data_6LLQ # _entry.id 6LLQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6LLQ pdb_00006llq 10.2210/pdb6llq/pdb WWPDB D_1300014751 ? ? BMRB 36305 ? 10.13018/BMR36305 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-12-02 2 'Structure model' 1 1 2020-12-23 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6LLQ _pdbx_database_status.recvd_initial_deposition_date 2019-12-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution NMR structure of de novo Rossmann2x2 fold without tight packing, R2x2_VAL88' _pdbx_database_related.db_id 36305 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kobayashi, N.' 1 0000-0001-5136-2077 'Sugiki, T.' 2 ? 'Fujiwara, T.' 3 ? 'Koga, R.' 4 0000-0002-5068-1049 'Yamamoto, M.' 5 ? 'Kosugi, T.' 6 ? 'Koga, N.' 7 0000-0001-8457-0809 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 117 _citation.language ? _citation.page_first 31149 _citation.page_last 31156 _citation.title 'Robust folding of a de novo designed ideal protein even with most of the core mutated to valine.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2002120117 _citation.pdbx_database_id_PubMed 33229587 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Koga, R.' 1 ? primary 'Yamamoto, M.' 2 ? primary 'Kosugi, T.' 3 ? primary 'Kobayashi, N.' 4 ? primary 'Sugiki, T.' 5 ? primary 'Fujiwara, T.' 6 ? primary 'Koga, N.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description VAL88 _entity.formula_weight 11105.688 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GRVVVVVTSEQVKEEVRKKFPQVEVRVVTTEEDAKQVVKEVQKKGVQKVVVVGVSEKVVQKVKQEANVQVYRVTSNDEVE QVVKDVKGSGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;GRVVVVVTSEQVKEEVRKKFPQVEVRVVTTEEDAKQVVKEVQKKGVQKVVVVGVSEKVVQKVKQEANVQVYRVTSNDEVE QVVKDVKGSGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ARG n 1 3 VAL n 1 4 VAL n 1 5 VAL n 1 6 VAL n 1 7 VAL n 1 8 THR n 1 9 SER n 1 10 GLU n 1 11 GLN n 1 12 VAL n 1 13 LYS n 1 14 GLU n 1 15 GLU n 1 16 VAL n 1 17 ARG n 1 18 LYS n 1 19 LYS n 1 20 PHE n 1 21 PRO n 1 22 GLN n 1 23 VAL n 1 24 GLU n 1 25 VAL n 1 26 ARG n 1 27 VAL n 1 28 VAL n 1 29 THR n 1 30 THR n 1 31 GLU n 1 32 GLU n 1 33 ASP n 1 34 ALA n 1 35 LYS n 1 36 GLN n 1 37 VAL n 1 38 VAL n 1 39 LYS n 1 40 GLU n 1 41 VAL n 1 42 GLN n 1 43 LYS n 1 44 LYS n 1 45 GLY n 1 46 VAL n 1 47 GLN n 1 48 LYS n 1 49 VAL n 1 50 VAL n 1 51 VAL n 1 52 VAL n 1 53 GLY n 1 54 VAL n 1 55 SER n 1 56 GLU n 1 57 LYS n 1 58 VAL n 1 59 VAL n 1 60 GLN n 1 61 LYS n 1 62 VAL n 1 63 LYS n 1 64 GLN n 1 65 GLU n 1 66 ALA n 1 67 ASN n 1 68 VAL n 1 69 GLN n 1 70 VAL n 1 71 TYR n 1 72 ARG n 1 73 VAL n 1 74 THR n 1 75 SER n 1 76 ASN n 1 77 ASP n 1 78 GLU n 1 79 VAL n 1 80 GLU n 1 81 GLN n 1 82 VAL n 1 83 VAL n 1 84 LYS n 1 85 ASP n 1 86 VAL n 1 87 LYS n 1 88 GLY n 1 89 SER n 1 90 GLY n 1 91 LEU n 1 92 GLU n 1 93 HIS n 1 94 HIS n 1 95 HIS n 1 96 HIS n 1 97 HIS n 1 98 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 98 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name unidentified _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32644 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 HIS 98 98 98 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6LLQ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6LLQ _struct.title 'Solution NMR structure of de novo Rossmann2x2 fold with most of the core mutated to valine, R2x2_VAL88' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6LLQ _struct_keywords.text 'De Novo design, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6LLQ _struct_ref.pdbx_db_accession 6LLQ _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6LLQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 98 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6LLQ _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 98 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 98 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7700 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 9 ? PHE A 20 ? SER A 9 PHE A 20 1 ? 12 HELX_P HELX_P2 AA2 THR A 30 ? GLY A 45 ? THR A 30 GLY A 45 1 ? 16 HELX_P HELX_P3 AA3 SER A 55 ? ASN A 67 ? SER A 55 ASN A 67 1 ? 13 HELX_P HELX_P4 AA4 SER A 75 ? VAL A 86 ? SER A 75 VAL A 86 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 24 ? VAL A 27 ? GLU A 24 VAL A 27 AA1 2 VAL A 4 ? VAL A 7 ? VAL A 4 VAL A 7 AA1 3 LYS A 48 ? VAL A 52 ? LYS A 48 VAL A 52 AA1 4 GLN A 69 ? VAL A 73 ? GLN A 69 VAL A 73 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ARG A 26 ? O ARG A 26 N VAL A 5 ? N VAL A 5 AA1 2 3 N VAL A 4 ? N VAL A 4 O VAL A 50 ? O VAL A 50 AA1 3 4 N VAL A 49 ? N VAL A 49 O TYR A 71 ? O TYR A 71 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 47 ? ? -130.18 -39.48 2 1 VAL A 86 ? ? 71.31 -70.33 3 1 HIS A 96 ? ? -171.49 102.91 4 2 VAL A 86 ? ? 37.84 41.73 5 2 LYS A 87 ? ? 179.00 161.89 6 2 SER A 89 ? ? 63.22 70.23 7 2 LEU A 91 ? ? -56.58 178.13 8 2 HIS A 93 ? ? -154.40 76.98 9 2 HIS A 94 ? ? -109.58 55.50 10 2 HIS A 96 ? ? 63.08 90.91 11 2 HIS A 97 ? ? -58.94 -70.43 12 3 VAL A 86 ? ? 72.49 -69.34 13 4 VAL A 86 ? ? 71.54 -70.17 14 4 HIS A 95 ? ? -141.16 41.29 15 4 HIS A 97 ? ? -172.72 104.85 16 5 GLN A 47 ? ? -134.04 -41.20 17 5 LYS A 87 ? ? -179.39 -169.30 18 5 HIS A 94 ? ? -154.61 37.70 19 6 VAL A 86 ? ? 72.46 -69.37 20 6 SER A 89 ? ? -101.77 64.91 21 6 HIS A 95 ? ? -59.97 101.32 22 7 GLN A 47 ? ? -131.93 -39.15 23 7 VAL A 86 ? ? 71.32 -70.42 24 7 GLU A 92 ? ? -65.90 93.40 25 8 ARG A 72 ? ? -43.09 154.82 26 8 VAL A 86 ? ? 71.57 -70.43 27 8 SER A 89 ? ? -173.09 100.25 28 8 LEU A 91 ? ? 60.51 98.02 29 8 HIS A 95 ? ? -100.63 56.04 30 8 HIS A 97 ? ? -163.16 53.07 31 9 LYS A 87 ? ? -179.87 -35.32 32 9 HIS A 95 ? ? -135.55 -61.15 33 9 HIS A 96 ? ? 56.33 -175.56 34 10 VAL A 86 ? ? 71.57 -70.31 35 10 HIS A 93 ? ? 56.90 76.61 36 10 HIS A 94 ? ? -163.54 113.75 37 10 HIS A 95 ? ? -179.23 132.22 38 11 VAL A 86 ? ? 71.02 -70.38 39 11 LEU A 91 ? ? 61.09 75.73 40 11 HIS A 96 ? ? -174.37 -50.94 41 11 HIS A 97 ? ? 62.78 -175.76 42 12 GLN A 47 ? ? -131.25 -38.10 43 12 VAL A 86 ? ? 37.06 43.98 44 12 LYS A 87 ? ? -173.47 144.38 45 12 HIS A 94 ? ? -110.89 56.49 46 13 ASN A 67 ? ? 70.83 51.45 47 13 TYR A 71 ? ? -118.78 55.60 48 13 ARG A 72 ? ? -48.95 160.93 49 13 VAL A 86 ? ? 71.40 -70.51 50 13 HIS A 95 ? ? -57.05 178.65 51 14 GLN A 47 ? ? -130.23 -37.61 52 14 VAL A 86 ? ? 35.96 82.89 53 14 LYS A 87 ? ? 63.38 95.74 54 14 LEU A 91 ? ? 63.28 95.50 55 14 HIS A 93 ? ? -59.85 108.15 56 14 HIS A 96 ? ? -171.97 -62.48 57 14 HIS A 97 ? ? -162.92 -52.64 58 15 VAL A 86 ? ? 71.49 -70.41 59 15 HIS A 93 ? ? 59.75 -179.46 60 15 HIS A 95 ? ? -162.98 -43.08 61 16 LYS A 87 ? ? 179.95 -39.67 62 16 GLU A 92 ? ? -166.30 -44.55 63 16 HIS A 97 ? ? -172.41 -44.34 64 17 VAL A 86 ? ? 71.37 -70.57 65 18 VAL A 86 ? ? 66.24 62.15 66 18 LYS A 87 ? ? -179.32 -59.36 67 18 HIS A 96 ? ? 58.17 -172.87 68 19 GLN A 47 ? ? -130.49 -38.93 69 19 VAL A 86 ? ? 35.88 78.54 70 19 LYS A 87 ? ? 179.93 162.67 71 19 HIS A 93 ? ? -68.67 -172.71 72 19 HIS A 95 ? ? 57.91 -176.01 73 19 HIS A 96 ? ? 56.86 -174.03 74 20 LYS A 87 ? ? -179.37 111.20 # _pdbx_nmr_ensemble.entry_id 6LLQ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6LLQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;500 uM [U-99% 13C; U-99% 15N] VAL88, 7.4 mM potassium phosphate, 1.2 mM sodium phosphate, 100 mM sodium chloride, 95 % H2O, 5 % [U-99% 2H] D2O, 95% H2O/5% D2O ; '95% H2O/5% D2O' VAL88 solution ? 2 ;100 uM [U-99% 13C; U-99% 15N] VAL88, 7.4 mM potassium phosphate, 1.2 mM sodium phosphate, 100 mM sodium chloride, 10 mg/mL Pf1 phage, 95 % H2O, 5 % [U-99% 2H] D2O, 95% H2O/5% D2O ; '95% H2O/5% D2O' VAL88-RDC solution 'Weakly aligned' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 VAL88 500 ? uM '[U-99% 13C; U-99% 15N]' 1 'potassium phosphate' 7.4 ? mM 'natural abundance' 1 'sodium phosphate' 1.2 ? mM 'natural abundance' 1 'sodium chloride' 100 ? mM 'natural abundance' 1 H2O 95 ? % 'natural abundance' 1 D2O 5 ? % '[U-99% 2H]' 2 VAL88 100 ? uM '[U-99% 13C; U-99% 15N]' 2 'potassium phosphate' 7.4 ? mM 'natural abundance' 2 'sodium phosphate' 1.2 ? mM 'natural abundance' 2 'sodium chloride' 100 ? mM 'natural abundance' 2 'Pf1 phage' 10 ? mg/mL 'natural abundance' 2 H2O 95 ? % 'natural abundance' 2 D2O 5 ? % '[U-99% 2H]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1.0 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 108.6 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label VAL88 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 2 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 2 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 2 isotropic 4 1 1 '3D CBCA(CO)NH' 2 isotropic 5 1 1 '3D HNCACB' 2 isotropic 6 1 1 '3D H(CCO)NH' 2 isotropic 7 1 1 '3D C(CO)NH' 2 isotropic 8 1 1 '3D 1H-15N NOESY' 2 isotropic 9 1 1 '3D 1H-13C NOESY aliphatic' 2 isotropic 10 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic 13 1 1 '3D HCCH-TOCSY aliphatic' 2 isotropic 11 1 2 '2D 1H-15N IPAP HSQC' 3 isotropic 12 1 2 '2D 1H-15N IPAP HSQC' 3 anisotropic # _pdbx_nmr_refine.entry_id 6LLQ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'refinment with RDC values as constrain' _pdbx_nmr_refine.software_ordinal 8 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin 3.2 'Bruker Biospin' 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'chemical shift assignment' NMRView 9.0 'Johnson, One Moon Scientific' 4 'data analysis' MAGRO 2.0.24 'Kobayashi, N.' 5 'chemical shift assignment' CYANA 3.98 'Guntert, Mumenthaler and Wuthrich' 6 'structure calculation' CYANA 3.98 'Guntert, Mumenthaler and Wuthrich' 7 'data analysis' TALOS TALOS+ 'Yang, S. and Bax, Ad.' 8 refinement CYANA 3.98 'Guntert, Mumenthaler and Wuthrich' 9 'data analysis' MAGRO 2.01.12 'Kobayashi, N. upgraded version of Kujira (Kobayshi, N. et al., 2007)' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 LEU N N N N 144 LEU CA C N S 145 LEU C C N N 146 LEU O O N N 147 LEU CB C N N 148 LEU CG C N N 149 LEU CD1 C N N 150 LEU CD2 C N N 151 LEU OXT O N N 152 LEU H H N N 153 LEU H2 H N N 154 LEU HA H N N 155 LEU HB2 H N N 156 LEU HB3 H N N 157 LEU HG H N N 158 LEU HD11 H N N 159 LEU HD12 H N N 160 LEU HD13 H N N 161 LEU HD21 H N N 162 LEU HD22 H N N 163 LEU HD23 H N N 164 LEU HXT H N N 165 LYS N N N N 166 LYS CA C N S 167 LYS C C N N 168 LYS O O N N 169 LYS CB C N N 170 LYS CG C N N 171 LYS CD C N N 172 LYS CE C N N 173 LYS NZ N N N 174 LYS OXT O N N 175 LYS H H N N 176 LYS H2 H N N 177 LYS HA H N N 178 LYS HB2 H N N 179 LYS HB3 H N N 180 LYS HG2 H N N 181 LYS HG3 H N N 182 LYS HD2 H N N 183 LYS HD3 H N N 184 LYS HE2 H N N 185 LYS HE3 H N N 186 LYS HZ1 H N N 187 LYS HZ2 H N N 188 LYS HZ3 H N N 189 LYS HXT H N N 190 PHE N N N N 191 PHE CA C N S 192 PHE C C N N 193 PHE O O N N 194 PHE CB C N N 195 PHE CG C Y N 196 PHE CD1 C Y N 197 PHE CD2 C Y N 198 PHE CE1 C Y N 199 PHE CE2 C Y N 200 PHE CZ C Y N 201 PHE OXT O N N 202 PHE H H N N 203 PHE H2 H N N 204 PHE HA H N N 205 PHE HB2 H N N 206 PHE HB3 H N N 207 PHE HD1 H N N 208 PHE HD2 H N N 209 PHE HE1 H N N 210 PHE HE2 H N N 211 PHE HZ H N N 212 PHE HXT H N N 213 PRO N N N N 214 PRO CA C N S 215 PRO C C N N 216 PRO O O N N 217 PRO CB C N N 218 PRO CG C N N 219 PRO CD C N N 220 PRO OXT O N N 221 PRO H H N N 222 PRO HA H N N 223 PRO HB2 H N N 224 PRO HB3 H N N 225 PRO HG2 H N N 226 PRO HG3 H N N 227 PRO HD2 H N N 228 PRO HD3 H N N 229 PRO HXT H N N 230 SER N N N N 231 SER CA C N S 232 SER C C N N 233 SER O O N N 234 SER CB C N N 235 SER OG O N N 236 SER OXT O N N 237 SER H H N N 238 SER H2 H N N 239 SER HA H N N 240 SER HB2 H N N 241 SER HB3 H N N 242 SER HG H N N 243 SER HXT H N N 244 THR N N N N 245 THR CA C N S 246 THR C C N N 247 THR O O N N 248 THR CB C N R 249 THR OG1 O N N 250 THR CG2 C N N 251 THR OXT O N N 252 THR H H N N 253 THR H2 H N N 254 THR HA H N N 255 THR HB H N N 256 THR HG1 H N N 257 THR HG21 H N N 258 THR HG22 H N N 259 THR HG23 H N N 260 THR HXT H N N 261 TYR N N N N 262 TYR CA C N S 263 TYR C C N N 264 TYR O O N N 265 TYR CB C N N 266 TYR CG C Y N 267 TYR CD1 C Y N 268 TYR CD2 C Y N 269 TYR CE1 C Y N 270 TYR CE2 C Y N 271 TYR CZ C Y N 272 TYR OH O N N 273 TYR OXT O N N 274 TYR H H N N 275 TYR H2 H N N 276 TYR HA H N N 277 TYR HB2 H N N 278 TYR HB3 H N N 279 TYR HD1 H N N 280 TYR HD2 H N N 281 TYR HE1 H N N 282 TYR HE2 H N N 283 TYR HH H N N 284 TYR HXT H N N 285 VAL N N N N 286 VAL CA C N S 287 VAL C C N N 288 VAL O O N N 289 VAL CB C N N 290 VAL CG1 C N N 291 VAL CG2 C N N 292 VAL OXT O N N 293 VAL H H N N 294 VAL H2 H N N 295 VAL HA H N N 296 VAL HB H N N 297 VAL HG11 H N N 298 VAL HG12 H N N 299 VAL HG13 H N N 300 VAL HG21 H N N 301 VAL HG22 H N N 302 VAL HG23 H N N 303 VAL HXT H N N 304 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 PHE N CA sing N N 182 PHE N H sing N N 183 PHE N H2 sing N N 184 PHE CA C sing N N 185 PHE CA CB sing N N 186 PHE CA HA sing N N 187 PHE C O doub N N 188 PHE C OXT sing N N 189 PHE CB CG sing N N 190 PHE CB HB2 sing N N 191 PHE CB HB3 sing N N 192 PHE CG CD1 doub Y N 193 PHE CG CD2 sing Y N 194 PHE CD1 CE1 sing Y N 195 PHE CD1 HD1 sing N N 196 PHE CD2 CE2 doub Y N 197 PHE CD2 HD2 sing N N 198 PHE CE1 CZ doub Y N 199 PHE CE1 HE1 sing N N 200 PHE CE2 CZ sing Y N 201 PHE CE2 HE2 sing N N 202 PHE CZ HZ sing N N 203 PHE OXT HXT sing N N 204 PRO N CA sing N N 205 PRO N CD sing N N 206 PRO N H sing N N 207 PRO CA C sing N N 208 PRO CA CB sing N N 209 PRO CA HA sing N N 210 PRO C O doub N N 211 PRO C OXT sing N N 212 PRO CB CG sing N N 213 PRO CB HB2 sing N N 214 PRO CB HB3 sing N N 215 PRO CG CD sing N N 216 PRO CG HG2 sing N N 217 PRO CG HG3 sing N N 218 PRO CD HD2 sing N N 219 PRO CD HD3 sing N N 220 PRO OXT HXT sing N N 221 SER N CA sing N N 222 SER N H sing N N 223 SER N H2 sing N N 224 SER CA C sing N N 225 SER CA CB sing N N 226 SER CA HA sing N N 227 SER C O doub N N 228 SER C OXT sing N N 229 SER CB OG sing N N 230 SER CB HB2 sing N N 231 SER CB HB3 sing N N 232 SER OG HG sing N N 233 SER OXT HXT sing N N 234 THR N CA sing N N 235 THR N H sing N N 236 THR N H2 sing N N 237 THR CA C sing N N 238 THR CA CB sing N N 239 THR CA HA sing N N 240 THR C O doub N N 241 THR C OXT sing N N 242 THR CB OG1 sing N N 243 THR CB CG2 sing N N 244 THR CB HB sing N N 245 THR OG1 HG1 sing N N 246 THR CG2 HG21 sing N N 247 THR CG2 HG22 sing N N 248 THR CG2 HG23 sing N N 249 THR OXT HXT sing N N 250 TYR N CA sing N N 251 TYR N H sing N N 252 TYR N H2 sing N N 253 TYR CA C sing N N 254 TYR CA CB sing N N 255 TYR CA HA sing N N 256 TYR C O doub N N 257 TYR C OXT sing N N 258 TYR CB CG sing N N 259 TYR CB HB2 sing N N 260 TYR CB HB3 sing N N 261 TYR CG CD1 doub Y N 262 TYR CG CD2 sing Y N 263 TYR CD1 CE1 sing Y N 264 TYR CD1 HD1 sing N N 265 TYR CD2 CE2 doub Y N 266 TYR CD2 HD2 sing N N 267 TYR CE1 CZ doub Y N 268 TYR CE1 HE1 sing N N 269 TYR CE2 CZ sing Y N 270 TYR CE2 HE2 sing N N 271 TYR CZ OH sing N N 272 TYR OH HH sing N N 273 TYR OXT HXT sing N N 274 VAL N CA sing N N 275 VAL N H sing N N 276 VAL N H2 sing N N 277 VAL CA C sing N N 278 VAL CA CB sing N N 279 VAL CA HA sing N N 280 VAL C O doub N N 281 VAL C OXT sing N N 282 VAL CB CG1 sing N N 283 VAL CB CG2 sing N N 284 VAL CB HB sing N N 285 VAL CG1 HG11 sing N N 286 VAL CG1 HG12 sing N N 287 VAL CG1 HG13 sing N N 288 VAL CG2 HG21 sing N N 289 VAL CG2 HG22 sing N N 290 VAL CG2 HG23 sing N N 291 VAL OXT HXT sing N N 292 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Japan Society for the Promotion of Science (JSPS)' Japan 15H05592 1 'Japan Society for the Promotion of Science (JSPS)' Japan 18H05420 2 'Japan Science and Technology' Japan JPMJPR13AD 3 'Japan Agency for Medical Research and Development (AMED)' Japan JP19am0101072 4 'Japan Society for the Promotion of Science (JSPS)' Japan 18K06152 5 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 800 ? 3 'AVANCE III' ? Bruker 950 ? # _atom_sites.entry_id 6LLQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_