data_6NW4 # _entry.id 6NW4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6NW4 pdb_00006nw4 10.2210/pdb6nw4/pdb WWPDB D_1000239564 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-07-24 2 'Structure model' 1 1 2019-08-07 3 'Structure model' 1 2 2019-11-20 4 'Structure model' 1 3 2020-04-22 5 'Structure model' 1 4 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Database references' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_database_status 4 4 'Structure model' pdbx_related_exp_data_set 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 2 'Structure model' '_citation_author.name' 7 3 'Structure model' '_pdbx_database_status.process_site' 8 5 'Structure model' '_database_2.pdbx_DOI' 9 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6NW4 _pdbx_database_status.recvd_initial_deposition_date 2019-02-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bunzel, A.' 1 ? 'Mittl, P.' 2 ? 'Hilvert, D.' 3 0000-0002-3941-621X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 141 _citation.language ? _citation.page_first 11745 _citation.page_last 11748 _citation.title 'Emergence of a Negative Activation Heat Capacity during Evolution of a Designed Enzyme.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.9b02731 _citation.pdbx_database_id_PubMed 31282667 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bunzel, H.A.' 1 0000-0001-6427-368X primary 'Kries, H.' 2 0000-0002-4919-2811 primary 'Marchetti, L.' 3 ? primary 'Zeymer, C.' 4 0000-0001-7138-381X primary 'Mittl, P.R.E.' 5 ? primary 'Mulholland, A.J.' 6 0000-0003-1015-4567 primary 'Hilvert, D.' 7 0000-0002-3941-621X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Indole-3-glycerol phosphate synthase' 28523.930 1 4.1.1.48 ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 4 ? ? ? ? 3 non-polymer syn 6-NITROBENZOTRIAZOLE 164.122 1 ? ? ? ? 4 water nat water 18.015 21 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name IGPS # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PRYLKGWLKDVVQLSLRRPSFRASRQRPIISLNERILEFNKRNITAIIAAYRRKSPCGLDVERDPIEYSKFMERYAVGLA IATEEKYFNGSYETLRKIASSVSIPILMWDFIVKESQIDDAYNLGADTVALIVKILTERELESLLEYARSYGMEPYIVIN DENDLDIALRIGARFIEICSRDFETLEINKENQRKLISMIPSNVVKVAWGGISERNEIEELRKLGVNAFGIGSSLMRNPE KIKEFIL ; _entity_poly.pdbx_seq_one_letter_code_can ;PRYLKGWLKDVVQLSLRRPSFRASRQRPIISLNERILEFNKRNITAIIAAYRRKSPCGLDVERDPIEYSKFMERYAVGLA IATEEKYFNGSYETLRKIASSVSIPILMWDFIVKESQIDDAYNLGADTVALIVKILTERELESLLEYARSYGMEPYIVIN DENDLDIALRIGARFIEICSRDFETLEINKENQRKLISMIPSNVVKVAWGGISERNEIEELRKLGVNAFGIGSSLMRNPE KIKEFIL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 6-NITROBENZOTRIAZOLE 6NT 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 ARG n 1 3 TYR n 1 4 LEU n 1 5 LYS n 1 6 GLY n 1 7 TRP n 1 8 LEU n 1 9 LYS n 1 10 ASP n 1 11 VAL n 1 12 VAL n 1 13 GLN n 1 14 LEU n 1 15 SER n 1 16 LEU n 1 17 ARG n 1 18 ARG n 1 19 PRO n 1 20 SER n 1 21 PHE n 1 22 ARG n 1 23 ALA n 1 24 SER n 1 25 ARG n 1 26 GLN n 1 27 ARG n 1 28 PRO n 1 29 ILE n 1 30 ILE n 1 31 SER n 1 32 LEU n 1 33 ASN n 1 34 GLU n 1 35 ARG n 1 36 ILE n 1 37 LEU n 1 38 GLU n 1 39 PHE n 1 40 ASN n 1 41 LYS n 1 42 ARG n 1 43 ASN n 1 44 ILE n 1 45 THR n 1 46 ALA n 1 47 ILE n 1 48 ILE n 1 49 ALA n 1 50 ALA n 1 51 TYR n 1 52 ARG n 1 53 ARG n 1 54 LYS n 1 55 SER n 1 56 PRO n 1 57 CYS n 1 58 GLY n 1 59 LEU n 1 60 ASP n 1 61 VAL n 1 62 GLU n 1 63 ARG n 1 64 ASP n 1 65 PRO n 1 66 ILE n 1 67 GLU n 1 68 TYR n 1 69 SER n 1 70 LYS n 1 71 PHE n 1 72 MET n 1 73 GLU n 1 74 ARG n 1 75 TYR n 1 76 ALA n 1 77 VAL n 1 78 GLY n 1 79 LEU n 1 80 ALA n 1 81 ILE n 1 82 ALA n 1 83 THR n 1 84 GLU n 1 85 GLU n 1 86 LYS n 1 87 TYR n 1 88 PHE n 1 89 ASN n 1 90 GLY n 1 91 SER n 1 92 TYR n 1 93 GLU n 1 94 THR n 1 95 LEU n 1 96 ARG n 1 97 LYS n 1 98 ILE n 1 99 ALA n 1 100 SER n 1 101 SER n 1 102 VAL n 1 103 SER n 1 104 ILE n 1 105 PRO n 1 106 ILE n 1 107 LEU n 1 108 MET n 1 109 TRP n 1 110 ASP n 1 111 PHE n 1 112 ILE n 1 113 VAL n 1 114 LYS n 1 115 GLU n 1 116 SER n 1 117 GLN n 1 118 ILE n 1 119 ASP n 1 120 ASP n 1 121 ALA n 1 122 TYR n 1 123 ASN n 1 124 LEU n 1 125 GLY n 1 126 ALA n 1 127 ASP n 1 128 THR n 1 129 VAL n 1 130 ALA n 1 131 LEU n 1 132 ILE n 1 133 VAL n 1 134 LYS n 1 135 ILE n 1 136 LEU n 1 137 THR n 1 138 GLU n 1 139 ARG n 1 140 GLU n 1 141 LEU n 1 142 GLU n 1 143 SER n 1 144 LEU n 1 145 LEU n 1 146 GLU n 1 147 TYR n 1 148 ALA n 1 149 ARG n 1 150 SER n 1 151 TYR n 1 152 GLY n 1 153 MET n 1 154 GLU n 1 155 PRO n 1 156 TYR n 1 157 ILE n 1 158 VAL n 1 159 ILE n 1 160 ASN n 1 161 ASP n 1 162 GLU n 1 163 ASN n 1 164 ASP n 1 165 LEU n 1 166 ASP n 1 167 ILE n 1 168 ALA n 1 169 LEU n 1 170 ARG n 1 171 ILE n 1 172 GLY n 1 173 ALA n 1 174 ARG n 1 175 PHE n 1 176 ILE n 1 177 GLU n 1 178 ILE n 1 179 CYS n 1 180 SER n 1 181 ARG n 1 182 ASP n 1 183 PHE n 1 184 GLU n 1 185 THR n 1 186 LEU n 1 187 GLU n 1 188 ILE n 1 189 ASN n 1 190 LYS n 1 191 GLU n 1 192 ASN n 1 193 GLN n 1 194 ARG n 1 195 LYS n 1 196 LEU n 1 197 ILE n 1 198 SER n 1 199 MET n 1 200 ILE n 1 201 PRO n 1 202 SER n 1 203 ASN n 1 204 VAL n 1 205 VAL n 1 206 LYS n 1 207 VAL n 1 208 ALA n 1 209 TRP n 1 210 GLY n 1 211 GLY n 1 212 ILE n 1 213 SER n 1 214 GLU n 1 215 ARG n 1 216 ASN n 1 217 GLU n 1 218 ILE n 1 219 GLU n 1 220 GLU n 1 221 LEU n 1 222 ARG n 1 223 LYS n 1 224 LEU n 1 225 GLY n 1 226 VAL n 1 227 ASN n 1 228 ALA n 1 229 PHE n 1 230 GLY n 1 231 ILE n 1 232 GLY n 1 233 SER n 1 234 SER n 1 235 LEU n 1 236 MET n 1 237 ARG n 1 238 ASN n 1 239 PRO n 1 240 GLU n 1 241 LYS n 1 242 ILE n 1 243 LYS n 1 244 GLU n 1 245 PHE n 1 246 ILE n 1 247 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 247 _entity_src_gen.gene_src_common_name 'Sulfolobus solfataricus' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'trpC, SSO0895' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 35092 / DSM 1617 / JCM 11322 / P2' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 273057 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 6NT non-polymer . 6-NITROBENZOTRIAZOLE ? 'C6 H4 N4 O2' 164.122 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 2 2 PRO PRO A . n A 1 2 ARG 2 3 3 ARG ARG A . n A 1 3 TYR 3 4 4 TYR TYR A . n A 1 4 LEU 4 5 5 LEU LEU A . n A 1 5 LYS 5 6 6 LYS LYS A . n A 1 6 GLY 6 7 7 GLY GLY A . n A 1 7 TRP 7 8 8 TRP TRP A . n A 1 8 LEU 8 9 9 LEU LEU A . n A 1 9 LYS 9 10 10 LYS LYS A . n A 1 10 ASP 10 11 11 ASP ASP A . n A 1 11 VAL 11 12 12 VAL VAL A . n A 1 12 VAL 12 13 13 VAL VAL A . n A 1 13 GLN 13 14 14 GLN GLN A . n A 1 14 LEU 14 15 15 LEU LEU A . n A 1 15 SER 15 16 16 SER SER A . n A 1 16 LEU 16 17 17 LEU LEU A . n A 1 17 ARG 17 18 18 ARG ARG A . n A 1 18 ARG 18 19 19 ARG ARG A . n A 1 19 PRO 19 20 20 PRO PRO A . n A 1 20 SER 20 21 21 SER SER A . n A 1 21 PHE 21 22 22 PHE PHE A . n A 1 22 ARG 22 23 23 ARG ARG A . n A 1 23 ALA 23 24 24 ALA ALA A . n A 1 24 SER 24 25 25 SER SER A . n A 1 25 ARG 25 26 26 ARG ARG A . n A 1 26 GLN 26 27 27 GLN GLN A . n A 1 27 ARG 27 28 28 ARG ARG A . n A 1 28 PRO 28 29 29 PRO PRO A . n A 1 29 ILE 29 30 30 ILE ILE A . n A 1 30 ILE 30 31 31 ILE ILE A . n A 1 31 SER 31 32 32 SER SER A . n A 1 32 LEU 32 33 33 LEU LEU A . n A 1 33 ASN 33 34 34 ASN ASN A . n A 1 34 GLU 34 35 35 GLU GLU A . n A 1 35 ARG 35 36 36 ARG ARG A . n A 1 36 ILE 36 37 37 ILE ILE A . n A 1 37 LEU 37 38 38 LEU LEU A . n A 1 38 GLU 38 39 39 GLU GLU A . n A 1 39 PHE 39 40 40 PHE PHE A . n A 1 40 ASN 40 41 41 ASN ASN A . n A 1 41 LYS 41 42 42 LYS LYS A . n A 1 42 ARG 42 43 43 ARG ARG A . n A 1 43 ASN 43 44 44 ASN ASN A . n A 1 44 ILE 44 45 45 ILE ILE A . n A 1 45 THR 45 46 46 THR THR A . n A 1 46 ALA 46 47 47 ALA ALA A . n A 1 47 ILE 47 48 48 ILE ILE A . n A 1 48 ILE 48 49 49 ILE ILE A . n A 1 49 ALA 49 50 50 ALA ALA A . n A 1 50 ALA 50 51 51 ALA ALA A . n A 1 51 TYR 51 52 52 TYR TYR A . n A 1 52 ARG 52 53 53 ARG ARG A . n A 1 53 ARG 53 54 54 ARG ARG A . n A 1 54 LYS 54 55 55 LYS LYS A . n A 1 55 SER 55 56 56 SER SER A . n A 1 56 PRO 56 57 57 PRO PRO A . n A 1 57 CYS 57 58 58 CYS CYS A . n A 1 58 GLY 58 59 59 GLY GLY A . n A 1 59 LEU 59 60 60 LEU LEU A . n A 1 60 ASP 60 61 61 ASP ASP A . n A 1 61 VAL 61 62 62 VAL VAL A . n A 1 62 GLU 62 63 63 GLU GLU A . n A 1 63 ARG 63 64 64 ARG ARG A . n A 1 64 ASP 64 65 65 ASP ASP A . n A 1 65 PRO 65 66 66 PRO PRO A . n A 1 66 ILE 66 67 67 ILE ILE A . n A 1 67 GLU 67 68 68 GLU GLU A . n A 1 68 TYR 68 69 69 TYR TYR A . n A 1 69 SER 69 70 70 SER SER A . n A 1 70 LYS 70 71 71 LYS LYS A . n A 1 71 PHE 71 72 72 PHE PHE A . n A 1 72 MET 72 73 73 MET MET A . n A 1 73 GLU 73 74 74 GLU GLU A . n A 1 74 ARG 74 75 75 ARG ARG A . n A 1 75 TYR 75 76 76 TYR TYR A . n A 1 76 ALA 76 77 77 ALA ALA A . n A 1 77 VAL 77 78 78 VAL VAL A . n A 1 78 GLY 78 79 79 GLY GLY A . n A 1 79 LEU 79 80 80 LEU LEU A . n A 1 80 ALA 80 81 81 ALA ALA A . n A 1 81 ILE 81 82 82 ILE ILE A . n A 1 82 ALA 82 83 83 ALA ALA A . n A 1 83 THR 83 84 84 THR THR A . n A 1 84 GLU 84 85 85 GLU GLU A . n A 1 85 GLU 85 86 86 GLU GLU A . n A 1 86 LYS 86 87 87 LYS LYS A . n A 1 87 TYR 87 88 88 TYR TYR A . n A 1 88 PHE 88 89 89 PHE PHE A . n A 1 89 ASN 89 90 90 ASN ASN A . n A 1 90 GLY 90 91 91 GLY GLY A . n A 1 91 SER 91 92 92 SER SER A . n A 1 92 TYR 92 93 93 TYR TYR A . n A 1 93 GLU 93 94 94 GLU GLU A . n A 1 94 THR 94 95 95 THR THR A . n A 1 95 LEU 95 96 96 LEU LEU A . n A 1 96 ARG 96 97 97 ARG ARG A . n A 1 97 LYS 97 98 98 LYS LYS A . n A 1 98 ILE 98 99 99 ILE ILE A . n A 1 99 ALA 99 100 100 ALA ALA A . n A 1 100 SER 100 101 101 SER SER A . n A 1 101 SER 101 102 102 SER SER A . n A 1 102 VAL 102 103 103 VAL VAL A . n A 1 103 SER 103 104 104 SER SER A . n A 1 104 ILE 104 105 105 ILE ILE A . n A 1 105 PRO 105 106 106 PRO PRO A . n A 1 106 ILE 106 107 107 ILE ILE A . n A 1 107 LEU 107 108 108 LEU LEU A . n A 1 108 MET 108 109 109 MET MET A . n A 1 109 TRP 109 110 110 TRP TRP A . n A 1 110 ASP 110 111 111 ASP ASP A . n A 1 111 PHE 111 112 112 PHE PHE A . n A 1 112 ILE 112 113 113 ILE ILE A . n A 1 113 VAL 113 114 114 VAL VAL A . n A 1 114 LYS 114 115 115 LYS LYS A . n A 1 115 GLU 115 116 116 GLU GLU A . n A 1 116 SER 116 117 117 SER SER A . n A 1 117 GLN 117 118 118 GLN GLN A . n A 1 118 ILE 118 119 119 ILE ILE A . n A 1 119 ASP 119 120 120 ASP ASP A . n A 1 120 ASP 120 121 121 ASP ASP A . n A 1 121 ALA 121 122 122 ALA ALA A . n A 1 122 TYR 122 123 123 TYR TYR A . n A 1 123 ASN 123 124 124 ASN ASN A . n A 1 124 LEU 124 125 125 LEU LEU A . n A 1 125 GLY 125 126 126 GLY GLY A . n A 1 126 ALA 126 127 127 ALA ALA A . n A 1 127 ASP 127 128 128 ASP ASP A . n A 1 128 THR 128 129 129 THR THR A . n A 1 129 VAL 129 130 130 VAL VAL A . n A 1 130 ALA 130 131 131 ALA ALA A . n A 1 131 LEU 131 132 132 LEU LEU A . n A 1 132 ILE 132 133 133 ILE ILE A . n A 1 133 VAL 133 134 134 VAL VAL A . n A 1 134 LYS 134 135 135 LYS LYS A . n A 1 135 ILE 135 136 136 ILE ILE A . n A 1 136 LEU 136 137 137 LEU LEU A . n A 1 137 THR 137 138 138 THR THR A . n A 1 138 GLU 138 139 139 GLU GLU A . n A 1 139 ARG 139 140 140 ARG ARG A . n A 1 140 GLU 140 141 141 GLU GLU A . n A 1 141 LEU 141 142 142 LEU LEU A . n A 1 142 GLU 142 143 143 GLU GLU A . n A 1 143 SER 143 144 144 SER SER A . n A 1 144 LEU 144 145 145 LEU LEU A . n A 1 145 LEU 145 146 146 LEU LEU A . n A 1 146 GLU 146 147 147 GLU GLU A . n A 1 147 TYR 147 148 148 TYR TYR A . n A 1 148 ALA 148 149 149 ALA ALA A . n A 1 149 ARG 149 150 150 ARG ARG A . n A 1 150 SER 150 151 151 SER SER A . n A 1 151 TYR 151 152 152 TYR TYR A . n A 1 152 GLY 152 153 153 GLY GLY A . n A 1 153 MET 153 154 154 MET MET A . n A 1 154 GLU 154 155 155 GLU GLU A . n A 1 155 PRO 155 156 156 PRO PRO A . n A 1 156 TYR 156 157 157 TYR TYR A . n A 1 157 ILE 157 158 158 ILE ILE A . n A 1 158 VAL 158 159 159 VAL VAL A . n A 1 159 ILE 159 160 160 ILE ILE A . n A 1 160 ASN 160 161 161 ASN ASN A . n A 1 161 ASP 161 162 162 ASP ASP A . n A 1 162 GLU 162 163 163 GLU GLU A . n A 1 163 ASN 163 164 164 ASN ASN A . n A 1 164 ASP 164 165 165 ASP ASP A . n A 1 165 LEU 165 166 166 LEU LEU A . n A 1 166 ASP 166 167 167 ASP ASP A . n A 1 167 ILE 167 168 168 ILE ILE A . n A 1 168 ALA 168 169 169 ALA ALA A . n A 1 169 LEU 169 170 170 LEU LEU A . n A 1 170 ARG 170 171 171 ARG ARG A . n A 1 171 ILE 171 172 172 ILE ILE A . n A 1 172 GLY 172 173 173 GLY GLY A . n A 1 173 ALA 173 174 174 ALA ALA A . n A 1 174 ARG 174 175 175 ARG ARG A . n A 1 175 PHE 175 176 176 PHE PHE A . n A 1 176 ILE 176 177 177 ILE ILE A . n A 1 177 GLU 177 178 178 GLU GLU A . n A 1 178 ILE 178 179 179 ILE ILE A . n A 1 179 CYS 179 180 180 CYS CYS A . n A 1 180 SER 180 181 181 SER SER A . n A 1 181 ARG 181 182 182 ARG ARG A . n A 1 182 ASP 182 183 183 ASP ASP A . n A 1 183 PHE 183 184 184 PHE PHE A . n A 1 184 GLU 184 185 185 GLU GLU A . n A 1 185 THR 185 186 186 THR THR A . n A 1 186 LEU 186 187 187 LEU LEU A . n A 1 187 GLU 187 188 188 GLU GLU A . n A 1 188 ILE 188 189 189 ILE ILE A . n A 1 189 ASN 189 190 190 ASN ASN A . n A 1 190 LYS 190 191 191 LYS LYS A . n A 1 191 GLU 191 192 192 GLU GLU A . n A 1 192 ASN 192 193 193 ASN ASN A . n A 1 193 GLN 193 194 194 GLN GLN A . n A 1 194 ARG 194 195 195 ARG ARG A . n A 1 195 LYS 195 196 196 LYS LYS A . n A 1 196 LEU 196 197 197 LEU LEU A . n A 1 197 ILE 197 198 198 ILE ILE A . n A 1 198 SER 198 199 199 SER SER A . n A 1 199 MET 199 200 200 MET MET A . n A 1 200 ILE 200 201 201 ILE ILE A . n A 1 201 PRO 201 202 202 PRO PRO A . n A 1 202 SER 202 203 203 SER SER A . n A 1 203 ASN 203 204 204 ASN ASN A . n A 1 204 VAL 204 205 205 VAL VAL A . n A 1 205 VAL 205 206 206 VAL VAL A . n A 1 206 LYS 206 207 207 LYS LYS A . n A 1 207 VAL 207 208 208 VAL VAL A . n A 1 208 ALA 208 209 209 ALA ALA A . n A 1 209 TRP 209 210 210 TRP TRP A . n A 1 210 GLY 210 211 211 GLY GLY A . n A 1 211 GLY 211 212 212 GLY GLY A . n A 1 212 ILE 212 213 213 ILE ILE A . n A 1 213 SER 213 214 214 SER SER A . n A 1 214 GLU 214 215 215 GLU GLU A . n A 1 215 ARG 215 216 216 ARG ARG A . n A 1 216 ASN 216 217 217 ASN ASN A . n A 1 217 GLU 217 218 218 GLU GLU A . n A 1 218 ILE 218 219 219 ILE ILE A . n A 1 219 GLU 219 220 220 GLU GLU A . n A 1 220 GLU 220 221 221 GLU GLU A . n A 1 221 LEU 221 222 222 LEU LEU A . n A 1 222 ARG 222 223 223 ARG ARG A . n A 1 223 LYS 223 224 224 LYS LYS A . n A 1 224 LEU 224 225 225 LEU LEU A . n A 1 225 GLY 225 226 226 GLY GLY A . n A 1 226 VAL 226 227 227 VAL VAL A . n A 1 227 ASN 227 228 228 ASN ASN A . n A 1 228 ALA 228 229 229 ALA ALA A . n A 1 229 PHE 229 230 230 PHE PHE A . n A 1 230 GLY 230 231 231 GLY GLY A . n A 1 231 ILE 231 232 232 ILE ILE A . n A 1 232 GLY 232 233 233 GLY GLY A . n A 1 233 SER 233 234 234 SER SER A . n A 1 234 SER 234 235 235 SER SER A . n A 1 235 LEU 235 236 236 LEU LEU A . n A 1 236 MET 236 237 237 MET MET A . n A 1 237 ARG 237 238 238 ARG ARG A . n A 1 238 ASN 238 239 239 ASN ASN A . n A 1 239 PRO 239 240 240 PRO PRO A . n A 1 240 GLU 240 241 241 GLU GLU A . n A 1 241 LYS 241 242 242 LYS LYS A . n A 1 242 ILE 242 243 243 ILE ILE A . n A 1 243 LYS 243 244 244 LYS LYS A . n A 1 244 GLU 244 245 245 GLU GLU A . n A 1 245 PHE 245 246 246 PHE PHE A . n A 1 246 ILE 246 247 247 ILE ILE A . n A 1 247 LEU 247 248 248 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 301 1 SO4 SO4 A . C 2 SO4 1 302 2 SO4 SO4 A . D 2 SO4 1 303 3 SO4 SO4 A . E 2 SO4 1 304 4 SO4 SO4 A . F 3 6NT 1 305 1 6NT 6NT A . G 4 HOH 1 401 22 HOH HOH A . G 4 HOH 2 402 9 HOH HOH A . G 4 HOH 3 403 6 HOH HOH A . G 4 HOH 4 404 24 HOH HOH A . G 4 HOH 5 405 13 HOH HOH A . G 4 HOH 6 406 4 HOH HOH A . G 4 HOH 7 407 26 HOH HOH A . G 4 HOH 8 408 25 HOH HOH A . G 4 HOH 9 409 2 HOH HOH A . G 4 HOH 10 410 3 HOH HOH A . G 4 HOH 11 411 23 HOH HOH A . G 4 HOH 12 412 1 HOH HOH A . G 4 HOH 13 413 15 HOH HOH A . G 4 HOH 14 414 17 HOH HOH A . G 4 HOH 15 415 21 HOH HOH A . G 4 HOH 16 416 16 HOH HOH A . G 4 HOH 17 417 14 HOH HOH A . G 4 HOH 18 418 5 HOH HOH A . G 4 HOH 19 419 11 HOH HOH A . G 4 HOH 20 420 20 HOH HOH A . G 4 HOH 21 421 18 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.3 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6NW4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 61.304 _cell.length_a_esd ? _cell.length_b 61.304 _cell.length_b_esd ? _cell.length_c 121.278 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6NW4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6NW4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.31 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.67 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M sodium citrate, 20 mM sodium sulfate, 43% v/v PEG 300, pH 5.6' _exptl_crystal_grow.pdbx_pH_range '4.2 - 6.0' # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-06-26 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06DA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06DA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 74.220 _reflns.entry_id 6NW4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.000 _reflns.d_resolution_low 48.630 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5650 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.626 _reflns.pdbx_Rmerge_I_obs 0.413 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.090 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.710 _reflns.pdbx_scaling_rejects 9 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.437 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 54388 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 3.000 3.100 ? 1.410 ? ? ? ? 520 100.000 ? ? ? ? 2.123 ? ? ? ? ? ? ? ? 10.265 ? ? ? ? 2.234 ? ? 1 1 0.731 ? 3.100 3.200 ? 1.640 ? ? ? ? 446 99.800 ? ? ? ? 1.859 ? ? ? ? ? ? ? ? 10.213 ? ? ? ? 1.956 ? ? 2 1 0.745 ? 3.200 3.300 ? 1.910 ? ? ? ? 406 100.000 ? ? ? ? 1.479 ? ? ? ? ? ? ? ? 10.155 ? ? ? ? 1.558 ? ? 3 1 0.789 ? 3.300 3.500 ? 2.440 ? ? ? ? 667 99.900 ? ? ? ? 1.091 ? ? ? ? ? ? ? ? 10.025 ? ? ? ? 1.150 ? ? 4 1 0.879 ? 3.500 4.000 ? 3.750 ? ? ? ? 1150 99.800 ? ? ? ? 0.625 ? ? ? ? ? ? ? ? 9.658 ? ? ? ? 0.660 ? ? 5 1 0.962 ? 4.000 4.500 ? 6.110 ? ? ? ? 714 99.400 ? ? ? ? 0.318 ? ? ? ? ? ? ? ? 8.915 ? ? ? ? 0.338 ? ? 6 1 0.981 ? 4.500 5.000 ? 7.730 ? ? ? ? 444 100.000 ? ? ? ? 0.261 ? ? ? ? ? ? ? ? 9.955 ? ? ? ? 0.275 ? ? 7 1 0.985 ? 5.000 6.000 ? 7.510 ? ? ? ? 532 99.600 ? ? ? ? 0.263 ? ? ? ? ? ? ? ? 9.707 ? ? ? ? 0.278 ? ? 8 1 0.978 ? 6.000 7.000 ? 8.330 ? ? ? ? 273 100.000 ? ? ? ? 0.202 ? ? ? ? ? ? ? ? 9.238 ? ? ? ? 0.214 ? ? 9 1 0.989 ? 7.000 8.000 ? 11.040 ? ? ? ? 154 100.000 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 7.968 ? ? ? ? 0.125 ? ? 10 1 0.992 ? 8.000 10.000 ? 13.320 ? ? ? ? 160 99.400 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 8.188 ? ? ? ? 0.125 ? ? 11 1 0.994 ? 10.000 48.630 ? 14.600 ? ? ? ? 184 99.500 ? ? ? ? 0.102 ? ? ? ? ? ? ? ? 8.533 ? ? ? ? 0.109 ? ? 12 1 0.999 ? # _refine.aniso_B[1][1] -15.5199 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -15.5199 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 31.0398 _refine.B_iso_max 153.160 _refine.B_iso_mean 64.5200 _refine.B_iso_min 22.180 _refine.correlation_coeff_Fo_to_Fc 0.8900 _refine.correlation_coeff_Fo_to_Fc_free 0.7800 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6NW4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.0000 _refine.ls_d_res_low 48.6300 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5651 _refine.ls_number_reflns_R_free 296 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8000 _refine.ls_percent_reflns_R_free 5.2400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1920 _refine.ls_R_factor_R_free 0.2950 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1870 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3NZ1 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI 0.5360 _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 6NW4 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.350 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 3.0000 _refine_hist.d_res_low 48.6300 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.number_atoms_solvent 21 _refine_hist.number_atoms_total 2058 _refine_hist.pdbx_number_residues_total 247 _refine_hist.pdbx_B_iso_mean_ligand 88.51 _refine_hist.pdbx_B_iso_mean_solvent 40.62 _refine_hist.pdbx_number_atoms_protein 2005 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 757 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_trig_c_planes ? ? 'X-RAY DIFFRACTION' ? ? ? 345 ? t_gen_planes 5.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 2067 ? t_it 20.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 270 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 2513 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.010 ? 2067 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 1.160 ? 2787 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 2.730 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 21.860 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.0000 _refine_ls_shell.d_res_low 3.0800 _refine_ls_shell.number_reflns_all 404 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 25 _refine_ls_shell.number_reflns_R_work 379 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free 6.1900 _refine_ls_shell.R_factor_all 0.2300 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2595 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2279 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 14 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6NW4 _struct.title 'Evolution of a computationally designed Kemp eliminase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6NW4 _struct_keywords.text 'Kemp elimination, evolution, BIOSYNTHETIC PROTEIN' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? G N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRPC_SACS2 _struct_ref.pdbx_db_accession Q06121 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PRYLKGWLKDVVQLSLRRPSFRASRQRPIISLNERILEFNKRNITAIIAEYKRKSPSGLDVERDPIEYSKFMERYAVGLS ILTEEKYFNGSYETLRKIASSVSIPILMKDFIVKESQIDDAYNLGADTVLLIVKILTERELESLLEYARSYGMEPLIEIN DENDLDIALRIGARFIGINSRDLETLEINKENQRKLISMIPSNVVKVAESGISERNEIEELRKLGVNAFLIGSSLMRNPE KIKEFIL ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6NW4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 247 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q06121 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 248 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 248 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6NW4 ALA A 50 ? UNP Q06121 GLU 51 conflict 51 1 1 6NW4 ARG A 52 ? UNP Q06121 LYS 53 conflict 53 2 1 6NW4 CYS A 57 ? UNP Q06121 SER 58 conflict 58 3 1 6NW4 ALA A 80 ? UNP Q06121 SER 81 conflict 81 4 1 6NW4 ALA A 82 ? UNP Q06121 LEU 83 conflict 83 5 1 6NW4 TRP A 109 ? UNP Q06121 LYS 110 conflict 110 6 1 6NW4 ALA A 130 ? UNP Q06121 LEU 131 conflict 131 7 1 6NW4 TYR A 156 ? UNP Q06121 LEU 157 conflict 157 8 1 6NW4 VAL A 158 ? UNP Q06121 GLU 159 conflict 159 9 1 6NW4 GLU A 177 ? UNP Q06121 GLY 178 conflict 178 10 1 6NW4 CYS A 179 ? UNP Q06121 ASN 180 conflict 180 11 1 6NW4 PHE A 183 ? UNP Q06121 LEU 184 conflict 184 12 1 6NW4 TRP A 209 ? UNP Q06121 GLU 210 conflict 210 13 1 6NW4 GLY A 210 ? UNP Q06121 SER 211 conflict 211 14 1 6NW4 GLY A 230 ? UNP Q06121 LEU 231 conflict 231 15 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 650 ? 1 MORE -45 ? 1 'SSA (A^2)' 11020 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 5 ? ARG A 18 ? LYS A 6 ARG A 19 1 ? 14 HELX_P HELX_P2 AA2 SER A 31 ? ARG A 42 ? SER A 32 ARG A 43 1 ? 12 HELX_P HELX_P3 AA3 ASP A 64 ? ARG A 74 ? ASP A 65 ARG A 75 1 ? 11 HELX_P HELX_P4 AA4 SER A 91 ? VAL A 102 ? SER A 92 VAL A 103 1 ? 12 HELX_P HELX_P5 AA5 LYS A 114 ? GLY A 125 ? LYS A 115 GLY A 126 1 ? 12 HELX_P HELX_P6 AA6 LYS A 134 ? LEU A 136 ? LYS A 135 LEU A 137 5 ? 3 HELX_P HELX_P7 AA7 THR A 137 ? SER A 150 ? THR A 138 SER A 151 1 ? 14 HELX_P HELX_P8 AA8 ASP A 161 ? GLY A 172 ? ASP A 162 GLY A 173 1 ? 12 HELX_P HELX_P9 AA9 ASN A 189 ? ILE A 200 ? ASN A 190 ILE A 201 1 ? 12 HELX_P HELX_P10 AB1 GLU A 214 ? LEU A 224 ? GLU A 215 LEU A 225 1 ? 11 HELX_P HELX_P11 AB2 GLY A 232 ? ASN A 238 ? GLY A 233 ASN A 239 1 ? 7 HELX_P HELX_P12 AB3 LYS A 241 ? LEU A 247 ? LYS A 242 LEU A 248 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 46 ? TYR A 51 ? ALA A 47 TYR A 52 AA1 2 GLY A 78 ? ALA A 82 ? GLY A 79 ALA A 83 AA1 3 ILE A 106 ? TRP A 109 ? ILE A 107 TRP A 110 AA1 4 THR A 128 ? ILE A 132 ? THR A 129 ILE A 133 AA1 5 TYR A 156 ? ILE A 159 ? TYR A 157 ILE A 160 AA1 6 PHE A 175 ? CYS A 179 ? PHE A 176 CYS A 180 AA1 7 VAL A 205 ? TRP A 209 ? VAL A 206 TRP A 210 AA1 8 ALA A 228 ? ILE A 231 ? ALA A 229 ILE A 232 AA1 9 ALA A 46 ? TYR A 51 ? ALA A 47 TYR A 52 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 51 ? N TYR A 52 O ALA A 80 ? O ALA A 81 AA1 2 3 N ILE A 81 ? N ILE A 82 O LEU A 107 ? O LEU A 108 AA1 3 4 N MET A 108 ? N MET A 109 O THR A 128 ? O THR A 129 AA1 4 5 N LEU A 131 ? N LEU A 132 O VAL A 158 ? O VAL A 159 AA1 5 6 N ILE A 159 ? N ILE A 160 O GLU A 177 ? O GLU A 178 AA1 6 7 N ILE A 176 ? N ILE A 177 O VAL A 205 ? O VAL A 206 AA1 7 8 N LYS A 206 ? N LYS A 207 O ALA A 228 ? O ALA A 229 AA1 8 9 O ILE A 231 ? O ILE A 232 N ILE A 48 ? N ILE A 49 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 301 ? 4 'binding site for residue SO4 A 301' AC2 Software A SO4 302 ? 6 'binding site for residue SO4 A 302' AC3 Software A SO4 303 ? 6 'binding site for residue SO4 A 303' AC4 Software A SO4 304 ? 6 'binding site for residue SO4 A 304' AC5 Software A 6NT 305 ? 7 'binding site for residue 6NT A 305' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ARG A 35 ? ARG A 36 . ? 1_555 ? 2 AC1 4 PHE A 39 ? PHE A 40 . ? 1_555 ? 3 AC1 4 LYS A 41 ? LYS A 42 . ? 5_554 ? 4 AC1 4 ARG A 42 ? ARG A 43 . ? 1_555 ? 5 AC2 6 ARG A 52 ? ARG A 53 . ? 1_555 ? 6 AC2 6 ARG A 181 ? ARG A 182 . ? 1_555 ? 7 AC2 6 TRP A 209 ? TRP A 210 . ? 1_555 ? 8 AC2 6 GLY A 210 ? GLY A 211 . ? 1_555 ? 9 AC2 6 GLY A 232 ? GLY A 233 . ? 1_555 ? 10 AC2 6 SER A 233 ? SER A 234 . ? 1_555 ? 11 AC3 6 ARG A 2 ? ARG A 3 . ? 4_565 ? 12 AC3 6 ARG A 96 ? ARG A 97 . ? 5_664 ? 13 AC3 6 GLU A 138 ? GLU A 139 . ? 4_565 ? 14 AC3 6 SER A 213 ? SER A 214 . ? 1_555 ? 15 AC3 6 GLU A 214 ? GLU A 215 . ? 1_555 ? 16 AC3 6 LYS A 241 ? LYS A 242 . ? 1_555 ? 17 AC4 6 PRO A 19 ? PRO A 20 . ? 1_555 ? 18 AC4 6 SER A 20 ? SER A 21 . ? 1_555 ? 19 AC4 6 ARG A 22 ? ARG A 23 . ? 1_555 ? 20 AC4 6 ARG A 63 ? ARG A 64 . ? 5_564 ? 21 AC4 6 ASP A 64 ? ASP A 65 . ? 5_564 ? 22 AC4 6 GLU A 67 ? GLU A 68 . ? 5_564 ? 23 AC5 7 ALA A 50 ? ALA A 51 . ? 1_555 ? 24 AC5 7 ARG A 52 ? ARG A 53 . ? 1_555 ? 25 AC5 7 ALA A 80 ? ALA A 81 . ? 1_555 ? 26 AC5 7 TRP A 109 ? TRP A 110 . ? 1_555 ? 27 AC5 7 GLU A 177 ? GLU A 178 . ? 1_555 ? 28 AC5 7 CYS A 179 ? CYS A 180 . ? 1_555 ? 29 AC5 7 TRP A 209 ? TRP A 210 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 60 ? ? -162.03 86.85 2 1 TYR A 76 ? ? -123.02 -54.78 3 1 ASN A 90 ? ? 48.27 29.57 # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -22.1451 _pdbx_refine_tls.origin_y 16.6641 _pdbx_refine_tls.origin_z -9.9762 _pdbx_refine_tls.T[1][1] 0.0286 _pdbx_refine_tls.T[2][2] -0.0804 _pdbx_refine_tls.T[3][3] -0.1348 _pdbx_refine_tls.T[1][2] 0.0075 _pdbx_refine_tls.T[1][3] -0.0133 _pdbx_refine_tls.T[2][3] -0.0009 _pdbx_refine_tls.L[1][1] 1.2494 _pdbx_refine_tls.L[2][2] 0.7454 _pdbx_refine_tls.L[3][3] 2.0876 _pdbx_refine_tls.L[1][2] 0.1459 _pdbx_refine_tls.L[1][3] 0.3671 _pdbx_refine_tls.L[2][3] 0.2813 _pdbx_refine_tls.S[1][1] 0.0171 _pdbx_refine_tls.S[2][2] -0.0365 _pdbx_refine_tls.S[3][3] 0.0194 _pdbx_refine_tls.S[1][2] -0.0673 _pdbx_refine_tls.S[1][3] -0.0396 _pdbx_refine_tls.S[2][3] -0.0111 _pdbx_refine_tls.S[2][1] -0.0473 _pdbx_refine_tls.S[3][1] -0.1200 _pdbx_refine_tls.S[3][2] 0.0075 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 2 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 248 _pdbx_refine_tls_group.selection_details '{ A|* }' _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 6NT O21 O N N 1 6NT NO1 N N N 2 6NT O11 O N N 3 6NT C5 C Y N 4 6NT C6 C Y N 5 6NT C7 C Y N 6 6NT C7A C Y N 7 6NT N1 N Y N 8 6NT C3A C Y N 9 6NT C4 C Y N 10 6NT N3 N Y N 11 6NT N2 N Y N 12 6NT H6 H N N 13 6NT H4 H N N 14 6NT H7 H N N 15 6NT H3 H N N 16 ALA N N N N 17 ALA CA C N S 18 ALA C C N N 19 ALA O O N N 20 ALA CB C N N 21 ALA OXT O N N 22 ALA H H N N 23 ALA H2 H N N 24 ALA HA H N N 25 ALA HB1 H N N 26 ALA HB2 H N N 27 ALA HB3 H N N 28 ALA HXT H N N 29 ARG N N N N 30 ARG CA C N S 31 ARG C C N N 32 ARG O O N N 33 ARG CB C N N 34 ARG CG C N N 35 ARG CD C N N 36 ARG NE N N N 37 ARG CZ C N N 38 ARG NH1 N N N 39 ARG NH2 N N N 40 ARG OXT O N N 41 ARG H H N N 42 ARG H2 H N N 43 ARG HA H N N 44 ARG HB2 H N N 45 ARG HB3 H N N 46 ARG HG2 H N N 47 ARG HG3 H N N 48 ARG HD2 H N N 49 ARG HD3 H N N 50 ARG HE H N N 51 ARG HH11 H N N 52 ARG HH12 H N N 53 ARG HH21 H N N 54 ARG HH22 H N N 55 ARG HXT H N N 56 ASN N N N N 57 ASN CA C N S 58 ASN C C N N 59 ASN O O N N 60 ASN CB C N N 61 ASN CG C N N 62 ASN OD1 O N N 63 ASN ND2 N N N 64 ASN OXT O N N 65 ASN H H N N 66 ASN H2 H N N 67 ASN HA H N N 68 ASN HB2 H N N 69 ASN HB3 H N N 70 ASN HD21 H N N 71 ASN HD22 H N N 72 ASN HXT H N N 73 ASP N N N N 74 ASP CA C N S 75 ASP C C N N 76 ASP O O N N 77 ASP CB C N N 78 ASP CG C N N 79 ASP OD1 O N N 80 ASP OD2 O N N 81 ASP OXT O N N 82 ASP H H N N 83 ASP H2 H N N 84 ASP HA H N N 85 ASP HB2 H N N 86 ASP HB3 H N N 87 ASP HD2 H N N 88 ASP HXT H N N 89 CYS N N N N 90 CYS CA C N R 91 CYS C C N N 92 CYS O O N N 93 CYS CB C N N 94 CYS SG S N N 95 CYS OXT O N N 96 CYS H H N N 97 CYS H2 H N N 98 CYS HA H N N 99 CYS HB2 H N N 100 CYS HB3 H N N 101 CYS HG H N N 102 CYS HXT H N N 103 GLN N N N N 104 GLN CA C N S 105 GLN C C N N 106 GLN O O N N 107 GLN CB C N N 108 GLN CG C N N 109 GLN CD C N N 110 GLN OE1 O N N 111 GLN NE2 N N N 112 GLN OXT O N N 113 GLN H H N N 114 GLN H2 H N N 115 GLN HA H N N 116 GLN HB2 H N N 117 GLN HB3 H N N 118 GLN HG2 H N N 119 GLN HG3 H N N 120 GLN HE21 H N N 121 GLN HE22 H N N 122 GLN HXT H N N 123 GLU N N N N 124 GLU CA C N S 125 GLU C C N N 126 GLU O O N N 127 GLU CB C N N 128 GLU CG C N N 129 GLU CD C N N 130 GLU OE1 O N N 131 GLU OE2 O N N 132 GLU OXT O N N 133 GLU H H N N 134 GLU H2 H N N 135 GLU HA H N N 136 GLU HB2 H N N 137 GLU HB3 H N N 138 GLU HG2 H N N 139 GLU HG3 H N N 140 GLU HE2 H N N 141 GLU HXT H N N 142 GLY N N N N 143 GLY CA C N N 144 GLY C C N N 145 GLY O O N N 146 GLY OXT O N N 147 GLY H H N N 148 GLY H2 H N N 149 GLY HA2 H N N 150 GLY HA3 H N N 151 GLY HXT H N N 152 HOH O O N N 153 HOH H1 H N N 154 HOH H2 H N N 155 ILE N N N N 156 ILE CA C N S 157 ILE C C N N 158 ILE O O N N 159 ILE CB C N S 160 ILE CG1 C N N 161 ILE CG2 C N N 162 ILE CD1 C N N 163 ILE OXT O N N 164 ILE H H N N 165 ILE H2 H N N 166 ILE HA H N N 167 ILE HB H N N 168 ILE HG12 H N N 169 ILE HG13 H N N 170 ILE HG21 H N N 171 ILE HG22 H N N 172 ILE HG23 H N N 173 ILE HD11 H N N 174 ILE HD12 H N N 175 ILE HD13 H N N 176 ILE HXT H N N 177 LEU N N N N 178 LEU CA C N S 179 LEU C C N N 180 LEU O O N N 181 LEU CB C N N 182 LEU CG C N N 183 LEU CD1 C N N 184 LEU CD2 C N N 185 LEU OXT O N N 186 LEU H H N N 187 LEU H2 H N N 188 LEU HA H N N 189 LEU HB2 H N N 190 LEU HB3 H N N 191 LEU HG H N N 192 LEU HD11 H N N 193 LEU HD12 H N N 194 LEU HD13 H N N 195 LEU HD21 H N N 196 LEU HD22 H N N 197 LEU HD23 H N N 198 LEU HXT H N N 199 LYS N N N N 200 LYS CA C N S 201 LYS C C N N 202 LYS O O N N 203 LYS CB C N N 204 LYS CG C N N 205 LYS CD C N N 206 LYS CE C N N 207 LYS NZ N N N 208 LYS OXT O N N 209 LYS H H N N 210 LYS H2 H N N 211 LYS HA H N N 212 LYS HB2 H N N 213 LYS HB3 H N N 214 LYS HG2 H N N 215 LYS HG3 H N N 216 LYS HD2 H N N 217 LYS HD3 H N N 218 LYS HE2 H N N 219 LYS HE3 H N N 220 LYS HZ1 H N N 221 LYS HZ2 H N N 222 LYS HZ3 H N N 223 LYS HXT H N N 224 MET N N N N 225 MET CA C N S 226 MET C C N N 227 MET O O N N 228 MET CB C N N 229 MET CG C N N 230 MET SD S N N 231 MET CE C N N 232 MET OXT O N N 233 MET H H N N 234 MET H2 H N N 235 MET HA H N N 236 MET HB2 H N N 237 MET HB3 H N N 238 MET HG2 H N N 239 MET HG3 H N N 240 MET HE1 H N N 241 MET HE2 H N N 242 MET HE3 H N N 243 MET HXT H N N 244 PHE N N N N 245 PHE CA C N S 246 PHE C C N N 247 PHE O O N N 248 PHE CB C N N 249 PHE CG C Y N 250 PHE CD1 C Y N 251 PHE CD2 C Y N 252 PHE CE1 C Y N 253 PHE CE2 C Y N 254 PHE CZ C Y N 255 PHE OXT O N N 256 PHE H H N N 257 PHE H2 H N N 258 PHE HA H N N 259 PHE HB2 H N N 260 PHE HB3 H N N 261 PHE HD1 H N N 262 PHE HD2 H N N 263 PHE HE1 H N N 264 PHE HE2 H N N 265 PHE HZ H N N 266 PHE HXT H N N 267 PRO N N N N 268 PRO CA C N S 269 PRO C C N N 270 PRO O O N N 271 PRO CB C N N 272 PRO CG C N N 273 PRO CD C N N 274 PRO OXT O N N 275 PRO H H N N 276 PRO HA H N N 277 PRO HB2 H N N 278 PRO HB3 H N N 279 PRO HG2 H N N 280 PRO HG3 H N N 281 PRO HD2 H N N 282 PRO HD3 H N N 283 PRO HXT H N N 284 SER N N N N 285 SER CA C N S 286 SER C C N N 287 SER O O N N 288 SER CB C N N 289 SER OG O N N 290 SER OXT O N N 291 SER H H N N 292 SER H2 H N N 293 SER HA H N N 294 SER HB2 H N N 295 SER HB3 H N N 296 SER HG H N N 297 SER HXT H N N 298 SO4 S S N N 299 SO4 O1 O N N 300 SO4 O2 O N N 301 SO4 O3 O N N 302 SO4 O4 O N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 6NT O21 NO1 sing N N 1 6NT NO1 O11 doub N N 2 6NT NO1 C5 sing N N 3 6NT C5 C6 sing Y N 4 6NT C5 C4 doub Y N 5 6NT C6 C7 doub Y N 6 6NT C7 C7A sing Y N 7 6NT C7A N1 sing Y N 8 6NT C7A C3A doub Y N 9 6NT N1 N2 doub Y N 10 6NT C3A C4 sing Y N 11 6NT C3A N3 sing Y N 12 6NT N3 N2 sing Y N 13 6NT C6 H6 sing N N 14 6NT C4 H4 sing N N 15 6NT C7 H7 sing N N 16 6NT N3 H3 sing N N 17 ALA N CA sing N N 18 ALA N H sing N N 19 ALA N H2 sing N N 20 ALA CA C sing N N 21 ALA CA CB sing N N 22 ALA CA HA sing N N 23 ALA C O doub N N 24 ALA C OXT sing N N 25 ALA CB HB1 sing N N 26 ALA CB HB2 sing N N 27 ALA CB HB3 sing N N 28 ALA OXT HXT sing N N 29 ARG N CA sing N N 30 ARG N H sing N N 31 ARG N H2 sing N N 32 ARG CA C sing N N 33 ARG CA CB sing N N 34 ARG CA HA sing N N 35 ARG C O doub N N 36 ARG C OXT sing N N 37 ARG CB CG sing N N 38 ARG CB HB2 sing N N 39 ARG CB HB3 sing N N 40 ARG CG CD sing N N 41 ARG CG HG2 sing N N 42 ARG CG HG3 sing N N 43 ARG CD NE sing N N 44 ARG CD HD2 sing N N 45 ARG CD HD3 sing N N 46 ARG NE CZ sing N N 47 ARG NE HE sing N N 48 ARG CZ NH1 sing N N 49 ARG CZ NH2 doub N N 50 ARG NH1 HH11 sing N N 51 ARG NH1 HH12 sing N N 52 ARG NH2 HH21 sing N N 53 ARG NH2 HH22 sing N N 54 ARG OXT HXT sing N N 55 ASN N CA sing N N 56 ASN N H sing N N 57 ASN N H2 sing N N 58 ASN CA C sing N N 59 ASN CA CB sing N N 60 ASN CA HA sing N N 61 ASN C O doub N N 62 ASN C OXT sing N N 63 ASN CB CG sing N N 64 ASN CB HB2 sing N N 65 ASN CB HB3 sing N N 66 ASN CG OD1 doub N N 67 ASN CG ND2 sing N N 68 ASN ND2 HD21 sing N N 69 ASN ND2 HD22 sing N N 70 ASN OXT HXT sing N N 71 ASP N CA sing N N 72 ASP N H sing N N 73 ASP N H2 sing N N 74 ASP CA C sing N N 75 ASP CA CB sing N N 76 ASP CA HA sing N N 77 ASP C O doub N N 78 ASP C OXT sing N N 79 ASP CB CG sing N N 80 ASP CB HB2 sing N N 81 ASP CB HB3 sing N N 82 ASP CG OD1 doub N N 83 ASP CG OD2 sing N N 84 ASP OD2 HD2 sing N N 85 ASP OXT HXT sing N N 86 CYS N CA sing N N 87 CYS N H sing N N 88 CYS N H2 sing N N 89 CYS CA C sing N N 90 CYS CA CB sing N N 91 CYS CA HA sing N N 92 CYS C O doub N N 93 CYS C OXT sing N N 94 CYS CB SG sing N N 95 CYS CB HB2 sing N N 96 CYS CB HB3 sing N N 97 CYS SG HG sing N N 98 CYS OXT HXT sing N N 99 GLN N CA sing N N 100 GLN N H sing N N 101 GLN N H2 sing N N 102 GLN CA C sing N N 103 GLN CA CB sing N N 104 GLN CA HA sing N N 105 GLN C O doub N N 106 GLN C OXT sing N N 107 GLN CB CG sing N N 108 GLN CB HB2 sing N N 109 GLN CB HB3 sing N N 110 GLN CG CD sing N N 111 GLN CG HG2 sing N N 112 GLN CG HG3 sing N N 113 GLN CD OE1 doub N N 114 GLN CD NE2 sing N N 115 GLN NE2 HE21 sing N N 116 GLN NE2 HE22 sing N N 117 GLN OXT HXT sing N N 118 GLU N CA sing N N 119 GLU N H sing N N 120 GLU N H2 sing N N 121 GLU CA C sing N N 122 GLU CA CB sing N N 123 GLU CA HA sing N N 124 GLU C O doub N N 125 GLU C OXT sing N N 126 GLU CB CG sing N N 127 GLU CB HB2 sing N N 128 GLU CB HB3 sing N N 129 GLU CG CD sing N N 130 GLU CG HG2 sing N N 131 GLU CG HG3 sing N N 132 GLU CD OE1 doub N N 133 GLU CD OE2 sing N N 134 GLU OE2 HE2 sing N N 135 GLU OXT HXT sing N N 136 GLY N CA sing N N 137 GLY N H sing N N 138 GLY N H2 sing N N 139 GLY CA C sing N N 140 GLY CA HA2 sing N N 141 GLY CA HA3 sing N N 142 GLY C O doub N N 143 GLY C OXT sing N N 144 GLY OXT HXT sing N N 145 HOH O H1 sing N N 146 HOH O H2 sing N N 147 ILE N CA sing N N 148 ILE N H sing N N 149 ILE N H2 sing N N 150 ILE CA C sing N N 151 ILE CA CB sing N N 152 ILE CA HA sing N N 153 ILE C O doub N N 154 ILE C OXT sing N N 155 ILE CB CG1 sing N N 156 ILE CB CG2 sing N N 157 ILE CB HB sing N N 158 ILE CG1 CD1 sing N N 159 ILE CG1 HG12 sing N N 160 ILE CG1 HG13 sing N N 161 ILE CG2 HG21 sing N N 162 ILE CG2 HG22 sing N N 163 ILE CG2 HG23 sing N N 164 ILE CD1 HD11 sing N N 165 ILE CD1 HD12 sing N N 166 ILE CD1 HD13 sing N N 167 ILE OXT HXT sing N N 168 LEU N CA sing N N 169 LEU N H sing N N 170 LEU N H2 sing N N 171 LEU CA C sing N N 172 LEU CA CB sing N N 173 LEU CA HA sing N N 174 LEU C O doub N N 175 LEU C OXT sing N N 176 LEU CB CG sing N N 177 LEU CB HB2 sing N N 178 LEU CB HB3 sing N N 179 LEU CG CD1 sing N N 180 LEU CG CD2 sing N N 181 LEU CG HG sing N N 182 LEU CD1 HD11 sing N N 183 LEU CD1 HD12 sing N N 184 LEU CD1 HD13 sing N N 185 LEU CD2 HD21 sing N N 186 LEU CD2 HD22 sing N N 187 LEU CD2 HD23 sing N N 188 LEU OXT HXT sing N N 189 LYS N CA sing N N 190 LYS N H sing N N 191 LYS N H2 sing N N 192 LYS CA C sing N N 193 LYS CA CB sing N N 194 LYS CA HA sing N N 195 LYS C O doub N N 196 LYS C OXT sing N N 197 LYS CB CG sing N N 198 LYS CB HB2 sing N N 199 LYS CB HB3 sing N N 200 LYS CG CD sing N N 201 LYS CG HG2 sing N N 202 LYS CG HG3 sing N N 203 LYS CD CE sing N N 204 LYS CD HD2 sing N N 205 LYS CD HD3 sing N N 206 LYS CE NZ sing N N 207 LYS CE HE2 sing N N 208 LYS CE HE3 sing N N 209 LYS NZ HZ1 sing N N 210 LYS NZ HZ2 sing N N 211 LYS NZ HZ3 sing N N 212 LYS OXT HXT sing N N 213 MET N CA sing N N 214 MET N H sing N N 215 MET N H2 sing N N 216 MET CA C sing N N 217 MET CA CB sing N N 218 MET CA HA sing N N 219 MET C O doub N N 220 MET C OXT sing N N 221 MET CB CG sing N N 222 MET CB HB2 sing N N 223 MET CB HB3 sing N N 224 MET CG SD sing N N 225 MET CG HG2 sing N N 226 MET CG HG3 sing N N 227 MET SD CE sing N N 228 MET CE HE1 sing N N 229 MET CE HE2 sing N N 230 MET CE HE3 sing N N 231 MET OXT HXT sing N N 232 PHE N CA sing N N 233 PHE N H sing N N 234 PHE N H2 sing N N 235 PHE CA C sing N N 236 PHE CA CB sing N N 237 PHE CA HA sing N N 238 PHE C O doub N N 239 PHE C OXT sing N N 240 PHE CB CG sing N N 241 PHE CB HB2 sing N N 242 PHE CB HB3 sing N N 243 PHE CG CD1 doub Y N 244 PHE CG CD2 sing Y N 245 PHE CD1 CE1 sing Y N 246 PHE CD1 HD1 sing N N 247 PHE CD2 CE2 doub Y N 248 PHE CD2 HD2 sing N N 249 PHE CE1 CZ doub Y N 250 PHE CE1 HE1 sing N N 251 PHE CE2 CZ sing Y N 252 PHE CE2 HE2 sing N N 253 PHE CZ HZ sing N N 254 PHE OXT HXT sing N N 255 PRO N CA sing N N 256 PRO N CD sing N N 257 PRO N H sing N N 258 PRO CA C sing N N 259 PRO CA CB sing N N 260 PRO CA HA sing N N 261 PRO C O doub N N 262 PRO C OXT sing N N 263 PRO CB CG sing N N 264 PRO CB HB2 sing N N 265 PRO CB HB3 sing N N 266 PRO CG CD sing N N 267 PRO CG HG2 sing N N 268 PRO CG HG3 sing N N 269 PRO CD HD2 sing N N 270 PRO CD HD3 sing N N 271 PRO OXT HXT sing N N 272 SER N CA sing N N 273 SER N H sing N N 274 SER N H2 sing N N 275 SER CA C sing N N 276 SER CA CB sing N N 277 SER CA HA sing N N 278 SER C O doub N N 279 SER C OXT sing N N 280 SER CB OG sing N N 281 SER CB HB2 sing N N 282 SER CB HB3 sing N N 283 SER OG HG sing N N 284 SER OXT HXT sing N N 285 SO4 S O1 doub N N 286 SO4 S O2 doub N N 287 SO4 S O3 sing N N 288 SO4 S O4 sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3NZ1 _pdbx_initial_refinement_model.details ? # _pdbx_related_exp_data_set.ordinal 1 _pdbx_related_exp_data_set.data_reference 10.18430/m36nw4 _pdbx_related_exp_data_set.data_set_type 'diffraction image data' # _atom_sites.entry_id 6NW4 _atom_sites.fract_transf_matrix[1][1] 0.016312 _atom_sites.fract_transf_matrix[1][2] 0.009418 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018836 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008246 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_