N N N N 151 GLY CA C N N 152 GLY C C N N 153 GLY O O N N 154 GLY OXT O N N 155 GLY H H N N 156 GLY H2 H N N 157 GLY HA2 H N N 158 GLY HA3 H N N 159 GLY HXT H N N 160 HIS N N N N 161 HIS CA C N S 162 HIS C C N N 163 HIS O O N N 164 HIS CB C N N 165 HIS CG C Y N 166 HIS ND1 N Y N 167 HIS CD2 C Y N 168 HIS CE1 C Y N 169 HIS NE2 N Y N 170 HIS OXT O N N 171 HIS H H N N 172 HIS H2 H N N 173 HIS HA H N N 174 HIS HB2 H N N 175 HIS HB3 H N N 176 HIS HD1 H N N 177 HIS HD2 H N N 178 HIS HE1 H N N 179 HIS HE2 H N N 180 HIS HXT H N N 181 HOH O O N N 182 HOH H1 H N N 183 HOH H2 H N N 184 ILE N N N N 185 ILE CA C N S 186 ILE C C N N 187 ILE O O N N 188 ILE CB C N S 189 ILE CG1 C N N 190 ILE CG2 C N N 191 ILE CD1 C N N 192 ILE OXT O N N 193 ILE H H N N 194 ILE H2 H N N 195 ILE HA H N N 196 ILE HB H N N 197 ILE HG12 H N N 198 ILE HG13 H N N 199 ILE HG21 H N N 200 ILE HG22 H N N 201 ILE HG23 H N N 202 ILE HD11 H N N 203 ILE HD12 H N N 204 ILE HD13 H N N 205 ILE HXT H N N 206 LEU N N N N 207 LEU CA C N S 208 LEU C C N N 209 LEU O O N N 210 LEU CB C N N 211 LEU CG C N N 212 LEU CD1 C N N 213 LEU CD2 C N N 214 LEU OXT O N N 215 LEU H H N N 216 LEU H2 H N N 217 LEU HA H N N 218 LEU HB2 H N N 219 LEU HB3 H N N 220 LEU HG H N N 221 LEU HD11 H N N 222 LEU HD12 H N N 223 LEU HD13 H N N 224 LEU HD21 H N N 225 LEU HD22 H N N 226 LEU HD23 H N N 227 LEU HXT H N N 228 LYS N N N N 229 LYS CA C N S 230 LYS C C N N 231 LYS O O N N 232 LYS CB C N N 233 LYS CG C N N 234 LYS CD C N N 235 LYS CE C N N 236 LYS NZ N N N 237 LYS OXT O N N 238 LYS H H N N 239 LYS H2 H N N 240 LYS HA H N N 241 LYS HB2 H N N 242 LYS HB3 H N N 243 LYS HG2 H N N 244 LYS HG3 H N N 245 LYS HD2 H N N 246 LYS HD3 H N N 247 LYS HE2 H N N 248 LYS HE3 H N N 249 LYS HZ1 H N N 250 LYS HZ2 H N N 251 LYS HZ3 H N N 252 LYS HXT H N N 253 MET N N N N 254 MET CA C N S 255 MET C C N N 256 MET O O N N 257 MET CB C N N 258 MET CG C N N 259 MET SD S N N 260 MET CE C N N 261 MET OXT O N N 262 MET H H N N 263 MET H2 H N N 264 MET HA H N N 265 MET HB2 H N N 266 MET HB3 H N N 267 MET HG2 H N N 268 MET HG3 H N N 269 MET HE1 H N N 270 MET HE2 H N N 271 MET HE3 H N N 272 MET HXT H N N 273 PHE N N N N 274 PHE CA C N S 275 PHE C C N N 276 PHE O O N N 277 PHE CB C N N 278 PHE CG C Y N 279 PHE CD1 C Y N 280 PHE CD2 C Y N 281 PHE CE1 C Y N 282 PHE CE2 C Y N 283 PHE CZ C Y N 284 PHE OXT O N N 285 PHE H H N N 286 PHE H2 H N N 287 PHE HA H N N 288 PHE HB2 H N N 289 PHE HB3 H N N 290 PHE HD1 H N N 291 PHE HD2 H N N 292 PHE HE1 H N N 293 PHE HE2 H N N 294 PHE HZ H N N 295 PHE HXT H N N 296 PRO N N N N 297 PRO CA C N S 298 PRO C C N N 299 PRO O O N N 300 PRO CB C N N 301 PRO CG C N N 302 PRO CD C N N 303 PRO OXT O N N 304 PRO H H N N 305 PRO HA H N N 306 PRO HB2 H N N 307 PRO HB3 H N N 308 PRO HG2 H N N 309 PRO HG3 H N N 310 PRO HD2 H N N 311 PRO HD3 H N N 312 PRO HXT H N N 313 SER N N N N 314 SER CA C N S 315 SER C C N N 316 SER O O N N 317 SER CB C N N 318 SER OG O N N 319 SER OXT O N N 320 SER H H N N 321 SER H2 H N N 322 SER HA H N N 323 SER HB2 H N N 324 SER HB3 H N N 325 SER HG H N N 326 SER HXT H N N 327 THR N N N N 328 THR CA C N S 329 THR C C N N 330 THR O O N N 331 THR CB C N R 332 THR OG1 O N N 333 THR CG2 C N N 334 THR OXT O N N 335 THR H H N N 336 THR H2 H N N 337 THR HA H N N 338 THR HB H N N 339 THR HG1 H N N 340 THR HG21 H N N 341 THR HG22 H N N 342 THR HG23 H N N 343 THR HXT H N N 344 TRP N N N N 345 TRP CA C N S 346 TRP C C N N 347 TRP O O N N 348 TRP CB C N N 349 TRP CG C Y N 350 TRP CD1 C Y N 351 TRP CD2 C Y N 352 TRP NE1 N Y N 353 TRP CE2 C Y N 354 TRP CE3 C Y N 355 TRP CZ2 C Y N 356 TRP CZ3 C Y N 357 TRP CH2 C Y N 358 TRP OXT O N N 359 TRP H H N N 360 TRP H2 H N N 361 TRP HA H N N 362 TRP HB2 H N N 363 TRP HB3 H N N 364 TRP HD1 H N N 365 TRP HE1 H N N 366 TRP HE3 H N N 367 TRP HZ2 H N N 368 TRP HZ3 H N N 369 TRP HH2 H N N 370 TRP HXT H N N 371 TYR N N N N 372 TYR CA C N S 373 TYR C C N N 374 TYR O O N N 375 TYR CB C N N 376 TYR CG C Y N 377 TYR CD1 C Y N 378 TYR CD2 C Y N 379 TYR CE1 C Y N 380 TYR CE2 C Y N 381 TYR CZ C Y N 382 TYR OH O N N 383 TYR OXT O N N 384 TYR H H N N 385 TYR H2 H N N 386 TYR HA H N N 387 TYR HB2 H N N 388 TYR HB3 H N N 389 TYR HD1 H N N 390 TYR HD2 H N N 391 TYR HE1 H N N 392 TYR HE2 H N N 393 TYR HH H N N 394 TYR HXT H N N 395 VAL N N N N 396 VAL CA C N S 397 VAL C C N N 398 VAL O O N N 399 VAL CB C N N 400 VAL CG1 C N N 401 VAL CG2 C N N 402 VAL OXT O N N 403 VAL H H N N 404 VAL H2 H N N 405 VAL HA H N N 406 VAL HB H N N 407 VAL HG11 H N N 408 VAL HG12 H N N 409 VAL HG13 H N N 410 VAL HG21 H N N 411 VAL HG22 H N N 412 VAL HG23 H N N 413 VAL HXT H N N 414 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BMA C1 C2 sing N N 70 BMA C1 O1 sing N N 71 BMA C1 O5 sing N N 72 BMA C1 H1 sing N N 73 BMA C2 C3 sing N N 74 BMA C2 O2 sing N N 75 BMA C2 H2 sing N N 76 BMA C3 C4 sing N N 77 BMA C3 O3 sing N N 78 BMA C3 H3 sing N N 79 BMA C4 C5 sing N N 80 BMA C4 O4 sing N N 81 BMA C4 H4 sing N N 82 BMA C5 C6 sing N N 83 BMA C5 O5 sing N N 84 BMA C5 H5 sing N N 85 BMA C6 O6 sing N N 86 BMA C6 H61 sing N N 87 BMA C6 H62 sing N N 88 BMA O1 HO1 sing N N 89 BMA O2 HO2 sing N N 90 BMA O3 HO3 sing N N 91 BMA O4 HO4 sing N N 92 BMA O6 HO6 sing N N 93 CYS N CA sing N N 94 CYS N H sing N N 95 CYS N H2 sing N N 96 CYS CA C sing N N 97 CYS CA CB sing N N 98 CYS CA HA sing N N 99 CYS C O doub N N 100 CYS C OXT sing N N 101 CYS CB SG sing N N 102 CYS CB HB2 sing N N 103 CYS CB HB3 sing N N 104 CYS SG HG sing N N 105 CYS OXT HXT sing N N 106 GLN N CA sing N N 107 GLN N H sing N N 108 GLN N H2 sing N N 109 GLN CA C sing N N 110 GLN CA CB sing N N 111 GLN CA HA sing N N 112 GLN C O doub N N 113 GLN C OXT sing N N 114 GLN CB CG sing N N 115 GLN CB HB2 sing N N 116 GLN CB HB3 sing N N 117 GLN CG CD sing N N 118 GLN CG HG2 sing N N 119 GLN CG HG3 sing N N 120 GLN CD OE1 doub N N 121 GLN CD NE2 sing N N 122 GLN NE2 HE21 sing N N 123 GLN NE2 HE22 sing N N 124 GLN OXT HXT sing N N 125 GLU N CA sing N N 126 GLU N H sing N N 127 GLU N H2 sing N N 128 GLU CA C sing N N 129 GLU CA CB sing N N 130 GLU CA HA sing N N 131 GLU C O doub N N 132 GLU C OXT sing N N 133 GLU CB CG sing N N 134 GLU CB HB2 sing N N 135 GLU CB HB3 sing N N 136 GLU CG CD sing N N 137 GLU CG HG2 sing N N 138 GLU CG HG3 sing N N 139 GLU CD OE1 doub N N 140 GLU CD OE2 sing N N 141 GLU OE2 HE2 sing N N 142 GLU OXT HXT sing N N 143 GLY N CA sing N N 144 GLY N H sing N N 145 GLY N H2 sing N N 146 GLY CA C sing N N 147 GLY CA HA2 sing N N 148 GLY CA HA3 sing N N 149 GLY C O doub N N 150 GLY C OXT sing N N 151 GLY OXT HXT sing N N 152 HIS N CA sing N N 153 HIS N H sing N N 154 HIS N H2 sing N N 155 HIS CA C sing N N 156 HIS CA CB sing N N 157 HIS CA HA sing N N 158 HIS C O doub N N 159 HIS C OXT sing N N 160 HIS CB CG sing N N 161 HIS CB HB2 sing N N 162 HIS CB HB3 sing N N 163 HIS CG ND1 sing Y N 164 HIS CG CD2 doub Y N 165 HIS ND1 CE1 doub Y N 166 HIS ND1 HD1 sing N N 167 HIS CD2 NE2 sing Y N 168 HIS CD2 HD2 sing N N 169 HIS CE1 NE2 sing Y N 170 HIS CE1 HE1 sing N N 171 HIS NE2 HE2 sing N N 172 HIS OXT HXT sing N N 173 HOH O H1 sing N N 174 HOH O H2 sing N N 175 ILE N CA sing N N 176 ILE N H sing N N 177 ILE N H2 sing N N 178 ILE CA C sing N N 179 ILE CA CB sing N N 180 ILE CA HA sing N N 181 ILE C O doub N N 182 ILE C OXT sing N N 183 ILE CB CG1 sing N N 184 ILE CB CG2 sing N N 185 ILE CB HB sing N N 186 ILE CG1 CD1 sing N N 187 ILE CG1 HG12 sing N N 188 ILE CG1 HG13 sing N N 189 ILE CG2 HG21 sing N N 190 ILE CG2 HG22 sing N N 191 ILE CG2 HG23 sing N N 192 ILE CD1 HD11 sing N N 193 ILE CD1 HD12 sing N N 194 ILE CD1 HD13 sing N N 195 ILE OXT HXT sing N N 196 LEU N CA sing N N 197 LEU N H sing N N 198 LEU N H2 sing N N 199 LEU CA C sing N N 200 LEU CA CB sing N N 201 LEU CA HA sing N N 202 LEU C O doub N N 203 LEU C OXT sing N N 204 LEU CB CG sing N N 205 LEU CB HB2 sing N N 206 LEU CB HB3 sing N N 207 LEU CG CD1 sing N N 208 LEU CG CD2 sing N N 209 LEU CG HG sing N N 210 LEU CD1 HD11 sing N N 211 LEU CD1 HD12 sing N N 212 LEU CD1 HD13 sing N N 213 LEU CD2 HD21 sing N N 214 LEU CD2 HD22 sing N N 215 LEU CD2 HD23 sing N N 216 LEU OXT HXT sing N N 217 LYS N CA sing N N 218 LYS N H sing N N 219 LYS N H2 sing N N 220 LYS CA C sing N N 221 LYS CA CB sing N N 222 LYS CA HA sing N N 223 LYS C O doub N N 224 LYS C OXT sing N N 225 LYS CB CG sing N N 226 LYS CB HB2 sing N N 227 LYS CB HB3 sing N N 228 LYS CG CD sing N N 229 LYS CG HG2 sing N N 230 LYS CG HG3 sing N N 231 LYS CD CE sing N N 232 LYS CD HD2 sing N N 233 LYS CD HD3 sing N N 234 LYS CE NZ sing N N 235 LYS CE HE2 sing N N 236 LYS CE HE3 sing N N 237 LYS NZ HZ1 sing N N 238 LYS NZ HZ2 sing N N 239 LYS NZ HZ3 sing N N 240 LYS OXT HXT sing N N 241 MET N CA sing N N 242 MET N H sing N N 243 MET N H2 sing N N 244 MET CA C sing N N 245 MET CA CB sing N N 246 MET CA HA sing N N 247 MET C O doub N N 248 MET C OXT sing N N 249 MET CB CG sing N N 250 MET CB HB2 sing N N 251 MET CB HB3 sing N N 252 MET CG SD sing N N 253 MET CG HG2 sing N N 254 MET CG HG3 sing N N 255 MET SD CE sing N N 256 MET CE HE1 sing N N 257 MET CE HE2 sing N N 258 MET CE HE3 sing N N 259 MET OXT HXT sing N N 260 PHE N CA sing N N 261 PHE N H sing N N 262 PHE N H2 sing N N 263 PHE CA C sing N N 264 PHE CA CB sing N N 265 PHE CA HA sing N N 266 PHE C O doub N N 267 PHE C OXT sing N N 268 PHE CB CG sing N N 269 PHE CB HB2 sing N N 270 PHE CB HB3 sing N N 271 PHE CG CD1 doub Y N 272 PHE CG CD2 sing Y N 273 PHE CD1 CE1 sing Y N 274 PHE CD1 HD1 sing N N 275 PHE CD2 CE2 doub Y N 276 PHE CD2 HD2 sing N N 277 PHE CE1 CZ doub Y N 278 PHE CE1 HE1 sing N N 279 PHE CE2 CZ sing Y N 280 PHE CE2 HE2 sing N N 281 PHE CZ HZ sing N N 282 PHE OXT HXT sing N N 283 PRO N CA sing N N 284 PRO N CD sing N N 285 PRO N H sing N N 286 PRO CA C sing N N 287 PRO CA CB sing N N 288 PRO CA HA sing N N 289 PRO C O doub N N 290 PRO C OXT sing N N 291 PRO CB CG sing N N 292 PRO CB HB2 sing N N 293 PRO CB HB3 sing N N 294 PRO CG CD sing N N 295 PRO CG HG2 sing N N 296 PRO CG HG3 sing N N 297 PRO CD HD2 sing N N 298 PRO CD HD3 sing N N 299 PRO OXT HXT sing N N 300 SER N CA sing N N 301 SER N H sing N N 302 SER N H2 sing N N 303 SER CA C sing N N 304 SER CA CB sing N N 305 SER CA HA sing N N 306 SER C O doub N N 307 SER C OXT sing N N 308 SER CB OG sing N N 309 SER CB HB2 sing N N 310 SER CB HB3 sing N N 311 SER OG HG sing N N 312 SER OXT HXT sing N N 313 THR N CA sing N N 314 THR N H sing N N 315 THR N H2 sing N N 316 THR CA C sing N N 317 THR CA CB sing N N 318 THR CA HA sing N N 319 THR C O doub N N 320 THR C OXT sing N N 321 THR CB OG1 sing N N 322 THR CB CG2 sing N N 323 THR CB HB sing N N 324 THR OG1 HG1 sing N N 325 THR CG2 HG21 sing N N 326 THR CG2 HG22 sing N N 327 THR CG2 HG23 sing N N 328 THR OXT HXT sing N N 329 TRP N CA sing N N 330 TRP N H sing N N 331 TRP N H2 sing N N 332 TRP CA C sing N N 333 TRP CA CB sing N N 334 TRP CA HA sing N N 335 TRP C O doub N N 336 TRP C OXT sing N N 337 TRP CB CG sing N N 338 TRP CB HB2 sing N N 339 TRP CB HB3 sing N N 340 TRP CG CD1 doub Y N 341 TRP CG CD2 sing Y N 342 TRP CD1 NE1 sing Y N 343 TRP CD1 HD1 sing N N 344 TRP CD2 CE2 doub Y N 345 TRP CD2 CE3 sing Y N 346 TRP NE1 CE2 sing Y N 347 TRP NE1 HE1 sing N N 348 TRP CE2 CZ2 sing Y N 349 TRP CE3 CZ3 doub Y N 350 TRP CE3 HE3 sing N N 351 TRP CZ2 CH2 doub Y N 352 TRP CZ2 HZ2 sing N N 353 TRP CZ3 CH2 sing Y N 354 TRP CZ3 HZ3 sing N N 355 TRP CH2 HH2 sing N N 356 TRP OXT HXT sing N N 357 TYR N CA sing N N 358 TYR N H sing N N 359 TYR N H2 sing N N 360 TYR CA C sing N N 361 TYR CA CB sing N N 362 TYR CA HA sing N N 363 TYR C O doub N N 364 TYR C OXT sing N N 365 TYR CB CG sing N N 366 TYR CB HB2 sing N N 367 TYR CB HB3 sing N N 368 TYR CG CD1 doub Y N 369 TYR CG CD2 sing Y N 370 TYR CD1 CE1 sing Y N 371 TYR CD1 HD1 sing N N 372 TYR CD2 CE2 doub Y N 373 TYR CD2 HD2 sing N N 374 TYR CE1 CZ doub Y N 375 TYR CE1 HE1 sing N N 376 TYR CE2 CZ sing Y N 377 TYR CE2 HE2 sing N N 378 TYR CZ OH sing N N 379 TYR OH HH sing N N 380 TYR OXT HXT sing N N 381 VAL N CA sing N N 382 VAL N H sing N N 383 VAL N H2 sing N N 384 VAL CA C sing N N 385 VAL CA CB sing N N 386 VAL CA HA sing N N 387 VAL C O doub N N 388 VAL C OXT sing N N 389 VAL CB CG1 sing N N 390 VAL CB CG2 sing N N 391 VAL CB HB sing N N 392 VAL CG1 HG11 sing N N 393 VAL CG1 HG12 sing N N 394 VAL CG1 HG13 sing N N 395 VAL CG2 HG21 sing N N 396 VAL CG2 HG22 sing N N 397 VAL CG2 HG23 sing N N 398 VAL OXT HXT sing N N 399 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpb BMA 'COMMON NAME' GMML 1.0 b-D-mannopyranose BMA 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Manp BMA 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id BMA _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id BMA _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 beta-D-mannopyranose BMA 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1QKQ _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? #