data_6M2E # _entry.id 6M2E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6M2E pdb_00006m2e 10.2210/pdb6m2e/pdb WWPDB D_1300015924 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6M2E _pdbx_database_status.recvd_initial_deposition_date 2020-02-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Fujishiro, T.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0001-7967-8380 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-6520 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 2172 _citation.page_last 2180 _citation.title 'The nickel-sirohydrochlorin formation mechanism of the ancestral class II chelatase CfbA in coenzyme F430 biosynthesis.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/d0sc05439a _citation.pdbx_database_id_PubMed 34163982 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fujishiro, T.' 1 0000-0001-7967-8380 primary 'Ogawa, S.' 2 0000-0002-1409-3784 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6M2E _cell.details ? _cell.formula_units_Z ? _cell.length_a 69.140 _cell.length_a_esd ? _cell.length_b 69.140 _cell.length_b_esd ? _cell.length_c 81.650 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6M2E _symmetry.cell_setting ? _symmetry.Int_Tables_number 76 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Sirohydrochlorin cobaltochelatase' 16554.045 2 4.99.1.3,4.99.1.11 ? ? ? 2 non-polymer syn ;3,3',3'',3'''-[(7S,8S,12S,13S)-3,8,13,17-tetrakis(carboxymethyl)-8,13-dimethyl-7,8,12,13-tetrahydroporphyrin-2,7,12,18-tetrayl]tetrapropanoic acid ; 862.832 1 ? ? ? ? 3 water nat water 18.015 5 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CbiXS,Sirohydrochlorin nickelchelatase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEALVLVGHGSRLPYSKELLVKLAEKVKERNLFPIVEIGLMEFSEPTIPQAVKKAIEQGAKRIIVVPVFLAHGIHTTRDI PRLLGLIEDNHEHHHEHSHHHHHHHHHEHEKLEIPEDVEIIYREPIGADDRIVDIIIDRAFGR ; _entity_poly.pdbx_seq_one_letter_code_can ;MEALVLVGHGSRLPYSKELLVKLAEKVKERNLFPIVEIGLMEFSEPTIPQAVKKAIEQGAKRIIVVPVFLAHGIHTTRDI PRLLGLIEDNHEHHHEHSHHHHHHHHHEHEKLEIPEDVEIIYREPIGADDRIVDIIIDRAFGR ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ALA n 1 4 LEU n 1 5 VAL n 1 6 LEU n 1 7 VAL n 1 8 GLY n 1 9 HIS n 1 10 GLY n 1 11 SER n 1 12 ARG n 1 13 LEU n 1 14 PRO n 1 15 TYR n 1 16 SER n 1 17 LYS n 1 18 GLU n 1 19 LEU n 1 20 LEU n 1 21 VAL n 1 22 LYS n 1 23 LEU n 1 24 ALA n 1 25 GLU n 1 26 LYS n 1 27 VAL n 1 28 LYS n 1 29 GLU n 1 30 ARG n 1 31 ASN n 1 32 LEU n 1 33 PHE n 1 34 PRO n 1 35 ILE n 1 36 VAL n 1 37 GLU n 1 38 ILE n 1 39 GLY n 1 40 LEU n 1 41 MET n 1 42 GLU n 1 43 PHE n 1 44 SER n 1 45 GLU n 1 46 PRO n 1 47 THR n 1 48 ILE n 1 49 PRO n 1 50 GLN n 1 51 ALA n 1 52 VAL n 1 53 LYS n 1 54 LYS n 1 55 ALA n 1 56 ILE n 1 57 GLU n 1 58 GLN n 1 59 GLY n 1 60 ALA n 1 61 LYS n 1 62 ARG n 1 63 ILE n 1 64 ILE n 1 65 VAL n 1 66 VAL n 1 67 PRO n 1 68 VAL n 1 69 PHE n 1 70 LEU n 1 71 ALA n 1 72 HIS n 1 73 GLY n 1 74 ILE n 1 75 HIS n 1 76 THR n 1 77 THR n 1 78 ARG n 1 79 ASP n 1 80 ILE n 1 81 PRO n 1 82 ARG n 1 83 LEU n 1 84 LEU n 1 85 GLY n 1 86 LEU n 1 87 ILE n 1 88 GLU n 1 89 ASP n 1 90 ASN n 1 91 HIS n 1 92 GLU n 1 93 HIS n 1 94 HIS n 1 95 HIS n 1 96 GLU n 1 97 HIS n 1 98 SER n 1 99 HIS n 1 100 HIS n 1 101 HIS n 1 102 HIS n 1 103 HIS n 1 104 HIS n 1 105 HIS n 1 106 HIS n 1 107 HIS n 1 108 GLU n 1 109 HIS n 1 110 GLU n 1 111 LYS n 1 112 LEU n 1 113 GLU n 1 114 ILE n 1 115 PRO n 1 116 GLU n 1 117 ASP n 1 118 VAL n 1 119 GLU n 1 120 ILE n 1 121 ILE n 1 122 TYR n 1 123 ARG n 1 124 GLU n 1 125 PRO n 1 126 ILE n 1 127 GLY n 1 128 ALA n 1 129 ASP n 1 130 ASP n 1 131 ARG n 1 132 ILE n 1 133 VAL n 1 134 ASP n 1 135 ILE n 1 136 ILE n 1 137 ILE n 1 138 ASP n 1 139 ARG n 1 140 ALA n 1 141 PHE n 1 142 GLY n 1 143 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 143 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'cbiX, cfbA, MJ0970' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 243232 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant C41 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CFBA_METJA _struct_ref.pdbx_db_accession Q58380 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEALVLVGHGSRLPYSKELLVKLAEKVKERNLFPIVEIGLMEFSEPTIPQAVKKAIEQGAKRIIVVPVFLAHGIHTTRDI PRLLGLIEDNHEHHHEHSHHHHHHHHHEHEKLEIPEDVEIIYREPIGADDRIVDIIIDRAFGR ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6M2E A 1 ? 143 ? Q58380 1 ? 143 ? 1 143 2 1 6M2E B 1 ? 143 ? Q58380 1 ? 143 ? 1 143 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SHN non-polymer . ;3,3',3'',3'''-[(7S,8S,12S,13S)-3,8,13,17-tetrakis(carboxymethyl)-8,13-dimethyl-7,8,12,13-tetrahydroporphyrin-2,7,12,18-tetrayl]tetrapropanoic acid ; ? 'C42 H46 N4 O16' 862.832 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6M2E _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.95 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.27 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M ammonium sulfate, 0.3M Na-formate, 0.1M Na-acetate, 3% (w/v) gamma-PGA, 5% (w/v) PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-07-22 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'liquid-nitrogen-cooled Si(111) double-crystal monochromator' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.606990 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL44XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.606990 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL44XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 83.400 _reflns.entry_id 6M2E _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.600 _reflns.d_resolution_low 48.890 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11899 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.665 _reflns.pdbx_Rmerge_I_obs 0.059 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.660 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.970 _reflns.pdbx_scaling_rejects 13 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.061 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 162601 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.600 2.700 ? 3.010 ? 16848 1261 ? 1261 100.000 ? ? ? ? 0.945 ? ? ? ? ? ? ? ? 13.361 ? ? ? ? 0.983 ? ? 1 1 0.840 ? ? 2.700 2.800 ? 4.320 ? 15206 1092 ? 1092 100.000 ? ? ? ? 0.688 ? ? ? ? ? ? ? ? 13.925 ? ? ? ? 0.714 ? ? 2 1 0.933 ? ? 2.800 2.900 ? 6.380 ? 13126 948 ? 948 100.000 ? ? ? ? 0.459 ? ? ? ? ? ? ? ? 13.846 ? ? ? ? 0.476 ? ? 3 1 0.961 ? ? 2.900 3.000 ? 9.100 ? 11253 825 ? 825 100.000 ? ? ? ? 0.304 ? ? ? ? ? ? ? ? 13.640 ? ? ? ? 0.316 ? ? 4 1 0.987 ? ? 3.000 3.100 ? 13.020 ? 9561 709 ? 709 100.000 ? ? ? ? 0.206 ? ? ? ? ? ? ? ? 13.485 ? ? ? ? 0.214 ? ? 5 1 0.991 ? ? 3.100 3.200 ? 15.810 ? 8278 644 ? 644 100.000 ? ? ? ? 0.157 ? ? ? ? ? ? ? ? 12.854 ? ? ? ? 0.164 ? ? 6 1 0.994 ? ? 3.200 3.300 ? 20.300 ? 7418 568 ? 567 99.800 ? ? ? ? 0.121 ? ? ? ? ? ? ? ? 13.083 ? ? ? ? 0.126 ? ? 7 1 0.996 ? ? 3.300 3.400 ? 25.120 ? 6821 479 ? 479 100.000 ? ? ? ? 0.094 ? ? ? ? ? ? ? ? 14.240 ? ? ? ? 0.098 ? ? 8 1 0.998 ? ? 3.400 3.500 ? 28.560 ? 6567 459 ? 458 99.800 ? ? ? ? 0.081 ? ? ? ? ? ? ? ? 14.338 ? ? ? ? 0.084 ? ? 9 1 0.997 ? ? 3.500 4.000 ? 36.460 ? 22683 1605 ? 1604 99.900 ? ? ? ? 0.060 ? ? ? ? ? ? ? ? 14.142 ? ? ? ? 0.062 ? ? 10 1 0.999 ? ? 4.000 6.000 ? 48.850 ? 31595 2311 ? 2311 100.000 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 13.672 ? ? ? ? 0.046 ? ? 11 1 0.999 ? ? 6.000 10.000 ? 55.060 ? 10344 782 ? 782 100.000 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 13.228 ? ? ? ? 0.047 ? ? 12 1 0.999 ? ? 10.000 48.890 ? 58.220 ? 2901 221 ? 219 99.100 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 13.247 ? ? ? ? 0.052 ? ? 13 1 0.998 ? ? # _refine.aniso_B[1][1] 0.0100 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.0100 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -0.0200 _refine.B_iso_max 175.450 _refine.B_iso_mean 82.4770 _refine.B_iso_min 44.270 _refine.correlation_coeff_Fo_to_Fc 0.9630 _refine.correlation_coeff_Fo_to_Fc_free 0.9420 _refine.details 'U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6M2E _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6000 _refine.ls_d_res_low 48.8900 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11303 _refine.ls_number_reflns_R_free 595 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9600 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1945 _refine.ls_R_factor_R_free 0.2348 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1925 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.2530 _refine.ls_wR_factor_R_work 0.2019 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2XWS _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.3810 _refine.pdbx_overall_ESU_R_Free 0.2580 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 10.0100 _refine.overall_SU_ML 0.2060 _refine.overall_SU_R_Cruickshank_DPI 0.3808 _refine.overall_SU_R_free 0.2581 _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.7885 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.6000 _refine_hist.d_res_low 48.8900 _refine_hist.number_atoms_solvent 5 _refine_hist.number_atoms_total 1953 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 238 _refine_hist.pdbx_B_iso_mean_ligand 108.98 _refine_hist.pdbx_B_iso_mean_solvent 66.34 _refine_hist.pdbx_number_atoms_protein 1886 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 62 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.012 1982 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 2.131 1.684 2686 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 6.038 5.000 234 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.794 20.816 98 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 24.751 15.000 364 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 22.917 15.000 18 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.142 0.200 266 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 1478 ? r_gen_planes_refined ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? 0.080 ? 0.050 1 'interatomic distance' ? A 3568 ? ? 1 'X-RAY DIFFRACTION' 2 ? ? 0.080 ? 0.050 2 'interatomic distance' ? B 3568 ? ? 1 # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.6000 _refine_ls_shell.d_res_low 2.6670 _refine_ls_shell.number_reflns_all 875 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 43 _refine_ls_shell.number_reflns_R_work 832 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3250 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3330 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 A 1 2 B # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 0 A MET 1 . A ARG 143 . A MET 1 A ARG 143 0 ? 1 2 0 B MET 1 . B ARG 143 . B MET 1 B ARG 143 0 ? # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 6M2E _struct.title 'Sirohydrochlorin nickelochelatase CfbA in complex with sirohydrochlorin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6M2E _struct_keywords.text 'Chelatase, BIOSYNTHETIC PROTEIN' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 14 ? GLU A 29 ? PRO A 14 GLU A 29 1 ? 16 HELX_P HELX_P2 AA2 THR A 47 ? GLU A 57 ? THR A 47 GLU A 57 1 ? 11 HELX_P HELX_P3 AA3 GLY A 73 ? ARG A 78 ? GLY A 73 ARG A 78 1 ? 6 HELX_P HELX_P4 AA4 ARG A 78 ? LEU A 84 ? ARG A 78 LEU A 84 1 ? 7 HELX_P HELX_P5 AA5 ASP A 129 ? PHE A 141 ? ASP A 129 PHE A 141 1 ? 13 HELX_P HELX_P6 AA6 PRO B 14 ? GLU B 29 ? PRO B 14 GLU B 29 1 ? 16 HELX_P HELX_P7 AA7 THR B 47 ? GLU B 57 ? THR B 47 GLU B 57 1 ? 11 HELX_P HELX_P8 AA8 GLY B 73 ? ARG B 78 ? GLY B 73 ARG B 78 1 ? 6 HELX_P HELX_P9 AA9 ARG B 78 ? LEU B 84 ? ARG B 78 LEU B 84 1 ? 7 HELX_P HELX_P10 AB1 ASP B 129 ? PHE B 141 ? ASP B 129 PHE B 141 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 45 A . ? GLU 45 A PRO 46 A ? PRO 46 A 1 -4.68 2 GLU 45 B . ? GLU 45 B PRO 46 B ? PRO 46 B 1 -3.50 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 35 ? LEU A 40 ? ILE A 35 LEU A 40 AA1 2 GLU A 2 ? GLY A 8 ? GLU A 2 GLY A 8 AA1 3 ARG A 62 ? PRO A 67 ? ARG A 62 PRO A 67 AA1 4 GLU A 119 ? TYR A 122 ? GLU A 119 TYR A 122 AA2 1 ILE B 35 ? LEU B 40 ? ILE B 35 LEU B 40 AA2 2 GLU B 2 ? GLY B 8 ? GLU B 2 GLY B 8 AA2 3 ARG B 62 ? PRO B 67 ? ARG B 62 PRO B 67 AA2 4 GLU B 119 ? TYR B 122 ? GLU B 119 TYR B 122 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 37 ? O GLU A 37 N LEU A 4 ? N LEU A 4 AA1 2 3 N ALA A 3 ? N ALA A 3 O ILE A 64 ? O ILE A 64 AA1 3 4 N ILE A 63 ? N ILE A 63 O ILE A 121 ? O ILE A 121 AA2 1 2 O GLU B 37 ? O GLU B 37 N LEU B 4 ? N LEU B 4 AA2 2 3 N ALA B 3 ? N ALA B 3 O ILE B 64 ? O ILE B 64 AA2 3 4 N ILE B 63 ? N ILE B 63 O ILE B 121 ? O ILE B 121 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id SHN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 21 _struct_site.details 'binding site for residue SHN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 21 HIS A 9 ? HIS A 9 . ? 1_555 ? 2 AC1 21 SER A 11 ? SER A 11 . ? 1_555 ? 3 AC1 21 ARG A 12 ? ARG A 12 . ? 1_555 ? 4 AC1 21 PHE A 43 ? PHE A 43 . ? 1_555 ? 5 AC1 21 PHE A 69 ? PHE A 69 . ? 1_555 ? 6 AC1 21 LEU A 70 ? LEU A 70 . ? 1_555 ? 7 AC1 21 ALA A 71 ? ALA A 71 . ? 1_555 ? 8 AC1 21 GLY A 73 ? GLY A 73 . ? 1_555 ? 9 AC1 21 ILE A 74 ? ILE A 74 . ? 1_555 ? 10 AC1 21 HIS A 75 ? HIS A 75 . ? 1_555 ? 11 AC1 21 HIS B 9 ? HIS B 9 . ? 1_555 ? 12 AC1 21 GLY B 10 ? GLY B 10 . ? 1_555 ? 13 AC1 21 SER B 11 ? SER B 11 . ? 1_555 ? 14 AC1 21 ARG B 12 ? ARG B 12 . ? 1_555 ? 15 AC1 21 PHE B 43 ? PHE B 43 . ? 1_555 ? 16 AC1 21 PHE B 69 ? PHE B 69 . ? 1_555 ? 17 AC1 21 LEU B 70 ? LEU B 70 . ? 1_555 ? 18 AC1 21 ALA B 71 ? ALA B 71 . ? 1_555 ? 19 AC1 21 GLY B 73 ? GLY B 73 . ? 1_555 ? 20 AC1 21 ILE B 74 ? ILE B 74 . ? 1_555 ? 21 AC1 21 HIS B 75 ? HIS B 75 . ? 1_555 ? # _atom_sites.entry_id 6M2E _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014463 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014463 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012247 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ASP 89 89 ? ? ? A . n A 1 90 ASN 90 90 ? ? ? A . n A 1 91 HIS 91 91 ? ? ? A . n A 1 92 GLU 92 92 ? ? ? A . n A 1 93 HIS 93 93 ? ? ? A . n A 1 94 HIS 94 94 ? ? ? A . n A 1 95 HIS 95 95 ? ? ? A . n A 1 96 GLU 96 96 ? ? ? A . n A 1 97 HIS 97 97 ? ? ? A . n A 1 98 SER 98 98 ? ? ? A . n A 1 99 HIS 99 99 ? ? ? A . n A 1 100 HIS 100 100 ? ? ? A . n A 1 101 HIS 101 101 ? ? ? A . n A 1 102 HIS 102 102 ? ? ? A . n A 1 103 HIS 103 103 ? ? ? A . n A 1 104 HIS 104 104 ? ? ? A . n A 1 105 HIS 105 105 ? ? ? A . n A 1 106 HIS 106 106 ? ? ? A . n A 1 107 HIS 107 107 ? ? ? A . n A 1 108 GLU 108 108 ? ? ? A . n A 1 109 HIS 109 109 ? ? ? A . n A 1 110 GLU 110 110 ? ? ? A . n A 1 111 LYS 111 111 ? ? ? A . n A 1 112 LEU 112 112 ? ? ? A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ARG 143 143 143 ARG ARG A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 GLU 2 2 2 GLU GLU B . n B 1 3 ALA 3 3 3 ALA ALA B . n B 1 4 LEU 4 4 4 LEU LEU B . n B 1 5 VAL 5 5 5 VAL VAL B . n B 1 6 LEU 6 6 6 LEU LEU B . n B 1 7 VAL 7 7 7 VAL VAL B . n B 1 8 GLY 8 8 8 GLY GLY B . n B 1 9 HIS 9 9 9 HIS HIS B . n B 1 10 GLY 10 10 10 GLY GLY B . n B 1 11 SER 11 11 11 SER SER B . n B 1 12 ARG 12 12 12 ARG ARG B . n B 1 13 LEU 13 13 13 LEU LEU B . n B 1 14 PRO 14 14 14 PRO PRO B . n B 1 15 TYR 15 15 15 TYR TYR B . n B 1 16 SER 16 16 16 SER SER B . n B 1 17 LYS 17 17 17 LYS LYS B . n B 1 18 GLU 18 18 18 GLU GLU B . n B 1 19 LEU 19 19 19 LEU LEU B . n B 1 20 LEU 20 20 20 LEU LEU B . n B 1 21 VAL 21 21 21 VAL VAL B . n B 1 22 LYS 22 22 22 LYS LYS B . n B 1 23 LEU 23 23 23 LEU LEU B . n B 1 24 ALA 24 24 24 ALA ALA B . n B 1 25 GLU 25 25 25 GLU GLU B . n B 1 26 LYS 26 26 26 LYS LYS B . n B 1 27 VAL 27 27 27 VAL VAL B . n B 1 28 LYS 28 28 28 LYS LYS B . n B 1 29 GLU 29 29 29 GLU GLU B . n B 1 30 ARG 30 30 30 ARG ARG B . n B 1 31 ASN 31 31 31 ASN ASN B . n B 1 32 LEU 32 32 32 LEU LEU B . n B 1 33 PHE 33 33 33 PHE PHE B . n B 1 34 PRO 34 34 34 PRO PRO B . n B 1 35 ILE 35 35 35 ILE ILE B . n B 1 36 VAL 36 36 36 VAL VAL B . n B 1 37 GLU 37 37 37 GLU GLU B . n B 1 38 ILE 38 38 38 ILE ILE B . n B 1 39 GLY 39 39 39 GLY GLY B . n B 1 40 LEU 40 40 40 LEU LEU B . n B 1 41 MET 41 41 41 MET MET B . n B 1 42 GLU 42 42 42 GLU GLU B . n B 1 43 PHE 43 43 43 PHE PHE B . n B 1 44 SER 44 44 44 SER SER B . n B 1 45 GLU 45 45 45 GLU GLU B . n B 1 46 PRO 46 46 46 PRO PRO B . n B 1 47 THR 47 47 47 THR THR B . n B 1 48 ILE 48 48 48 ILE ILE B . n B 1 49 PRO 49 49 49 PRO PRO B . n B 1 50 GLN 50 50 50 GLN GLN B . n B 1 51 ALA 51 51 51 ALA ALA B . n B 1 52 VAL 52 52 52 VAL VAL B . n B 1 53 LYS 53 53 53 LYS LYS B . n B 1 54 LYS 54 54 54 LYS LYS B . n B 1 55 ALA 55 55 55 ALA ALA B . n B 1 56 ILE 56 56 56 ILE ILE B . n B 1 57 GLU 57 57 57 GLU GLU B . n B 1 58 GLN 58 58 58 GLN GLN B . n B 1 59 GLY 59 59 59 GLY GLY B . n B 1 60 ALA 60 60 60 ALA ALA B . n B 1 61 LYS 61 61 61 LYS LYS B . n B 1 62 ARG 62 62 62 ARG ARG B . n B 1 63 ILE 63 63 63 ILE ILE B . n B 1 64 ILE 64 64 64 ILE ILE B . n B 1 65 VAL 65 65 65 VAL VAL B . n B 1 66 VAL 66 66 66 VAL VAL B . n B 1 67 PRO 67 67 67 PRO PRO B . n B 1 68 VAL 68 68 68 VAL VAL B . n B 1 69 PHE 69 69 69 PHE PHE B . n B 1 70 LEU 70 70 70 LEU LEU B . n B 1 71 ALA 71 71 71 ALA ALA B . n B 1 72 HIS 72 72 72 HIS HIS B . n B 1 73 GLY 73 73 73 GLY GLY B . n B 1 74 ILE 74 74 74 ILE ILE B . n B 1 75 HIS 75 75 75 HIS HIS B . n B 1 76 THR 76 76 76 THR THR B . n B 1 77 THR 77 77 77 THR THR B . n B 1 78 ARG 78 78 78 ARG ARG B . n B 1 79 ASP 79 79 79 ASP ASP B . n B 1 80 ILE 80 80 80 ILE ILE B . n B 1 81 PRO 81 81 81 PRO PRO B . n B 1 82 ARG 82 82 82 ARG ARG B . n B 1 83 LEU 83 83 83 LEU LEU B . n B 1 84 LEU 84 84 84 LEU LEU B . n B 1 85 GLY 85 85 85 GLY GLY B . n B 1 86 LEU 86 86 86 LEU LEU B . n B 1 87 ILE 87 87 87 ILE ILE B . n B 1 88 GLU 88 88 88 GLU GLU B . n B 1 89 ASP 89 89 ? ? ? B . n B 1 90 ASN 90 90 ? ? ? B . n B 1 91 HIS 91 91 ? ? ? B . n B 1 92 GLU 92 92 ? ? ? B . n B 1 93 HIS 93 93 ? ? ? B . n B 1 94 HIS 94 94 ? ? ? B . n B 1 95 HIS 95 95 ? ? ? B . n B 1 96 GLU 96 96 ? ? ? B . n B 1 97 HIS 97 97 ? ? ? B . n B 1 98 SER 98 98 ? ? ? B . n B 1 99 HIS 99 99 ? ? ? B . n B 1 100 HIS 100 100 ? ? ? B . n B 1 101 HIS 101 101 ? ? ? B . n B 1 102 HIS 102 102 ? ? ? B . n B 1 103 HIS 103 103 ? ? ? B . n B 1 104 HIS 104 104 ? ? ? B . n B 1 105 HIS 105 105 ? ? ? B . n B 1 106 HIS 106 106 ? ? ? B . n B 1 107 HIS 107 107 ? ? ? B . n B 1 108 GLU 108 108 ? ? ? B . n B 1 109 HIS 109 109 ? ? ? B . n B 1 110 GLU 110 110 ? ? ? B . n B 1 111 LYS 111 111 ? ? ? B . n B 1 112 LEU 112 112 ? ? ? B . n B 1 113 GLU 113 113 113 GLU GLU B . n B 1 114 ILE 114 114 114 ILE ILE B . n B 1 115 PRO 115 115 115 PRO PRO B . n B 1 116 GLU 116 116 116 GLU GLU B . n B 1 117 ASP 117 117 117 ASP ASP B . n B 1 118 VAL 118 118 118 VAL VAL B . n B 1 119 GLU 119 119 119 GLU GLU B . n B 1 120 ILE 120 120 120 ILE ILE B . n B 1 121 ILE 121 121 121 ILE ILE B . n B 1 122 TYR 122 122 122 TYR TYR B . n B 1 123 ARG 123 123 123 ARG ARG B . n B 1 124 GLU 124 124 124 GLU GLU B . n B 1 125 PRO 125 125 125 PRO PRO B . n B 1 126 ILE 126 126 126 ILE ILE B . n B 1 127 GLY 127 127 127 GLY GLY B . n B 1 128 ALA 128 128 128 ALA ALA B . n B 1 129 ASP 129 129 129 ASP ASP B . n B 1 130 ASP 130 130 130 ASP ASP B . n B 1 131 ARG 131 131 131 ARG ARG B . n B 1 132 ILE 132 132 132 ILE ILE B . n B 1 133 VAL 133 133 133 VAL VAL B . n B 1 134 ASP 134 134 134 ASP ASP B . n B 1 135 ILE 135 135 135 ILE ILE B . n B 1 136 ILE 136 136 136 ILE ILE B . n B 1 137 ILE 137 137 137 ILE ILE B . n B 1 138 ASP 138 138 138 ASP ASP B . n B 1 139 ARG 139 139 139 ARG ARG B . n B 1 140 ALA 140 140 140 ALA ALA B . n B 1 141 PHE 141 141 141 PHE PHE B . n B 1 142 GLY 142 142 142 GLY GLY B . n B 1 143 ARG 143 143 143 ARG ARG B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 SHN 1 201 1 SHN ZW9 A . D 3 HOH 1 301 2 HOH HOH A . D 3 HOH 2 302 1 HOH HOH A . D 3 HOH 3 303 3 HOH HOH A . E 3 HOH 1 201 4 HOH HOH B . E 3 HOH 2 202 5 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4680 ? 1 MORE -29 ? 1 'SSA (A^2)' 11320 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-01-13 2 'Structure model' 1 1 2021-07-07 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 3 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_ISSN' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation_author.identifier_ORCID' 9 3 'Structure model' '_database_2.pdbx_DOI' 10 3 'Structure model' '_database_2.pdbx_database_accession' 11 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 12 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 13 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 14 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 15 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 16 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 17 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 18 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _pdbx_entry_details.entry_id 6M2E _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 43 ? ? 69.99 -5.28 2 1 ARG A 78 ? ? -110.78 -75.19 3 1 ASP A 117 ? ? -98.02 32.56 4 1 PHE B 43 ? ? 52.41 12.44 5 1 ARG B 78 ? ? -110.61 -75.85 6 1 ILE B 87 ? ? -125.86 -61.67 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 89 ? A ASP 89 2 1 Y 1 A ASN 90 ? A ASN 90 3 1 Y 1 A HIS 91 ? A HIS 91 4 1 Y 1 A GLU 92 ? A GLU 92 5 1 Y 1 A HIS 93 ? A HIS 93 6 1 Y 1 A HIS 94 ? A HIS 94 7 1 Y 1 A HIS 95 ? A HIS 95 8 1 Y 1 A GLU 96 ? A GLU 96 9 1 Y 1 A HIS 97 ? A HIS 97 10 1 Y 1 A SER 98 ? A SER 98 11 1 Y 1 A HIS 99 ? A HIS 99 12 1 Y 1 A HIS 100 ? A HIS 100 13 1 Y 1 A HIS 101 ? A HIS 101 14 1 Y 1 A HIS 102 ? A HIS 102 15 1 Y 1 A HIS 103 ? A HIS 103 16 1 Y 1 A HIS 104 ? A HIS 104 17 1 Y 1 A HIS 105 ? A HIS 105 18 1 Y 1 A HIS 106 ? A HIS 106 19 1 Y 1 A HIS 107 ? A HIS 107 20 1 Y 1 A GLU 108 ? A GLU 108 21 1 Y 1 A HIS 109 ? A HIS 109 22 1 Y 1 A GLU 110 ? A GLU 110 23 1 Y 1 A LYS 111 ? A LYS 111 24 1 Y 1 A LEU 112 ? A LEU 112 25 1 Y 1 B ASP 89 ? B ASP 89 26 1 Y 1 B ASN 90 ? B ASN 90 27 1 Y 1 B HIS 91 ? B HIS 91 28 1 Y 1 B GLU 92 ? B GLU 92 29 1 Y 1 B HIS 93 ? B HIS 93 30 1 Y 1 B HIS 94 ? B HIS 94 31 1 Y 1 B HIS 95 ? B HIS 95 32 1 Y 1 B GLU 96 ? B GLU 96 33 1 Y 1 B HIS 97 ? B HIS 97 34 1 Y 1 B SER 98 ? B SER 98 35 1 Y 1 B HIS 99 ? B HIS 99 36 1 Y 1 B HIS 100 ? B HIS 100 37 1 Y 1 B HIS 101 ? B HIS 101 38 1 Y 1 B HIS 102 ? B HIS 102 39 1 Y 1 B HIS 103 ? B HIS 103 40 1 Y 1 B HIS 104 ? B HIS 104 41 1 Y 1 B HIS 105 ? B HIS 105 42 1 Y 1 B HIS 106 ? B HIS 106 43 1 Y 1 B HIS 107 ? B HIS 107 44 1 Y 1 B GLU 108 ? B GLU 108 45 1 Y 1 B HIS 109 ? B HIS 109 46 1 Y 1 B GLU 110 ? B GLU 110 47 1 Y 1 B LYS 111 ? B LYS 111 48 1 Y 1 B LEU 112 ? B LEU 112 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 SHN C2A C N S 290 SHN C2B C N S 291 SHN CMA C N N 292 SHN CMB C N N 293 SHN NB N Y N 294 SHN ND N Y N 295 SHN C1A C Y N 296 SHN C1B C Y N 297 SHN C1C C Y N 298 SHN C1D C Y N 299 SHN C2C C Y N 300 SHN C2D C Y N 301 SHN C3A C N S 302 SHN C3B C N S 303 SHN C3C C Y N 304 SHN C3D C Y N 305 SHN C4A C Y N 306 SHN C4B C Y N 307 SHN C4C C Y N 308 SHN C4D C Y N 309 SHN CAA C N N 310 SHN CAB C N N 311 SHN CAC C N N 312 SHN CAD C N N 313 SHN CBA C N N 314 SHN CBB C N N 315 SHN CBC C N N 316 SHN CBD C N N 317 SHN CCA C N N 318 SHN CCB C N N 319 SHN CCC C N N 320 SHN CCD C N N 321 SHN CDA C N N 322 SHN CDB C N N 323 SHN CDC C N N 324 SHN CDD C N N 325 SHN CEA C N N 326 SHN CEB C N N 327 SHN CEC C N N 328 SHN CED C N N 329 SHN CHA C Y N 330 SHN CHB C Y N 331 SHN CHC C Y N 332 SHN CHD C Y N 333 SHN NA N Y N 334 SHN NC N Y N 335 SHN O1A O N N 336 SHN O1B O N N 337 SHN O1C O N N 338 SHN O1D O N N 339 SHN O2A O N N 340 SHN O2B O N N 341 SHN O2C O N N 342 SHN O2D O N N 343 SHN O3A O N N 344 SHN O3B O N N 345 SHN O3C O N N 346 SHN O3D O N N 347 SHN O4A O N N 348 SHN O4B O N N 349 SHN O4C O N N 350 SHN O4D O N N 351 SHN H1 H N N 352 SHN H2 H N N 353 SHN H3 H N N 354 SHN H4 H N N 355 SHN H5 H N N 356 SHN H6 H N N 357 SHN H7 H N N 358 SHN H8 H N N 359 SHN H9 H N N 360 SHN H10 H N N 361 SHN H11 H N N 362 SHN H12 H N N 363 SHN H13 H N N 364 SHN H14 H N N 365 SHN H15 H N N 366 SHN H16 H N N 367 SHN H17 H N N 368 SHN H18 H N N 369 SHN H19 H N N 370 SHN H20 H N N 371 SHN H21 H N N 372 SHN H22 H N N 373 SHN H23 H N N 374 SHN H24 H N N 375 SHN H25 H N N 376 SHN H26 H N N 377 SHN H27 H N N 378 SHN H28 H N N 379 SHN H29 H N N 380 SHN H30 H N N 381 SHN H31 H N N 382 SHN H32 H N N 383 SHN H33 H N N 384 SHN H34 H N N 385 SHN H37 H N N 386 SHN H38 H N N 387 SHN H39 H N N 388 SHN H40 H N N 389 SHN H41 H N N 390 SHN H42 H N N 391 SHN H43 H N N 392 SHN H44 H N N 393 SHN H45 H N N 394 SHN H46 H N N 395 SHN H47 H N N 396 SHN H48 H N N 397 THR N N N N 398 THR CA C N S 399 THR C C N N 400 THR O O N N 401 THR CB C N R 402 THR OG1 O N N 403 THR CG2 C N N 404 THR OXT O N N 405 THR H H N N 406 THR H2 H N N 407 THR HA H N N 408 THR HB H N N 409 THR HG1 H N N 410 THR HG21 H N N 411 THR HG22 H N N 412 THR HG23 H N N 413 THR HXT H N N 414 TYR N N N N 415 TYR CA C N S 416 TYR C C N N 417 TYR O O N N 418 TYR CB C N N 419 TYR CG C Y N 420 TYR CD1 C Y N 421 TYR CD2 C Y N 422 TYR CE1 C Y N 423 TYR CE2 C Y N 424 TYR CZ C Y N 425 TYR OH O N N 426 TYR OXT O N N 427 TYR H H N N 428 TYR H2 H N N 429 TYR HA H N N 430 TYR HB2 H N N 431 TYR HB3 H N N 432 TYR HD1 H N N 433 TYR HD2 H N N 434 TYR HE1 H N N 435 TYR HE2 H N N 436 TYR HH H N N 437 TYR HXT H N N 438 VAL N N N N 439 VAL CA C N S 440 VAL C C N N 441 VAL O O N N 442 VAL CB C N N 443 VAL CG1 C N N 444 VAL CG2 C N N 445 VAL OXT O N N 446 VAL H H N N 447 VAL H2 H N N 448 VAL HA H N N 449 VAL HB H N N 450 VAL HG11 H N N 451 VAL HG12 H N N 452 VAL HG13 H N N 453 VAL HG21 H N N 454 VAL HG22 H N N 455 VAL HG23 H N N 456 VAL HXT H N N 457 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 SHN O1B CCB doub N N 277 SHN O2B CCB sing N N 278 SHN CCB CBB sing N N 279 SHN CBB CAB sing N N 280 SHN O4B CEB doub N N 281 SHN CAB C3B sing N N 282 SHN O2C CEC doub N N 283 SHN CEB CDB sing N N 284 SHN CEB O3B sing N N 285 SHN CDB C2B sing N N 286 SHN C3B C2B sing N N 287 SHN C3B C4B sing N N 288 SHN CMB C2B sing N N 289 SHN O1C CEC sing N N 290 SHN CEC CDC sing N N 291 SHN C2B C1B sing N N 292 SHN C4B CHC doub Y N 293 SHN C4B NB sing Y N 294 SHN CHC C1C sing Y N 295 SHN CDC C2C sing N N 296 SHN C1B NB sing Y N 297 SHN C1B CHB doub Y N 298 SHN C1C C2C sing Y N 299 SHN C1C NC doub Y N 300 SHN C2C C3C doub Y N 301 SHN CHB C4A sing Y N 302 SHN NC C4C sing Y N 303 SHN C3C C4C sing Y N 304 SHN C3C CAC sing N N 305 SHN C4A NA doub Y N 306 SHN C4A C3A sing N N 307 SHN C4C CHD doub Y N 308 SHN O4A CEA doub N N 309 SHN O2A CCA doub N N 310 SHN CAC CBC sing N N 311 SHN NA C1A sing Y N 312 SHN CCA CBA sing N N 313 SHN CCA O1A sing N N 314 SHN CBA CAA sing N N 315 SHN CBC CCC sing N N 316 SHN C3A CAA sing N N 317 SHN C3A C2A sing N N 318 SHN CHD C1D sing Y N 319 SHN CEA CDA sing N N 320 SHN CEA O3A sing N N 321 SHN ND C1D sing Y N 322 SHN ND C4D sing Y N 323 SHN CDA C2A sing N N 324 SHN C1A C2A sing N N 325 SHN C1A CHA doub Y N 326 SHN C2A CMA sing N N 327 SHN CCC O4C doub N N 328 SHN CCC O3C sing N N 329 SHN C1D C2D doub Y N 330 SHN C4D CHA sing Y N 331 SHN C4D C3D doub Y N 332 SHN C2D C3D sing Y N 333 SHN C2D CAD sing N N 334 SHN C3D CDD sing N N 335 SHN CBD CAD sing N N 336 SHN CBD CCD sing N N 337 SHN O1D CCD doub N N 338 SHN CCD O2D sing N N 339 SHN CDD CED sing N N 340 SHN O3D CED doub N N 341 SHN CED O4D sing N N 342 SHN CMA H1 sing N N 343 SHN CMA H2 sing N N 344 SHN CMA H3 sing N N 345 SHN CMB H4 sing N N 346 SHN CMB H5 sing N N 347 SHN CMB H6 sing N N 348 SHN CAA H7 sing N N 349 SHN CAA H8 sing N N 350 SHN CAB H9 sing N N 351 SHN CAB H10 sing N N 352 SHN CAC H11 sing N N 353 SHN CAC H12 sing N N 354 SHN CAD H13 sing N N 355 SHN CAD H14 sing N N 356 SHN CBA H15 sing N N 357 SHN CBA H16 sing N N 358 SHN CBB H17 sing N N 359 SHN CBB H18 sing N N 360 SHN CBC H19 sing N N 361 SHN CBC H20 sing N N 362 SHN CBD H21 sing N N 363 SHN CBD H22 sing N N 364 SHN CDA H23 sing N N 365 SHN CDA H24 sing N N 366 SHN CDB H25 sing N N 367 SHN CDB H26 sing N N 368 SHN CDC H27 sing N N 369 SHN CDC H28 sing N N 370 SHN CDD H29 sing N N 371 SHN CDD H30 sing N N 372 SHN CHA H31 sing N N 373 SHN CHB H32 sing N N 374 SHN CHC H33 sing N N 375 SHN CHD H34 sing N N 376 SHN O1A H37 sing N N 377 SHN O1C H38 sing N N 378 SHN O2B H39 sing N N 379 SHN O2D H40 sing N N 380 SHN O3A H41 sing N N 381 SHN O3B H42 sing N N 382 SHN O3C H43 sing N N 383 SHN O4D H44 sing N N 384 SHN NB H45 sing N N 385 SHN ND H46 sing N N 386 SHN C3A H47 sing N N 387 SHN C3B H48 sing N N 388 THR N CA sing N N 389 THR N H sing N N 390 THR N H2 sing N N 391 THR CA C sing N N 392 THR CA CB sing N N 393 THR CA HA sing N N 394 THR C O doub N N 395 THR C OXT sing N N 396 THR CB OG1 sing N N 397 THR CB CG2 sing N N 398 THR CB HB sing N N 399 THR OG1 HG1 sing N N 400 THR CG2 HG21 sing N N 401 THR CG2 HG22 sing N N 402 THR CG2 HG23 sing N N 403 THR OXT HXT sing N N 404 TYR N CA sing N N 405 TYR N H sing N N 406 TYR N H2 sing N N 407 TYR CA C sing N N 408 TYR CA CB sing N N 409 TYR CA HA sing N N 410 TYR C O doub N N 411 TYR C OXT sing N N 412 TYR CB CG sing N N 413 TYR CB HB2 sing N N 414 TYR CB HB3 sing N N 415 TYR CG CD1 doub Y N 416 TYR CG CD2 sing Y N 417 TYR CD1 CE1 sing Y N 418 TYR CD1 HD1 sing N N 419 TYR CD2 CE2 doub Y N 420 TYR CD2 HD2 sing N N 421 TYR CE1 CZ doub Y N 422 TYR CE1 HE1 sing N N 423 TYR CE2 CZ sing Y N 424 TYR CE2 HE2 sing N N 425 TYR CZ OH sing N N 426 TYR OH HH sing N N 427 TYR OXT HXT sing N N 428 VAL N CA sing N N 429 VAL N H sing N N 430 VAL N H2 sing N N 431 VAL CA C sing N N 432 VAL CA CB sing N N 433 VAL CA HA sing N N 434 VAL C O doub N N 435 VAL C OXT sing N N 436 VAL CB CG1 sing N N 437 VAL CB CG2 sing N N 438 VAL CB HB sing N N 439 VAL CG1 HG11 sing N N 440 VAL CG1 HG12 sing N N 441 VAL CG1 HG13 sing N N 442 VAL CG2 HG21 sing N N 443 VAL CG2 HG22 sing N N 444 VAL CG2 HG23 sing N N 445 VAL OXT HXT sing N N 446 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 19H04639 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id SHN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id SHN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;3,3',3'',3'''-[(7S,8S,12S,13S)-3,8,13,17-tetrakis(carboxymethyl)-8,13-dimethyl-7,8,12,13-tetrahydroporphyrin-2,7,12,18-tetrayl]tetrapropanoic acid ; SHN 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2XWS _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #