data_6NJF # _entry.id 6NJF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6NJF pdb_00006njf 10.2210/pdb6njf/pdb WWPDB D_1000238540 ? ? BMRB 30532 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 30532 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6NJF _pdbx_database_status.recvd_initial_deposition_date 2019-01-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Damry, A.M.' 1 ? 'Mayer, M.M.' 2 ? 'Goto, N.K.' 3 ? 'Chica, R.A.' 4 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? UK ? ? primary 'Commun Biol' ? ? 2399-3642 ? ? 2 ? 433 433 'Origin of conformational dynamics in a globular protein.' 2019 ? 10.1038/s42003-019-0681-2 31799435 ? ? ? ? ? ? ? ? US ? ? 1 Biorxiv ? ? 2692-8205 ? ? ? ? ? ? 'Origin of Conformational Dynamics in a Globular Protein' 2019 ? 10.1101/724286 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Damry, A.M.' 1 ? primary 'Mayer, M.M.' 2 ? primary 'Broom, A.' 3 ? primary 'Goto, N.K.' 4 ? primary 'Chica, R.A.' 5 ? 1 'Damry, A.M.' 6 ? 1 'Mayer, M.M.' 7 ? 1 'Broom, A.' 8 ? 1 'Goto, N.K.' 9 ? 1 'Chica, R.A.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Immunoglobulin G-binding protein G' _entity.formula_weight 7230.964 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'Y3F, V7I, V39L, V54I' _entity.pdbx_fragment 'residues 373-427' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'IgG-binding protein G' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MHHHHHHGMTFKLIINGKTLKGETTTEAVDAATAEKVFKQYANDNGLDGEWTYDDATKTFTITE _entity_poly.pdbx_seq_one_letter_code_can MHHHHHHGMTFKLIINGKTLKGETTTEAVDAATAEKVFKQYANDNGLDGEWTYDDATKTFTITE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 GLY n 1 9 MET n 1 10 THR n 1 11 PHE n 1 12 LYS n 1 13 LEU n 1 14 ILE n 1 15 ILE n 1 16 ASN n 1 17 GLY n 1 18 LYS n 1 19 THR n 1 20 LEU n 1 21 LYS n 1 22 GLY n 1 23 GLU n 1 24 THR n 1 25 THR n 1 26 THR n 1 27 GLU n 1 28 ALA n 1 29 VAL n 1 30 ASP n 1 31 ALA n 1 32 ALA n 1 33 THR n 1 34 ALA n 1 35 GLU n 1 36 LYS n 1 37 VAL n 1 38 PHE n 1 39 LYS n 1 40 GLN n 1 41 TYR n 1 42 ALA n 1 43 ASN n 1 44 ASP n 1 45 ASN n 1 46 GLY n 1 47 LEU n 1 48 ASP n 1 49 GLY n 1 50 GLU n 1 51 TRP n 1 52 THR n 1 53 TYR n 1 54 ASP n 1 55 ASP n 1 56 ALA n 1 57 THR n 1 58 LYS n 1 59 THR n 1 60 PHE n 1 61 THR n 1 62 ILE n 1 63 THR n 1 64 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 64 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene spg _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus sp. group G' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1320 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-Gold(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SPG2_STRSG _struct_ref.pdbx_db_accession P19909 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE _struct_ref.pdbx_align_begin 373 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6NJF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 10 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P19909 _struct_ref_seq.db_align_beg 373 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 427 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 10 _struct_ref_seq.pdbx_auth_seq_align_end 64 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6NJF MET A 1 ? UNP P19909 ? ? 'initiating methionine' 1 1 1 6NJF HIS A 2 ? UNP P19909 ? ? 'expression tag' 2 2 1 6NJF HIS A 3 ? UNP P19909 ? ? 'expression tag' 3 3 1 6NJF HIS A 4 ? UNP P19909 ? ? 'expression tag' 4 4 1 6NJF HIS A 5 ? UNP P19909 ? ? 'expression tag' 5 5 1 6NJF HIS A 6 ? UNP P19909 ? ? 'expression tag' 6 6 1 6NJF HIS A 7 ? UNP P19909 ? ? 'expression tag' 7 7 1 6NJF GLY A 8 ? UNP P19909 ? ? 'expression tag' 8 8 1 6NJF MET A 9 ? UNP P19909 ? ? 'expression tag' 9 9 1 6NJF PHE A 11 ? UNP P19909 TYR 374 'engineered mutation' 11 10 1 6NJF ILE A 14 ? UNP P19909 VAL 377 'engineered mutation' 14 11 1 6NJF LEU A 47 ? UNP P19909 VAL 410 'engineered mutation' 47 12 1 6NJF ILE A 62 ? UNP P19909 VAL 425 'engineered mutation' 62 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-15N NOESY' 1 isotropic 2 1 3 '3D 1H-13C NOESY aliphatic' 1 isotropic 3 1 3 '3D 1H-13C NOESY aromatic' 1 isotropic 4 1 2 '3D HNCACB' 1 isotropic 5 1 2 '3D CBCA(CO)NH' 1 isotropic 6 1 2 '3D HNCO' 1 isotropic 7 1 3 '3D CCH-TOCSY' 1 isotropic 8 1 3 '3D HCCH-TOCSY' 1 isotropic 9 1 3 '3D HCCH-COSY' 1 isotropic 10 1 1 '3D 1H-15N TOCSY' 1 isotropic 11 1 1 '2D 1H-15N HSQC' 1 isotropic 12 1 2 '2D 1H-13C HSQC' 1 isotropic 13 1 3 '2D 1H-13C HSQC' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength '10 mM sodium phosphate' _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '1.0 mM [U-98% 15N] protein (GB1), 10 mM sodium phosphate, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_Sample solution ? 2 '1.0 mM [U-99% 13C; U-98% 15N] protein (GB1), 10 mM sodium phosphate, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C/15N_Sample_H2O solution ? 3 '1.0 mM [U-99% 13C; U-98% 15N] protein (GB1), 10 mM sodium phosphate, 100% D2O' '100% D2O' 13C/15N_Sample_D2O solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6NJF _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6NJF _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6NJF _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' NMRView ? 'Johnson, One Moon Scientific' 4 'peak picking' NMRView ? 'Johnson, One Moon Scientific' 5 collection TopSpin ? 'Bruker Biospin' 6 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6NJF _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6NJF _struct.title 'Solution NMR Structure of DANCER3-F34A, a rigid and natively folded single mutant of the dynamic protein DANCER-3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6NJF _struct_keywords.text 'dynamics, computational design, conformational exchange, immunoglobulin-binding, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 30 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 46 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 30 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 46 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 22 ? GLU A 27 ? GLY A 22 GLU A 27 AA1 2 THR A 10 ? ASN A 16 ? THR A 10 ASN A 16 AA1 3 THR A 59 ? THR A 63 ? THR A 59 THR A 63 AA1 4 GLU A 50 ? ASP A 54 ? GLU A 50 ASP A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 26 ? O THR A 26 N PHE A 11 ? N PHE A 11 AA1 2 3 N ILE A 14 ? N ILE A 14 O PHE A 60 ? O PHE A 60 AA1 3 4 O THR A 61 ? O THR A 61 N THR A 52 ? N THR A 52 # _atom_sites.entry_id 6NJF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 HIS 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 GLY 8 8 ? ? ? A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 GLU 64 64 64 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3980 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-08-21 2 'Structure model' 1 1 2019-12-04 3 'Structure model' 1 2 2019-12-18 4 'Structure model' 1 3 2020-01-08 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 5 'Structure model' 'Database references' 5 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' pdbx_audit_support 5 5 'Structure model' citation 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.page_first' 2 3 'Structure model' '_citation.page_last' 3 3 'Structure model' '_citation.pdbx_database_id_PubMed' 4 3 'Structure model' '_citation.title' 5 4 'Structure model' '_pdbx_audit_support.funding_organization' 6 5 'Structure model' '_citation.journal_id_ISSN' 7 5 'Structure model' '_database_2.pdbx_DOI' 8 5 'Structure model' '_database_2.pdbx_database_accession' 9 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'protein (GB1)' 1.0 ? mM '[U-98% 15N]' 1 'sodium phosphate' 10 ? mM 'natural abundance' 2 'protein (GB1)' 1.0 ? mM '[U-99% 13C; U-98% 15N]' 2 'sodium phosphate' 10 ? mM 'natural abundance' 3 'protein (GB1)' 1.0 ? mM '[U-99% 13C; U-98% 15N]' 3 'sodium phosphate' 10 ? mM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 ASP A 48 ? ? -162.34 107.30 2 6 GLU A 23 ? ? -170.19 149.19 3 8 ASP A 48 ? ? -166.37 106.20 4 9 LYS A 18 ? ? -90.57 -60.06 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A HIS 2 ? A HIS 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A GLY 8 ? A GLY 8 9 2 Y 1 A MET 1 ? A MET 1 10 2 Y 1 A HIS 2 ? A HIS 2 11 2 Y 1 A HIS 3 ? A HIS 3 12 2 Y 1 A HIS 4 ? A HIS 4 13 2 Y 1 A HIS 5 ? A HIS 5 14 2 Y 1 A HIS 6 ? A HIS 6 15 2 Y 1 A HIS 7 ? A HIS 7 16 2 Y 1 A GLY 8 ? A GLY 8 17 3 Y 1 A MET 1 ? A MET 1 18 3 Y 1 A HIS 2 ? A HIS 2 19 3 Y 1 A HIS 3 ? A HIS 3 20 3 Y 1 A HIS 4 ? A HIS 4 21 3 Y 1 A HIS 5 ? A HIS 5 22 3 Y 1 A HIS 6 ? A HIS 6 23 3 Y 1 A HIS 7 ? A HIS 7 24 3 Y 1 A GLY 8 ? A GLY 8 25 4 Y 1 A MET 1 ? A MET 1 26 4 Y 1 A HIS 2 ? A HIS 2 27 4 Y 1 A HIS 3 ? A HIS 3 28 4 Y 1 A HIS 4 ? A HIS 4 29 4 Y 1 A HIS 5 ? A HIS 5 30 4 Y 1 A HIS 6 ? A HIS 6 31 4 Y 1 A HIS 7 ? A HIS 7 32 4 Y 1 A GLY 8 ? A GLY 8 33 5 Y 1 A MET 1 ? A MET 1 34 5 Y 1 A HIS 2 ? A HIS 2 35 5 Y 1 A HIS 3 ? A HIS 3 36 5 Y 1 A HIS 4 ? A HIS 4 37 5 Y 1 A HIS 5 ? A HIS 5 38 5 Y 1 A HIS 6 ? A HIS 6 39 5 Y 1 A HIS 7 ? A HIS 7 40 5 Y 1 A GLY 8 ? A GLY 8 41 6 Y 1 A MET 1 ? A MET 1 42 6 Y 1 A HIS 2 ? A HIS 2 43 6 Y 1 A HIS 3 ? A HIS 3 44 6 Y 1 A HIS 4 ? A HIS 4 45 6 Y 1 A HIS 5 ? A HIS 5 46 6 Y 1 A HIS 6 ? A HIS 6 47 6 Y 1 A HIS 7 ? A HIS 7 48 6 Y 1 A GLY 8 ? A GLY 8 49 7 Y 1 A MET 1 ? A MET 1 50 7 Y 1 A HIS 2 ? A HIS 2 51 7 Y 1 A HIS 3 ? A HIS 3 52 7 Y 1 A HIS 4 ? A HIS 4 53 7 Y 1 A HIS 5 ? A HIS 5 54 7 Y 1 A HIS 6 ? A HIS 6 55 7 Y 1 A HIS 7 ? A HIS 7 56 7 Y 1 A GLY 8 ? A GLY 8 57 8 Y 1 A MET 1 ? A MET 1 58 8 Y 1 A HIS 2 ? A HIS 2 59 8 Y 1 A HIS 3 ? A HIS 3 60 8 Y 1 A HIS 4 ? A HIS 4 61 8 Y 1 A HIS 5 ? A HIS 5 62 8 Y 1 A HIS 6 ? A HIS 6 63 8 Y 1 A HIS 7 ? A HIS 7 64 8 Y 1 A GLY 8 ? A GLY 8 65 9 Y 1 A MET 1 ? A MET 1 66 9 Y 1 A HIS 2 ? A HIS 2 67 9 Y 1 A HIS 3 ? A HIS 3 68 9 Y 1 A HIS 4 ? A HIS 4 69 9 Y 1 A HIS 5 ? A HIS 5 70 9 Y 1 A HIS 6 ? A HIS 6 71 9 Y 1 A HIS 7 ? A HIS 7 72 9 Y 1 A GLY 8 ? A GLY 8 73 10 Y 1 A MET 1 ? A MET 1 74 10 Y 1 A HIS 2 ? A HIS 2 75 10 Y 1 A HIS 3 ? A HIS 3 76 10 Y 1 A HIS 4 ? A HIS 4 77 10 Y 1 A HIS 5 ? A HIS 5 78 10 Y 1 A HIS 6 ? A HIS 6 79 10 Y 1 A HIS 7 ? A HIS 7 80 10 Y 1 A GLY 8 ? A GLY 8 # _pdbx_audit_support.funding_organization 'Natural Sciences and Engineering Research Council (NSERC, Canada)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number RGPIN-2016-04831 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #