data_6N34 # _entry.id 6N34 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6N34 pdb_00006n34 10.2210/pdb6n34/pdb WWPDB D_1000238084 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6N34 _pdbx_database_status.recvd_initial_deposition_date 2018-11-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhang, K.' 1 ? 'Shang, G.' 2 ? 'Padavannil, A.' 3 ? 'Fontoura, B.' 4 ? 'Chook, Y.M.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 115 _citation.language ? _citation.page_first E12218 _citation.page_last E12227 _citation.title ;Structural-functional interactions of NS1-BP protein with the splicing and mRNA export machineries for viral and host gene expression. ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1818012115 _citation.pdbx_database_id_PubMed 30538201 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, K.' 1 ? primary 'Shang, G.' 2 ? primary 'Padavannil, A.' 3 ? primary 'Wang, J.' 4 ? primary 'Sakthivel, R.' 5 ? primary 'Chen, X.' 6 ? primary 'Kim, M.' 7 ? primary 'Thompson, M.G.' 8 ? primary 'Garcia-Sastre, A.' 9 ? primary 'Lynch, K.W.' 10 ? primary 'Chen, Z.J.' 11 ? primary 'Chook, Y.M.' 12 ? primary 'Fontoura, B.M.A.' 13 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6N34 _cell.details ? _cell.formula_units_Z ? _cell.length_a 41.866 _cell.length_a_esd ? _cell.length_b 72.599 _cell.length_b_esd ? _cell.length_c 92.858 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6N34 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Influenza virus NS1A-binding protein' _entity.formula_weight 16583.996 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'NS1-binding protein,Aryl hydrocarbon receptor-associated protein 3,Kelch-like protein 39' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNP EAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQVCGDYLLSRMDVTSCISYLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNP EAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQVCGDYLLSRMDVTSCISYLEHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 PRO n 1 4 ASN n 1 5 GLY n 1 6 TYR n 1 7 LEU n 1 8 MET n 1 9 PHE n 1 10 GLU n 1 11 ASP n 1 12 GLU n 1 13 ASN n 1 14 PHE n 1 15 ILE n 1 16 GLU n 1 17 SER n 1 18 SER n 1 19 VAL n 1 20 ALA n 1 21 LYS n 1 22 LEU n 1 23 ASN n 1 24 ALA n 1 25 LEU n 1 26 ARG n 1 27 LYS n 1 28 SER n 1 29 GLY n 1 30 GLN n 1 31 PHE n 1 32 CYS n 1 33 ASP n 1 34 VAL n 1 35 ARG n 1 36 LEU n 1 37 GLN n 1 38 VAL n 1 39 CYS n 1 40 GLY n 1 41 HIS n 1 42 GLU n 1 43 MET n 1 44 LEU n 1 45 ALA n 1 46 HIS n 1 47 ARG n 1 48 ALA n 1 49 VAL n 1 50 LEU n 1 51 ALA n 1 52 CYS n 1 53 CYS n 1 54 SER n 1 55 PRO n 1 56 TYR n 1 57 LEU n 1 58 PHE n 1 59 GLU n 1 60 ILE n 1 61 PHE n 1 62 ASN n 1 63 SER n 1 64 ASP n 1 65 SER n 1 66 ASP n 1 67 PRO n 1 68 HIS n 1 69 GLY n 1 70 ILE n 1 71 SER n 1 72 HIS n 1 73 VAL n 1 74 LYS n 1 75 PHE n 1 76 ASP n 1 77 ASP n 1 78 LEU n 1 79 ASN n 1 80 PRO n 1 81 GLU n 1 82 ALA n 1 83 VAL n 1 84 GLU n 1 85 VAL n 1 86 LEU n 1 87 LEU n 1 88 ASN n 1 89 TYR n 1 90 ALA n 1 91 TYR n 1 92 THR n 1 93 ALA n 1 94 GLN n 1 95 LEU n 1 96 LYS n 1 97 ALA n 1 98 ASP n 1 99 LYS n 1 100 GLU n 1 101 LEU n 1 102 VAL n 1 103 LYS n 1 104 ASP n 1 105 VAL n 1 106 TYR n 1 107 SER n 1 108 ALA n 1 109 ALA n 1 110 LYS n 1 111 LYS n 1 112 LEU n 1 113 LYS n 1 114 MET n 1 115 ASP n 1 116 ARG n 1 117 VAL n 1 118 LYS n 1 119 GLN n 1 120 VAL n 1 121 CYS n 1 122 GLY n 1 123 ASP n 1 124 TYR n 1 125 LEU n 1 126 LEU n 1 127 SER n 1 128 ARG n 1 129 MET n 1 130 ASP n 1 131 VAL n 1 132 THR n 1 133 SER n 1 134 CYS n 1 135 ILE n 1 136 SER n 1 137 TYR n 1 138 LEU n 1 139 GLU n 1 140 HIS n 1 141 HIS n 1 142 HIS n 1 143 HIS n 1 144 HIS n 1 145 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 145 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'IVNS1ABP, ARA3, FLARA3, KIAA0850, KLHL39, NS1, NS1BP, HSPC068' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NS1BP_HUMAN _struct_ref.pdbx_db_accession Q9Y6Y0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNP EAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQVCGDYLLSRMDVTSCISY ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6N34 A 1 ? 137 ? Q9Y6Y0 1 ? 137 ? 1 137 2 1 6N34 B 1 ? 137 ? Q9Y6Y0 1 ? 137 ? 1 137 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6N34 LEU A 138 ? UNP Q9Y6Y0 ? ? 'expression tag' 138 1 1 6N34 GLU A 139 ? UNP Q9Y6Y0 ? ? 'expression tag' 139 2 1 6N34 HIS A 140 ? UNP Q9Y6Y0 ? ? 'expression tag' 140 3 1 6N34 HIS A 141 ? UNP Q9Y6Y0 ? ? 'expression tag' 141 4 1 6N34 HIS A 142 ? UNP Q9Y6Y0 ? ? 'expression tag' 142 5 1 6N34 HIS A 143 ? UNP Q9Y6Y0 ? ? 'expression tag' 143 6 1 6N34 HIS A 144 ? UNP Q9Y6Y0 ? ? 'expression tag' 144 7 1 6N34 HIS A 145 ? UNP Q9Y6Y0 ? ? 'expression tag' 145 8 2 6N34 LEU B 138 ? UNP Q9Y6Y0 ? ? 'expression tag' 138 9 2 6N34 GLU B 139 ? UNP Q9Y6Y0 ? ? 'expression tag' 139 10 2 6N34 HIS B 140 ? UNP Q9Y6Y0 ? ? 'expression tag' 140 11 2 6N34 HIS B 141 ? UNP Q9Y6Y0 ? ? 'expression tag' 141 12 2 6N34 HIS B 142 ? UNP Q9Y6Y0 ? ? 'expression tag' 142 13 2 6N34 HIS B 143 ? UNP Q9Y6Y0 ? ? 'expression tag' 143 14 2 6N34 HIS B 144 ? UNP Q9Y6Y0 ? ? 'expression tag' 144 15 2 6N34 HIS B 145 ? UNP Q9Y6Y0 ? ? 'expression tag' 145 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6N34 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.27 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.92 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Ammonium sulfate, 0.1 M Tris pH 8.5, 25% w/v Polyethylene glycol 3,350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-07-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6N34 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.800 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7423 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.400 _reflns.pdbx_Rmerge_I_obs 0.127 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.404 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.139 _reflns.pdbx_Rpim_I_all 0.057 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.800 2.850 ? ? ? ? ? ? 