data_6NBN # _entry.id 6NBN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6NBN pdb_00006nbn 10.2210/pdb6nbn/pdb WWPDB D_1000238162 ? ? BMRB 30550 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Structure of Aedes aegypti OBP22 in the complex with arachidonic acid' _pdbx_database_related.db_id 30550 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6NBN _pdbx_database_status.recvd_initial_deposition_date 2018-12-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jones, D.N.' 1 0000-0002-7586-3543 'Wang, J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 3300 _citation.page_last 3300 _citation.title 'Aedes aegypti Odorant Binding Protein 22 selectively binds fatty acids through a conformational change in its C-terminal tail.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-020-60242-9 _citation.pdbx_database_id_PubMed 32094450 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, J.' 1 ? primary 'Murphy, E.J.' 2 ? primary 'Nix, J.C.' 3 ? primary 'Jones, D.N.M.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6NBN _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6NBN _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man AAEL005772-PA 14400.319 1 ? ? ? ? 2 non-polymer syn 'ARACHIDONIC ACID' 304.467 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Odorant binding protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEFTVSTTEDLQRYRTECVSSLNIPADYVEKFKKWEFPEDDTTMCYIKCVFNKMQLFDDTEGPLVDNLVHQLAHGRDAEE VRTEVLKCVDKNTDNNACHWAFRGFKCFQKNNLSLIKASIKKD ; _entity_poly.pdbx_seq_one_letter_code_can ;MEFTVSTTEDLQRYRTECVSSLNIPADYVEKFKKWEFPEDDTTMCYIKCVFNKMQLFDDTEGPLVDNLVHQLAHGRDAEE VRTEVLKCVDKNTDNNACHWAFRGFKCFQKNNLSLIKASIKKD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 PHE n 1 4 THR n 1 5 VAL n 1 6 SER n 1 7 THR n 1 8 THR n 1 9 GLU n 1 10 ASP n 1 11 LEU n 1 12 GLN n 1 13 ARG n 1 14 TYR n 1 15 ARG n 1 16 THR n 1 17 GLU n 1 18 CYS n 1 19 VAL n 1 20 SER n 1 21 SER n 1 22 LEU n 1 23 ASN n 1 24 ILE n 1 25 PRO n 1 26 ALA n 1 27 ASP n 1 28 TYR n 1 29 VAL n 1 30 GLU n 1 31 LYS n 1 32 PHE n 1 33 LYS n 1 34 LYS n 1 35 TRP n 1 36 GLU n 1 37 PHE n 1 38 PRO n 1 39 GLU n 1 40 ASP n 1 41 ASP n 1 42 THR n 1 43 THR n 1 44 MET n 1 45 CYS n 1 46 TYR n 1 47 ILE n 1 48 LYS n 1 49 CYS n 1 50 VAL n 1 51 PHE n 1 52 ASN n 1 53 LYS n 1 54 MET n 1 55 GLN n 1 56 LEU n 1 57 PHE n 1 58 ASP n 1 59 ASP n 1 60 THR n 1 61 GLU n 1 62 GLY n 1 63 PRO n 1 64 LEU n 1 65 VAL n 1 66 ASP n 1 67 ASN n 1 68 LEU n 1 69 VAL n 1 70 HIS n 1 71 GLN n 1 72 LEU n 1 73 ALA n 1 74 HIS n 1 75 GLY n 1 76 ARG n 1 77 ASP n 1 78 ALA n 1 79 GLU n 1 80 GLU n 1 81 VAL n 1 82 ARG n 1 83 THR n 1 84 GLU n 1 85 VAL n 1 86 LEU n 1 87 LYS n 1 88 CYS n 1 89 VAL n 1 90 ASP n 1 91 LYS n 1 92 ASN n 1 93 THR n 1 94 ASP n 1 95 ASN n 1 96 ASN n 1 97 ALA n 1 98 CYS n 1 99 HIS n 1 100 TRP n 1 101 ALA n 1 102 PHE n 1 103 ARG n 1 104 GLY n 1 105 PHE n 1 106 LYS n 1 107 CYS n 1 108 PHE n 1 109 GLN n 1 110 LYS n 1 111 ASN n 1 112 ASN n 1 113 LEU n 1 114 SER n 1 115 LEU n 1 116 ILE n 1 117 LYS n 1 118 ALA n 1 119 SER n 1 120 ILE n 1 121 LYS n 1 122 LYS n 1 123 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 123 _entity_src_gen.gene_src_common_name 'Yellowfever mosquito' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene '5567053, AAEL005772' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue 'Antennal cDNA' _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aedes aegypti' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7159 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET1a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q1HRL7_AEDAE _struct_ref.pdbx_db_accession Q1HRL7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EFTVSTTEDLQRYRTECVSSLNIPADYVEKFKKWEFPEDDTTMCYIKCVFNKMQLFDDTEGPLVDNLVHQLAHGRDAEEV RTEVLKCVDKNTDNNACHWAFRGFKCFQKNNLSLIKASIKKD ; _struct_ref.pdbx_align_begin 17 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6NBN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 123 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q1HRL7 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 138 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 123 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6NBN _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q1HRL7 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACD non-polymer . 'ARACHIDONIC ACID' ? 'C20 H32 O2' 304.467 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 17 2 2 '2D (HB)CB(CGCD)HD' 1 isotropic 4 1 1 '3D HNCACB' 2 isotropic 5 1 1 '3D CBCA(CO)NH' 2 isotropic 6 1 1 '3D C(CO)NH' 2 isotropic 10 1 1 '3D HBHA(CO)NH' 2 isotropic 9 1 1 '3D HNCO' 2 isotropic 8 1 1 '3D (HACA)CO(CA)NH' 2 isotropic 7 1 1 '3D 13C/15N- NOESY-HSQC' 1 isotropic 13 1 1 '3D 13C/15N-NOESY-HSQC (AROMATIC)' 1 isotropic 12 2 2 '3D 12C-filtered-13C/15N-editedNOESY-HSQC' 1 isotropic 11 2 2 '2D 12C-filtered-1H-1H-NOESY' 1 isotropic 15 2 2 '2D 12C-filterd-1H-1H-TOCSY' 1 isotropic 14 2 2 '3D HAHB' 1 isotropic 16 2 2 '2D (HB)CB(CGCDCE)HE' 1 isotropic 18 2 2 '3D 1H-13C NOESY aromatic' 1 isotropic # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 mbar 820 6.5 20 ? 0.2 mM H2O_Sample 0.1 pH 10 1 K 2 298 mbar 820 6.1 20 ? 0.2 mM D2O_Sample 0.05 pD 5 1 K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '650 uM [U-13C; U-15N] OBP22, 650 uM ARACHIDONIC ACID, 20 mM sodium phosphate, 90% H2O/10% D2O' '90% H2O/10% D2O' '15N/C13 H2O' solution ? 2 ;670 uM [U-95% 13C; U-98% 15N] Aedes aegypti odorant binding protein 22, 670 uM ARACHIDONIC ACID, 20 mM sodium phosphate, 99% D2O/1 % H2O ; '99% D2O/1 % H2O' '15N/C13 D2O' solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 DD2 ? Varian 900 ? 2 INOVA ? Varian 600 ? # _pdbx_nmr_refine.entry_id 6NBN _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;Structure were determined using the unambiguous assignment protocol in Aria2 using a final total of 2381 restraint of which 1998 were NOE based ; _pdbx_nmr_refine.software_ordinal 3 # _pdbx_nmr_ensemble.entry_id 6NBN _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria 'NOE violation energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6NBN _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria medoid # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' Analysis 2.4.2 CCPN 5 'structure calculation' ARIA 2.3.2 ;Linge, O'Donoghue and Nilges ; 3 'structure calculation' CNS 1.2 'Brunger, Adams, Clore, Gros, Nilges and Read' 4 'peak picking' Analysis 2.4.2 CCPN # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6NBN _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6NBN _struct.title 'Structure of Aedes aegypti OBP22 in the complex with arachidonic acid' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6NBN _struct_keywords.text 'Odorant binding protein Chemo-sensory signaling Lipid binding, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 7 ? LEU A 22 ? THR A 7 LEU A 22 1 ? 16 HELX_P HELX_P2 AA2 PRO A 25 ? LYS A 34 ? PRO A 25 LYS A 34 1 ? 10 HELX_P HELX_P3 AA3 ASP A 40 ? MET A 54 ? ASP A 40 MET A 54 1 ? 15 HELX_P HELX_P4 AA4 LEU A 64 ? ALA A 73 ? LEU A 64 ALA A 73 1 ? 10 HELX_P HELX_P5 AA5 ASP A 77 ? VAL A 89 ? ASP A 77 VAL A 89 1 ? 13 HELX_P HELX_P6 AA6 ASN A 96 ? ASN A 112 ? ASN A 96 ASN A 112 1 ? 17 HELX_P HELX_P7 AA7 LEU A 113 ? ILE A 120 ? LEU A 113 ILE A 120 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 18 A CYS 49 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf2 disulf ? ? A CYS 45 SG ? ? ? 1_555 A CYS 98 SG ? ? A CYS 45 A CYS 98 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf3 disulf ? ? A CYS 88 SG ? ? ? 1_555 A CYS 107 SG ? ? A CYS 88 A CYS 107 1_555 ? ? ? ? ? ? ? 2.035 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 57 ? ASP A 58 ? PHE A 57 ASP A 58 AA1 2 GLY A 62 ? PRO A 63 ? GLY A 62 PRO A 63 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ASP _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 58 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ASP _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 58 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLY _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 62 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 62 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ACD _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 17 _struct_site.details 'binding site for residue ACD A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 17 LEU A 11 ? LEU A 11 . ? 1_555 ? 2 AC1 17 ARG A 15 ? ARG A 15 . ? 1_555 ? 3 AC1 17 PHE A 32 ? PHE A 32 . ? 1_555 ? 4 AC1 17 PHE A 37 ? PHE A 37 . ? 1_555 ? 5 AC1 17 TYR A 46 ? TYR A 46 . ? 1_555 ? 6 AC1 17 PHE A 51 ? PHE A 51 . ? 1_555 ? 7 AC1 17 LEU A 56 ? LEU A 56 . ? 1_555 ? 8 AC1 17 PRO A 63 ? PRO A 63 . ? 1_555 ? 9 AC1 17 LEU A 68 ? LEU A 68 . ? 1_555 ? 10 AC1 17 LEU A 72 ? LEU A 72 . ? 1_555 ? 11 AC1 17 CYS A 88 ? CYS A 88 . ? 1_555 ? 12 AC1 17 VAL A 89 ? VAL A 89 . ? 1_555 ? 13 AC1 17 GLY A 104 ? GLY A 104 . ? 1_555 ? 14 AC1 17 PHE A 105 ? PHE A 105 . ? 1_555 ? 15 AC1 17 PHE A 108 ? PHE A 108 . ? 1_555 ? 16 AC1 17 ILE A 116 ? ILE A 116 . ? 1_555 ? 17 AC1 17 ILE A 120 ? ILE A 120 . ? 1_555 ? # _database_PDB_matrix.entry_id 6NBN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 6NBN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 TRP 100 100 100 TRP TRP A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 CYS 107 107 107 CYS CYS A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 ASP 123 123 123 ASP ASP A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ACD _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id ACD _pdbx_nonpoly_scheme.auth_mon_id ACD _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-12-19 2 'Structure model' 1 1 2019-12-18 3 'Structure model' 1 2 2020-05-06 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_CSD' 5 3 'Structure model' '_citation.journal_id_ISSN' 6 3 'Structure model' '_citation.journal_volume' 7 3 'Structure model' '_citation.page_first' 8 3 'Structure model' '_citation.page_last' 9 3 'Structure model' '_citation.pdbx_database_id_DOI' 10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 11 3 'Structure model' '_citation.title' 12 3 'Structure model' '_citation.year' 13 4 'Structure model' '_database_2.pdbx_DOI' 14 4 'Structure model' '_database_2.pdbx_database_accession' 15 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 OBP22 650 ? uM '[U-13C; U-15N]' 1 'ARACHIDONIC ACID' 650 ? uM 'natural abundance' 1 'sodium phosphate' 20 ? mM 'natural abundance' 2 'Aedes aegypti odorant binding protein 22' 670 ? uM '[U-95% 13C; U-98% 15N]' 2 'ARACHIDONIC ACID' 670 ? uM 'natural abundance' 2 'sodium phosphate' 20 ? mM 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 OD2 A ASP 94 ? ? HH21 A ARG 103 ? ? 1.59 2 2 HZ1 A LYS 48 ? ? OD2 A ASP 59 ? ? 1.60 3 3 OE2 A GLU 17 ? ? HZ1 A LYS 53 ? ? 1.58 4 5 HE A ARG 15 ? ? O1 A ACD 201 ? ? 1.52 5 7 OE1 A GLU 17 ? ? HZ1 A LYS 53 ? ? 1.55 6 8 HG1 A THR 7 ? ? OD1 A ASP 10 ? ? 1.59 7 13 OD2 A ASP 94 ? ? HD1 A HIS 99 ? ? 1.56 8 13 OD2 A ASP 94 ? ? HH21 A ARG 103 ? ? 1.59 9 15 HG1 A THR 7 ? ? OD2 A ASP 10 ? ? 1.59 10 22 HG1 A THR 7 ? ? OD1 A ASP 10 ? ? 1.59 11 24 OD1 A ASP 94 ? ? HH21 A ARG 103 ? ? 1.58 12 25 HG1 A THR 7 ? ? OD1 A ASP 10 ? ? 1.59 13 27 HZ3 A LYS 48 ? ? OD2 A ASP 59 ? ? 1.59 14 28 HH A TYR 46 ? ? O2 A ACD 201 ? ? 1.56 15 28 OD1 A ASP 94 ? ? HH22 A ARG 103 ? ? 1.59 16 29 OD2 A ASP 94 ? ? HH12 A ARG 103 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 60 ? ? -101.10 -63.82 2 1 ALA A 73 ? ? -71.18 33.20 3 2 THR A 60 ? ? -97.90 -64.03 4 2 ALA A 73 ? ? -85.45 32.74 5 2 ASP A 77 ? ? -63.44 92.30 6 3 THR A 60 ? ? -106.43 -62.01 7 3 GLN A 71 ? ? -90.25 -60.64 8 3 ALA A 73 ? ? -74.22 34.27 9 3 HIS A 74 ? ? -64.07 89.01 10 3 ASP A 77 ? ? -59.91 104.60 11 4 GLU A 2 ? ? -166.27 109.06 12 4 THR A 60 ? ? -99.68 -61.55 13 4 ALA A 73 ? ? -72.83 33.07 14 5 GLU A 2 ? ? 66.79 108.01 15 5 THR A 60 ? ? -99.46 -63.17 16 5 GLN A 71 ? ? -90.42 -60.22 17 5 ALA A 73 ? ? -73.56 33.83 18 6 THR A 60 ? ? -101.83 -65.09 19 6 GLN A 71 ? ? -90.28 -60.41 20 6 ALA A 73 ? ? -73.91 26.66 21 7 THR A 60 ? ? -95.71 -64.07 22 7 ALA A 73 ? ? -72.71 34.54 23 7 HIS A 74 ? ? -65.86 90.87 24 7 ASP A 77 ? ? -59.04 105.10 25 8 GLU A 2 ? ? 55.25 77.86 26 8 THR A 60 ? ? -99.33 -63.99 27 8 ALA A 73 ? ? -73.31 33.82 28 8 LYS A 122 ? ? 71.33 137.60 29 9 THR A 60 ? ? -102.58 -65.69 30 9 ALA A 73 ? ? -75.56 32.71 31 10 THR A 60 ? ? -121.79 -57.04 32 10 GLN A 71 ? ? -90.60 -60.82 33 10 ALA A 73 ? ? -73.15 34.00 34 10 HIS A 74 ? ? -62.38 89.81 35 10 ASP A 77 ? ? -57.97 101.47 36 11 SER A 6 ? ? -67.54 95.14 37 11 THR A 60 ? ? -99.28 -65.76 38 11 ALA A 73 ? ? -74.25 34.60 39 11 HIS A 74 ? ? -66.35 85.77 40 12 THR A 60 ? ? -99.11 -64.16 41 12 GLN A 71 ? ? -91.16 -60.71 42 12 ALA A 73 ? ? -69.94 34.00 43 13 ALA A 73 ? ? -74.83 33.57 44 13 ASP A 77 ? ? -58.47 105.59 45 14 GLU A 2 ? ? -112.93 57.26 46 14 ALA A 73 ? ? -76.95 32.92 47 14 HIS A 74 ? ? -68.30 89.74 48 15 ALA A 73 ? ? -74.76 34.06 49 15 HIS A 74 ? ? -69.98 84.32 50 16 THR A 60 ? ? -97.13 -62.20 51 16 ALA A 73 ? ? -74.76 32.67 52 16 HIS A 74 ? ? -69.45 92.26 53 16 ASP A 77 ? ? -57.87 109.69 54 17 THR A 60 ? ? -100.23 -65.76 55 17 GLN A 71 ? ? -90.37 -60.13 56 17 ALA A 73 ? ? -72.38 33.41 57 17 LYS A 122 ? ? 69.93 140.41 58 18 THR A 60 ? ? -103.57 -66.08 59 18 ALA A 73 ? ? -72.22 32.84 60 18 LYS A 122 ? ? -112.95 68.94 61 19 THR A 60 ? ? -95.93 -64.26 62 19 GLN A 71 ? ? -90.48 -60.44 63 19 ALA A 73 ? ? -72.75 33.20 64 20 THR A 60 ? ? -106.08 -62.41 65 20 ALA A 73 ? ? -73.62 32.52 66 21 THR A 60 ? ? -99.44 -63.87 67 21 ALA A 73 ? ? -74.65 32.86 68 21 HIS A 74 ? ? -68.94 89.50 69 21 LYS A 122 ? ? 67.58 141.69 70 22 THR A 60 ? ? -96.49 -64.02 71 22 ALA A 73 ? ? -75.84 32.94 72 22 HIS A 74 ? ? -68.86 99.71 73 23 SER A 6 ? ? -69.75 93.68 74 23 THR A 60 ? ? -91.28 -64.90 75 23 ALA A 73 ? ? -79.00 26.70 76 24 GLU A 2 ? ? 65.90 65.61 77 24 GLU A 39 ? ? -69.51 89.51 78 24 THR A 60 ? ? -94.36 -65.12 79 24 GLN A 71 ? ? -90.19 -60.92 80 24 ALA A 73 ? ? -71.83 35.93 81 24 HIS A 74 ? ? -64.03 82.80 82 24 ASP A 77 ? ? -59.89 102.58 83 24 LYS A 122 ? ? 70.61 169.26 84 25 THR A 60 ? ? -93.58 -65.68 85 25 ALA A 73 ? ? -73.72 35.18 86 25 HIS A 74 ? ? -61.66 88.68 87 25 ASP A 77 ? ? -58.19 105.66 88 26 THR A 60 ? ? -98.55 -62.12 89 26 ALA A 73 ? ? -77.74 33.91 90 27 ALA A 73 ? ? -72.69 33.40 91 27 LYS A 122 ? ? -114.87 78.81 92 28 GLU A 2 ? ? 63.55 84.34 93 28 THR A 60 ? ? -103.56 -60.37 94 28 ALA A 73 ? ? -81.22 33.68 95 29 THR A 60 ? ? -100.36 -62.48 96 29 GLN A 71 ? ? -90.49 -60.35 97 29 ALA A 73 ? ? -73.76 33.77 98 30 THR A 60 ? ? -103.50 -63.14 99 30 ALA A 73 ? ? -75.11 34.20 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number AI121253 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ARACHIDONIC ACID' _pdbx_entity_nonpoly.comp_id ACD # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details 'Fluorescence competition binding assays and NMR titrations support binding of lipid to protein' #