333 96.200 ? ? ? ? 0.743 ? ? ? ? ? ? ? ? 2.700 ? 0.733 ? ? 0.899 0.496 ? 1 1 0.553 ? 2.850 2.900 ? ? ? ? ? ? 358 96.800 ? ? ? ? 0.591 ? ? ? ? ? ? ? ? 3.100 ? 0.866 ? ? 0.704 0.374 ? 2 1 0.663 ? 2.900 2.960 ? ? ? ? ? ? 348 97.500 ? ? ? ? 0.527 ? ? ? ? ? ? ? ? 3.500 ? 0.780 ? ? 0.616 0.310 ? 3 1 0.774 ? 2.960 3.020 ? ? ? ? ? ? 376 97.200 ? ? ? ? 0.591 ? ? ? ? ? ? ? ? 3.900 ? 0.728 ? ? 0.682 0.331 ? 4 1 0.705 ? 3.020 3.080 ? ? ? ? ? ? 340 98.000 ? ? ? ? 0.809 ? ? ? ? ? ? ? ? 4.300 ? 0.835 ? ? 0.919 0.426 ? 5 1 0.702 ? 3.080 3.150 ? ? ? ? ? ? 364 98.100 ? ? ? ? 0.790 ? ? ? ? ? ? ? ? 4.700 ? 0.857 ? ? 0.887 0.395 ? 6 1 0.756 ? 3.150 3.230 ? ? ? ? ? ? 373 98.900 ? ? ? ? 0.583 ? ? ? ? ? ? ? ? 5.300 ? 0.847 ? ? 0.649 0.281 ? 7 1 0.842 ? 3.230 3.320 ? ? ? ? ? ? 353 97.800 ? ? ? ? 0.593 ? ? ? ? ? ? ? ? 5.600 ? 0.865 ? ? 0.657 0.276 ? 8 1 0.870 ? 3.320 3.420 ? ? ? ? ? ? 353 99.400 ? ? ? ? 0.522 ? ? ? ? ? ? ? ? 6.100 ? 1.009 ? ? 0.573 0.232 ? 9 1 0.904 ? 3.420 3.530 ? ? ? ? ? ? 384 99.200 ? ? ? ? 0.365 ? ? ? ? ? ? ? ? 6.100 ? 1.316 ? ? 0.401 0.163 ? 10 1 0.931 ? 3.530 3.650 ? ? ? ? ? ? 364 100.000 ? ? ? ? 0.580 ? ? ? ? ? ? ? ? 5.900 ? 1.968 ? ? 0.637 0.261 ? 11 1 0.913 ? 3.650 3.800 ? ? ? ? ? ? 374 100.000 ? ? ? ? 0.279 ? ? ? ? ? ? ? ? 6.100 ? 2.900 ? ? 0.306 0.124 ? 12 1 0.950 ? 3.800 3.970 ? ? ? ? ? ? 368 100.000 ? ? ? ? 0.189 ? ? ? ? ? ? ? ? 6.400 ? 1.540 ? ? 0.206 0.081 ? 13 1 0.978 ? 3.970 4.180 ? ? ? ? ? ? 383 100.000 ? ? ? ? 0.125 ? ? ? ? ? ? ? ? 6.600 ? 1.431 ? ? 0.136 0.053 ? 14 1 0.991 ? 4.180 4.440 ? ? ? ? ? ? 372 100.000 ? ? ? ? 0.099 ? ? ? ? ? ? ? ? 6.500 ? 1.630 ? ? 0.108 0.042 ? 15 1 0.993 ? 4.440 4.790 ? ? ? ? ? ? 377 100.000 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? 6.500 ? 1.406 ? ? 0.090 0.035 ? 16 1 0.996 ? 4.790 5.270 ? ? ? ? ? ? 391 100.000 ? ? ? ? 0.086 ? ? ? ? ? ? ? ? 6.300 ? 1.559 ? ? 0.093 0.037 ? 17 1 0.992 ? 5.270 6.030 ? ? ? ? ? ? 392 100.000 ? ? ? ? 0.091 ? ? ? ? ? ? ? ? 6.300 ? 1.637 ? ? 0.100 0.039 ? 18 1 0.993 ? 6.030 7.590 ? ? ? ? ? ? 381 100.000 ? ? ? ? 0.089 ? ? ? ? ? ? ? ? 6.000 ? 1.637 ? ? 0.098 0.040 ? 19 1 0.995 ? 7.590 50.000 ? ? ? ? ? ? 439 98.900 ? ? ? ? 0.099 ? ? ? ? ? ? ? ? 5.400 ? 1.482 ? ? 0.109 0.044 ? 20 1 0.997 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 180.570 _refine.B_iso_mean 98.1473 _refine.B_iso_min 62.890 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6N34 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8000 _refine.ls_d_res_low 38.1660 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7294 _refine.ls_number_reflns_R_free 730 _refine.ls_number_reflns_R_work 6564 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.8600 _refine.ls_percent_reflns_R_free 10.0100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2321 _refine.ls_R_factor_R_free 0.2974 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2249 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3I3N _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.5700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.8000 _refine_hist.d_res_low 38.1660 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1884 _refine_hist.pdbx_number_residues_total 238 _refine_hist.pdbx_number_atoms_protein 1884 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 1914 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.992 ? 2573 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.049 ? 289 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 328 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.790 ? 1165 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.8001 3.0162 1382 . 138 1244 97.0000 . . . 0.3884 0.0000 0.2928 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.0162 3.3196 1417 . 142 1275 98.0000 . . . 0.3773 0.0000 0.2769 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.3196 3.7996 1466 . 147 1319 99.0000 . . . 0.3882 0.0000 0.2715 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.7996 4.7856 1466 . 147 1319 100.0000 . . . 0.2674 0.0000 0.2015 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 4.7856 38.1697 1563 . 156 1407 100.0000 . . . 0.2604 0.0000 0.2069 . . . . . . 5 . . . # _struct.entry_id 6N34 _struct.title 'Crystal structure of the BTB domain of Human NS1-BP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6N34 _struct_keywords.text 'mRNA export, SPLICING' _struct_keywords.pdbx_keywords SPLICING # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 11 ? SER A 28 ? ASP A 11 SER A 28 1 ? 18 HELX_P HELX_P2 AA2 HIS A 46 ? CYS A 52 ? HIS A 46 CYS A 52 1 ? 7 HELX_P HELX_P3 AA3 SER A 54 ? PHE A 61 ? SER A 54 PHE A 61 1 ? 8 HELX_P HELX_P4 AA4 ASN A 79 ? ALA A 93 ? ASN A 79 ALA A 93 1 ? 15 HELX_P HELX_P5 AA5 ASP A 98 ? GLU A 100 ? ASP A 98 GLU A 100 5 ? 3 HELX_P HELX_P6 AA6 LEU A 101 ? LEU A 112 ? LEU A 101 LEU A 112 1 ? 12 HELX_P HELX_P7 AA7 MET A 114 ? SER A 127 ? MET A 114 SER A 127 1 ? 14 HELX_P HELX_P8 AA8 ASN B 13 ? GLY B 29 ? ASN B 13 GLY B 29 1 ? 17 HELX_P HELX_P9 AA9 HIS B 46 ? SER B 54 ? HIS B 46 SER B 54 1 ? 9 HELX_P HELX_P10 AB1 SER B 54 ? ASN B 62 ? SER B 54 ASN B 62 1 ? 9 HELX_P HELX_P11 AB2 ASN B 79 ? ALA B 93 ? ASN B 79 ALA B 93 1 ? 15 HELX_P HELX_P12 AB3 ASP B 98 ? GLU B 100 ? ASP B 98 GLU B 100 5 ? 3 HELX_P HELX_P13 AB4 LEU B 101 ? LYS B 113 ? LEU B 101 LYS B 113 1 ? 13 HELX_P HELX_P14 AB5 MET B 114 ? ARG B 128 ? MET B 114 ARG B 128 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? AA3 ? 2 ? AA4 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 7 ? GLU A 10 ? LEU A 7 GLU A 10 AA1 2 GLN B 94 ? ALA B 97 ? GLN B 94 ALA B 97 AA2 1 HIS A 41 ? ALA A 45 ? HIS A 41 ALA A 45 AA2 2 VAL A 34 ? VAL A 38 ? VAL A 34 VAL A 38 AA2 3 SER A 71 ? LYS A 74 ? SER A 71 LYS A 74 AA3 1 GLN A 94 ? ALA A 97 ? GLN A 94 ALA A 97 AA3 2 LEU B 7 ? GLU B 10 ? LEU B 7 GLU B 10 AA4 1 HIS B 41 ? ALA B 45 ? HIS B 41 ALA B 45 AA4 2 VAL B 34 ? VAL B 38 ? VAL B 34 VAL B 38 AA4 3 SER B 71 ? PHE B 75 ? SER B 71 PHE B 75 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 9 ? N PHE A 9 O LEU B 95 ? O LEU B 95 AA2 1 2 O MET A 43 ? O MET A 43 N LEU A 36 ? N LEU A 36 AA2 2 3 N GLN A 37 ? N GLN A 37 O VAL A 73 ? O VAL A 73 AA3 1 2 N LEU A 95 ? N LEU A 95 O PHE B 9 ? O PHE B 9 AA4 1 2 O MET B 43 ? O MET B 43 N LEU B 36 ? N LEU B 36 AA4 2 3 N GLN B 37 ? N GLN B 37 O PHE B 75 ? O PHE B 75 # _atom_sites.entry_id 6N34 _atom_sites.fract_transf_matrix[1][1] 0.023886 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013774 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010769 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ILE 2 2 ? ? ? A . n A 1 3 PRO 3 3 ? ? ? A . n A 1 4 ASN 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ASP 64 64 ? ? ? A . n A 1 65 SER 65 65 ? ? ? A . n A 1 66 ASP 66 66 ? ? ? A . n A 1 67 PRO 67 67 ? ? ? A . n A 1 68 HIS 68 68 ? ? ? A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 MET 114 114 114 MET MET A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 CYS 121 121 121 CYS CYS A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 MET 129 129 129 MET MET A . n A 1 130 ASP 130 130 ? ? ? A . n A 1 131 VAL 131 131 ? ? ? A . n A 1 132 THR 132 132 ? ? ? A . n A 1 133 SER 133 133 ? ? ? A . n A 1 134 CYS 134 134 ? ? ? A . n A 1 135 ILE 135 135 ? ? ? A . n A 1 136 SER 136 136 ? ? ? A . n A 1 137 TYR 137 137 ? ? ? A . n A 1 138 LEU 138 138 ? ? ? A . n A 1 139 GLU 139 139 ? ? ? A . n A 1 140 HIS 140 140 ? ? ? A . n A 1 141 HIS 141 141 ? ? ? A . n A 1 142 HIS 142 142 ? ? ? A . n A 1 143 HIS 143 143 ? ? ? A . n A 1 144 HIS 144 144 ? ? ? A . n A 1 145 HIS 145 145 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 ILE 2 2 ? ? ? B . n B 1 3 PRO 3 3 ? ? ? B . n B 1 4 ASN 4 4 4 ASN ASN B . n B 1 5 GLY 5 5 5 GLY GLY B . n B 1 6 TYR 6 6 6 TYR TYR B . n B 1 7 LEU 7 7 7 LEU LEU B . n B 1 8 MET 8 8 8 MET MET B . n B 1 9 PHE 9 9 9 PHE PHE B . n B 1 10 GLU 10 10 10 GLU GLU B . n B 1 11 ASP 11 11 11 ASP ASP B . n B 1 12 GLU 12 12 12 GLU GLU B . n B 1 13 ASN 13 13 13 ASN ASN B . n B 1 14 PHE 14 14 14 PHE PHE B . n B 1 15 ILE 15 15 15 ILE ILE B . n B 1 16 GLU 16 16 16 GLU GLU B . n B 1 17 SER 17 17 17 SER SER B . n B 1 18 SER 18 18 18 SER SER B . n B 1 19 VAL 19 19 19 VAL VAL B . n B 1 20 ALA 20 20 20 ALA ALA B . n B 1 21 LYS 21 21 21 LYS LYS B . n B 1 22 LEU 22 22 22 LEU LEU B . n B 1 23 ASN 23 23 23 ASN ASN B . n B 1 24 ALA 24 24 24 ALA ALA B . n B 1 25 LEU 25 25 25 LEU LEU B . n B 1 26 ARG 26 26 26 ARG ARG B . n B 1 27 LYS 27 27 27 LYS LYS B . n B 1 28 SER 28 28 28 SER SER B . n B 1 29 GLY 29 29 29 GLY GLY B . n B 1 30 GLN 30 30 30 GLN GLN B . n B 1 31 PHE 31 31 31 PHE PHE B . n B 1 32 CYS 32 32 32 CYS CYS B . n B 1 33 ASP 33 33 33 ASP ASP B . n B 1 34 VAL 34 34 34 VAL VAL B . n B 1 35 ARG 35 35 35 ARG ALA B . n B 1 36 LEU 36 36 36 LEU LEU B . n B 1 37 GLN 37 37 37 GLN GLN B . n B 1 38 VAL 38 38 38 VAL ALA B . n B 1 39 CYS 39 39 39 CYS CYS B . n B 1 40 GLY 40 40 40 GLY GLY B . n B 1 41 HIS 41 41 41 HIS HIS B . n B 1 42 GLU 42 42 42 GLU GLU B . n B 1 43 MET 43 43 43 MET MET B . n B 1 44 LEU 44 44 44 LEU LEU B . n B 1 45 ALA 45 45 45 ALA ALA B . n B 1 46 HIS 46 46 46 HIS HIS B . n B 1 47 ARG 47 47 47 ARG ARG B . n B 1 48 ALA 48 48 48 ALA ALA B . n B 1 49 VAL 49 49 49 VAL VAL B . n B 1 50 LEU 50 50 50 LEU LEU B . n B 1 51 ALA 51 51 51 ALA ALA B . n B 1 52 CYS 52 52 52 CYS CYS B . n B 1 53 CYS 53 53 53 CYS CYS B . n B 1 54 SER 54 54 54 SER SER B . n B 1 55 PRO 55 55 55 PRO PRO B . n B 1 56 TYR 56 56 56 TYR TYR B . n B 1 57 LEU 57 57 57 LEU LEU B . n B 1 58 PHE 58 58 58 PHE PHE B . n B 1 59 GLU 59 59 59 GLU GLU B . n B 1 60 ILE 60 60 60 ILE ILE B . n B 1 61 PHE 61 61 61 PHE PHE B . n B 1 62 ASN 62 62 62 ASN ASN B . n B 1 63 SER 63 63 63 SER SER B . n B 1 64 ASP 64 64 ? ? ? B . n B 1 65 SER 65 65 ? ? ? B . n B 1 66 ASP 66 66 ? ? ? B . n B 1 67 PRO 67 67 ? ? ? B . n B 1 68 HIS 68 68 ? ? ? B . n B 1 69 GLY 69 69 ? ? ? B . n B 1 70 ILE 70 70 70 ILE ILE B . n B 1 71 SER 71 71 71 SER SER B . n B 1 72 HIS 72 72 72 HIS HIS B . n B 1 73 VAL 73 73 73 VAL VAL B . n B 1 74 LYS 74 74 74 LYS ALA B . n B 1 75 PHE 75 75 75 PHE PHE B . n B 1 76 ASP 76 76 76 ASP ASP B . n B 1 77 ASP 77 77 77 ASP ASP B . n B 1 78 LEU 78 78 78 LEU LEU B . n B 1 79 ASN 79 79 79 ASN ASN B . n B 1 80 PRO 80 80 80 PRO PRO B . n B 1 81 GLU 81 81 81 GLU GLU B . n B 1 82 ALA 82 82 82 ALA ALA B . n B 1 83 VAL 83 83 83 VAL VAL B . n B 1 84 GLU 84 84 84 GLU GLU B . n B 1 85 VAL 85 85 85 VAL VAL B . n B 1 86 LEU 86 86 86 LEU LEU B . n B 1 87 LEU 87 87 87 LEU LEU B . n B 1 88 ASN 88 88 88 ASN ASN B . n B 1 89 TYR 89 89 89 TYR TYR B . n B 1 90 ALA 90 90 90 ALA ALA B . n B 1 91 TYR 91 91 91 TYR TYR B . n B 1 92 THR 92 92 92 THR THR B . n B 1 93 ALA 93 93 93 ALA ALA B . n B 1 94 GLN 94 94 94 GLN GLN B . n B 1 95 LEU 95 95 95 LEU LEU B . n B 1 96 LYS 96 96 96 LYS LYS B . n B 1 97 ALA 97 97 97 ALA ALA B . n B 1 98 ASP 98 98 98 ASP ASP B . n B 1 99 LYS 99 99 99 LYS LYS B . n B 1 100 GLU 100 100 100 GLU GLU B . n B 1 101 LEU 101 101 101 LEU LEU B . n B 1 102 VAL 102 102 102 VAL VAL B . n B 1 103 LYS 103 103 103 LYS LYS B . n B 1 104 ASP 104 104 104 ASP ASP B . n B 1 105 VAL 105 105 105 VAL VAL B . n B 1 106 TYR 106 106 106 TYR TYR B . n B 1 107 SER 107 107 107 SER SER B . n B 1 108 ALA 108 108 108 ALA ALA B . n B 1 109 ALA 109 109 109 ALA ALA B . n B 1 110 LYS 110 110 110 LYS LYS B . n B 1 111 LYS 111 111 111 LYS LYS B . n B 1 112 LEU 112 112 112 LEU LEU B . n B 1 113 LYS 113 113 113 LYS LYS B . n B 1 114 MET 114 114 114 MET MET B . n B 1 115 ASP 115 115 115 ASP ASP B . n B 1 116 ARG 116 116 116 ARG ARG B . n B 1 117 VAL 117 117 117 VAL VAL B . n B 1 118 LYS 118 118 118 LYS LYS B . n B 1 119 GLN 119 119 119 GLN GLN B . n B 1 120 VAL 120 120 120 VAL VAL B . n B 1 121 CYS 121 121 121 CYS CYS B . n B 1 122 GLY 122 122 122 GLY GLY B . n B 1 123 ASP 123 123 123 ASP ASP B . n B 1 124 TYR 124 124 124 TYR TYR B . n B 1 125 LEU 125 125 125 LEU LEU B . n B 1 126 LEU 126 126 126 LEU LEU B . n B 1 127 SER 127 127 127 SER SER B . n B 1 128 ARG 128 128 128 ARG ARG B . n B 1 129 MET 129 129 ? ? ? B . n B 1 130 ASP 130 130 ? ? ? B . n B 1 131 VAL 131 131 ? ? ? B . n B 1 132 THR 132 132 ? ? ? B . n B 1 133 SER 133 133 ? ? ? B . n B 1 134 CYS 134 134 ? ? ? B . n B 1 135 ILE 135 135 ? ? ? B . n B 1 136 SER 136 136 ? ? ? B . n B 1 137 TYR 137 137 ? ? ? B . n B 1 138 LEU 138 138 ? ? ? B . n B 1 139 GLU 139 139 ? ? ? B . n B 1 140 HIS 140 140 ? ? ? B . n B 1 141 HIS 141 141 ? ? ? B . n B 1 142 HIS 142 142 ? ? ? B . n B 1 143 HIS 143 143 ? ? ? B . n B 1 144 HIS 144 144 ? ? ? B . n B 1 145 HIS 145 145 ? ? ? B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3670 ? 1 MORE -37 ? 1 'SSA (A^2)' 12260 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-12-12 2 'Structure model' 1 1 2018-12-19 3 'Structure model' 1 2 2019-01-09 4 'Structure model' 1 3 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.name' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.page_first' 13 3 'Structure model' '_citation.page_last' 14 4 'Structure model' '_database_2.pdbx_DOI' 15 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 28.2763 51.3132 16.5788 0.7812 0.6633 0.9183 0.0075 0.0876 -0.0203 1.7366 3.0278 7.1138 -0.2512 1.5187 -2.7666 -0.2878 0.0683 0.0704 0.2366 -0.4185 -0.0489 0.4076 -0.4851 -0.0309 'X-RAY DIFFRACTION' 2 ? refined 37.1756 42.9038 36.2154 0.8162 0.7059 0.9399 0.1508 0.1865 -0.0217 3.3601 3.1819 6.0470 -2.6480 4.2780 -3.5359 -0.2268 0.3269 0.0420 -0.4420 -0.1129 -0.1457 0.4568 -0.6318 -0.3344 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 6 A 129 '(chain A and resseq 6:129)' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 B 4 B 128 '(chain B and resseq 4:128)' ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 6 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . 7 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 33 ? ? -141.63 11.27 2 1 PHE A 75 ? ? -134.46 -56.96 3 1 ASP A 76 ? ? 59.84 1.79 4 1 ARG A 128 ? ? -142.31 17.58 5 1 PHE B 31 ? ? 56.12 11.13 6 1 ASP B 77 ? ? -137.60 -31.86 7 1 ALA B 93 ? ? 54.17 15.25 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 B ARG 35 ? CG ? B ARG 35 CG 2 1 Y 1 B ARG 35 ? CD ? B ARG 35 CD 3 1 Y 1 B ARG 35 ? NE ? B ARG 35 NE 4 1 Y 1 B ARG 35 ? CZ ? B ARG 35 CZ 5 1 Y 1 B ARG 35 ? NH1 ? B ARG 35 NH1 6 1 Y 1 B ARG 35 ? NH2 ? B ARG 35 NH2 7 1 Y 1 B VAL 38 ? CG1 ? B VAL 38 CG1 8 1 Y 1 B VAL 38 ? CG2 ? B VAL 38 CG2 9 1 Y 1 B LYS 74 ? CG ? B LYS 74 CG 10 1 Y 1 B LYS 74 ? CD ? B LYS 74 CD 11 1 Y 1 B LYS 74 ? CE ? B LYS 74 CE 12 1 Y 1 B LYS 74 ? NZ ? B LYS 74 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ILE 2 ? A ILE 2 3 1 Y 1 A PRO 3 ? A PRO 3 4 1 Y 1 A ASN 4 ? A ASN 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A ASP 64 ? A ASP 64 7 1 Y 1 A SER 65 ? A SER 65 8 1 Y 1 A ASP 66 ? A ASP 66 9 1 Y 1 A PRO 67 ? A PRO 67 10 1 Y 1 A HIS 68 ? A HIS 68 11 1 Y 1 A ASP 130 ? A ASP 130 12 1 Y 1 A VAL 131 ? A VAL 131 13 1 Y 1 A THR 132 ? A THR 132 14 1 Y 1 A SER 133 ? A SER 133 15 1 Y 1 A CYS 134 ? A CYS 134 16 1 Y 1 A ILE 135 ? A ILE 135 17 1 Y 1 A SER 136 ? A SER 136 18 1 Y 1 A TYR 137 ? A TYR 137 19 1 Y 1 A LEU 138 ? A LEU 138 20 1 Y 1 A GLU 139 ? A GLU 139 21 1 Y 1 A HIS 140 ? A HIS 140 22 1 Y 1 A HIS 141 ? A HIS 141 23 1 Y 1 A HIS 142 ? A HIS 142 24 1 Y 1 A HIS 143 ? A HIS 143 25 1 Y 1 A HIS 144 ? A HIS 144 26 1 Y 1 A HIS 145 ? A HIS 145 27 1 Y 1 B MET 1 ? B MET 1 28 1 Y 1 B ILE 2 ? B ILE 2 29 1 Y 1 B PRO 3 ? B PRO 3 30 1 Y 1 B ASP 64 ? B ASP 64 31 1 Y 1 B SER 65 ? B SER 65 32 1 Y 1 B ASP 66 ? B ASP 66 33 1 Y 1 B PRO 67 ? B PRO 67 34 1 Y 1 B HIS 68 ? B HIS 68 35 1 Y 1 B GLY 69 ? B GLY 69 36 1 Y 1 B MET 129 ? B MET 129 37 1 Y 1 B ASP 130 ? B ASP 130 38 1 Y 1 B VAL 131 ? B VAL 131 39 1 Y 1 B THR 132 ? B THR 132 40 1 Y 1 B SER 133 ? B SER 133 41 1 Y 1 B CYS 134 ? B CYS 134 42 1 Y 1 B ILE 135 ? B ILE 135 43 1 Y 1 B SER 136 ? B SER 136 44 1 Y 1 B TYR 137 ? B TYR 137 45 1 Y 1 B LEU 138 ? B LEU 138 46 1 Y 1 B GLU 139 ? B GLU 139 47 1 Y 1 B HIS 140 ? B HIS 140 48 1 Y 1 B HIS 141 ? B HIS 141 49 1 Y 1 B HIS 142 ? B HIS 142 50 1 Y 1 B HIS 143 ? B HIS 143 51 1 Y 1 B HIS 144 ? B HIS 144 52 1 Y 1 B HIS 145 ? B HIS 145 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_audit_support.funding_organization 'Welch Foundation' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 1-1532 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3I3N _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #