data_6NZ3 # _entry.id 6NZ3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6NZ3 pdb_00006nz3 10.2210/pdb6nz3/pdb WWPDB D_1000239707 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-22 2 'Structure model' 1 1 2024-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6NZ3 _pdbx_database_status.recvd_initial_deposition_date 2019-02-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wei, K.Y.' 1 0000-0002-8794-1385 'Bick, M.J.' 2 0000-0002-9585-859X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 117 _citation.language ? _citation.page_first 7208 _citation.page_last 7215 _citation.title 'Computational design of closely related proteins that adopt two well-defined but structurally divergent folds.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1914808117 _citation.pdbx_database_id_PubMed 32188784 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wei, K.Y.' 1 0000-0002-8794-1385 primary 'Moschidi, D.' 2 0000-0003-2186-7693 primary 'Bick, M.J.' 3 0000-0002-9585-859X primary 'Nerli, S.' 4 0000-0001-6573-8661 primary 'McShan, A.C.' 5 0000-0002-3212-9867 primary 'Carter, L.P.' 6 ? primary 'Huang, P.S.' 7 0000-0002-7948-2895 primary 'Fletcher, D.A.' 8 0000-0002-1890-5364 primary 'Sgourakis, N.G.' 9 0000-0003-3655-3902 primary 'Boyken, S.E.' 10 0000-0002-5378-0632 primary 'Baker, D.' 11 0000-0001-7896-6217 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Design construct XAA_GGHN' 10958.525 3 ? ? ? ? 2 non-polymer man 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 water nat water 18.015 10 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMGDLKYSLERLREILERLEENPSEKQIVEAIRAIVENNAQIVEAIRAIVENNAQIVENNRAIIEALEAIGGHNKILE EMKKQLKDLKRSLERG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMGDLKYSLERLREILERLEENPSEKQIVEAIRAIVENNAQIVEAIRAIVENNAQIVENNRAIIEALEAIGGHNKILE EMKKQLKDLKRSLERG ; _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLY n 1 6 ASP n 1 7 LEU n 1 8 LYS n 1 9 TYR n 1 10 SER n 1 11 LEU n 1 12 GLU n 1 13 ARG n 1 14 LEU n 1 15 ARG n 1 16 GLU n 1 17 ILE n 1 18 LEU n 1 19 GLU n 1 20 ARG n 1 21 LEU n 1 22 GLU n 1 23 GLU n 1 24 ASN n 1 25 PRO n 1 26 SER n 1 27 GLU n 1 28 LYS n 1 29 GLN n 1 30 ILE n 1 31 VAL n 1 32 GLU n 1 33 ALA n 1 34 ILE n 1 35 ARG n 1 36 ALA n 1 37 ILE n 1 38 VAL n 1 39 GLU n 1 40 ASN n 1 41 ASN n 1 42 ALA n 1 43 GLN n 1 44 ILE n 1 45 VAL n 1 46 GLU n 1 47 ALA n 1 48 ILE n 1 49 ARG n 1 50 ALA n 1 51 ILE n 1 52 VAL n 1 53 GLU n 1 54 ASN n 1 55 ASN n 1 56 ALA n 1 57 GLN n 1 58 ILE n 1 59 VAL n 1 60 GLU n 1 61 ASN n 1 62 ASN n 1 63 ARG n 1 64 ALA n 1 65 ILE n 1 66 ILE n 1 67 GLU n 1 68 ALA n 1 69 LEU n 1 70 GLU n 1 71 ALA n 1 72 ILE n 1 73 GLY n 1 74 GLY n 1 75 HIS n 1 76 ASN n 1 77 LYS n 1 78 ILE n 1 79 LEU n 1 80 GLU n 1 81 GLU n 1 82 MET n 1 83 LYS n 1 84 LYS n 1 85 GLN n 1 86 LEU n 1 87 LYS n 1 88 ASP n 1 89 LEU n 1 90 LYS n 1 91 ARG n 1 92 SER n 1 93 LEU n 1 94 GLU n 1 95 ARG n 1 96 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 96 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLU 94 94 ? ? ? A . n A 1 95 ARG 95 95 ? ? ? A . n A 1 96 GLY 96 96 ? ? ? A . n B 1 1 GLY 1 1 ? ? ? B . n B 1 2 SER 2 2 ? ? ? B . n B 1 3 HIS 3 3 3 HIS HIS B . n B 1 4 MET 4 4 4 MET MET B . n B 1 5 GLY 5 5 5 GLY GLY B . n B 1 6 ASP 6 6 6 ASP ASP B . n B 1 7 LEU 7 7 7 LEU LEU B . n B 1 8 LYS 8 8 8 LYS LYS B . n B 1 9 TYR 9 9 9 TYR TYR B . n B 1 10 SER 10 10 10 SER SER B . n B 1 11 LEU 11 11 11 LEU LEU B . n B 1 12 GLU 12 12 12 GLU GLU B . n B 1 13 ARG 13 13 13 ARG ARG B . n B 1 14 LEU 14 14 14 LEU LEU B . n B 1 15 ARG 15 15 15 ARG ARG B . n B 1 16 GLU 16 16 16 GLU GLU B . n B 1 17 ILE 17 17 17 ILE ILE B . n B 1 18 LEU 18 18 18 LEU LEU B . n B 1 19 GLU 19 19 19 GLU GLU B . n B 1 20 ARG 20 20 20 ARG ARG B . n B 1 21 LEU 21 21 21 LEU LEU B . n B 1 22 GLU 22 22 22 GLU GLU B . n B 1 23 GLU 23 23 23 GLU GLU B . n B 1 24 ASN 24 24 24 ASN ASN B . n B 1 25 PRO 25 25 25 PRO PRO B . n B 1 26 SER 26 26 26 SER SER B . n B 1 27 GLU 27 27 27 GLU GLU B . n B 1 28 LYS 28 28 28 LYS LYS B . n B 1 29 GLN 29 29 29 GLN GLN B . n B 1 30 ILE 30 30 30 ILE ILE B . n B 1 31 VAL 31 31 31 VAL VAL B . n B 1 32 GLU 32 32 32 GLU GLU B . n B 1 33 ALA 33 33 33 ALA ALA B . n B 1 34 ILE 34 34 34 ILE ILE B . n B 1 35 ARG 35 35 35 ARG ARG B . n B 1 36 ALA 36 36 36 ALA ALA B . n B 1 37 ILE 37 37 37 ILE ILE B . n B 1 38 VAL 38 38 38 VAL VAL B . n B 1 39 GLU 39 39 39 GLU GLU B . n B 1 40 ASN 40 40 40 ASN ASN B . n B 1 41 ASN 41 41 41 ASN ASN B . n B 1 42 ALA 42 42 42 ALA ALA B . n B 1 43 GLN 43 43 43 GLN GLN B . n B 1 44 ILE 44 44 44 ILE ILE B . n B 1 45 VAL 45 45 45 VAL VAL B . n B 1 46 GLU 46 46 46 GLU GLU B . n B 1 47 ALA 47 47 47 ALA ALA B . n B 1 48 ILE 48 48 48 ILE ILE B . n B 1 49 ARG 49 49 49 ARG ARG B . n B 1 50 ALA 50 50 50 ALA ALA B . n B 1 51 ILE 51 51 51 ILE ILE B . n B 1 52 VAL 52 52 52 VAL VAL B . n B 1 53 GLU 53 53 53 GLU GLU B . n B 1 54 ASN 54 54 54 ASN ASN B . n B 1 55 ASN 55 55 55 ASN ASN B . n B 1 56 ALA 56 56 56 ALA ALA B . n B 1 57 GLN 57 57 57 GLN GLN B . n B 1 58 ILE 58 58 58 ILE ILE B . n B 1 59 VAL 59 59 59 VAL VAL B . n B 1 60 GLU 60 60 60 GLU GLU B . n B 1 61 ASN 61 61 61 ASN ASN B . n B 1 62 ASN 62 62 62 ASN ASN B . n B 1 63 ARG 63 63 63 ARG ARG B . n B 1 64 ALA 64 64 64 ALA ALA B . n B 1 65 ILE 65 65 65 ILE ILE B . n B 1 66 ILE 66 66 66 ILE ILE B . n B 1 67 GLU 67 67 67 GLU GLU B . n B 1 68 ALA 68 68 68 ALA ALA B . n B 1 69 LEU 69 69 69 LEU LEU B . n B 1 70 GLU 70 70 70 GLU GLU B . n B 1 71 ALA 71 71 71 ALA ALA B . n B 1 72 ILE 72 72 72 ILE ILE B . n B 1 73 GLY 73 73 73 GLY GLY B . n B 1 74 GLY 74 74 74 GLY GLY B . n B 1 75 HIS 75 75 75 HIS HIS B . n B 1 76 ASN 76 76 76 ASN ASN B . n B 1 77 LYS 77 77 77 LYS LYS B . n B 1 78 ILE 78 78 78 ILE ILE B . n B 1 79 LEU 79 79 79 LEU LEU B . n B 1 80 GLU 80 80 80 GLU GLU B . n B 1 81 GLU 81 81 81 GLU GLU B . n B 1 82 MET 82 82 82 MET MET B . n B 1 83 LYS 83 83 83 LYS LYS B . n B 1 84 LYS 84 84 84 LYS LYS B . n B 1 85 GLN 85 85 85 GLN GLN B . n B 1 86 LEU 86 86 86 LEU LEU B . n B 1 87 LYS 87 87 87 LYS LYS B . n B 1 88 ASP 88 88 88 ASP ASP B . n B 1 89 LEU 89 89 89 LEU LEU B . n B 1 90 LYS 90 90 90 LYS LYS B . n B 1 91 ARG 91 91 91 ARG ARG B . n B 1 92 SER 92 92 92 SER SER B . n B 1 93 LEU 93 93 93 LEU LEU B . n B 1 94 GLU 94 94 ? ? ? B . n B 1 95 ARG 95 95 ? ? ? B . n B 1 96 GLY 96 96 ? ? ? B . n C 1 1 GLY 1 1 ? ? ? C . n C 1 2 SER 2 2 2 SER SER C . n C 1 3 HIS 3 3 3 HIS HIS C . n C 1 4 MET 4 4 4 MET MET C . n C 1 5 GLY 5 5 5 GLY GLY C . n C 1 6 ASP 6 6 6 ASP ASP C . n C 1 7 LEU 7 7 7 LEU LEU C . n C 1 8 LYS 8 8 8 LYS LYS C . n C 1 9 TYR 9 9 9 TYR TYR C . n C 1 10 SER 10 10 10 SER SER C . n C 1 11 LEU 11 11 11 LEU LEU C . n C 1 12 GLU 12 12 12 GLU GLU C . n C 1 13 ARG 13 13 13 ARG ARG C . n C 1 14 LEU 14 14 14 LEU LEU C . n C 1 15 ARG 15 15 15 ARG ARG C . n C 1 16 GLU 16 16 16 GLU GLU C . n C 1 17 ILE 17 17 17 ILE ILE C . n C 1 18 LEU 18 18 18 LEU LEU C . n C 1 19 GLU 19 19 19 GLU GLU C . n C 1 20 ARG 20 20 20 ARG ARG C . n C 1 21 LEU 21 21 21 LEU LEU C . n C 1 22 GLU 22 22 22 GLU GLU C . n C 1 23 GLU 23 23 23 GLU GLU C . n C 1 24 ASN 24 24 24 ASN ASN C . n C 1 25 PRO 25 25 25 PRO PRO C . n C 1 26 SER 26 26 26 SER SER C . n C 1 27 GLU 27 27 27 GLU GLU C . n C 1 28 LYS 28 28 28 LYS LYS C . n C 1 29 GLN 29 29 29 GLN GLN C . n C 1 30 ILE 30 30 30 ILE ILE C . n C 1 31 VAL 31 31 31 VAL VAL C . n C 1 32 GLU 32 32 32 GLU GLU C . n C 1 33 ALA 33 33 33 ALA ALA C . n C 1 34 ILE 34 34 34 ILE ILE C . n C 1 35 ARG 35 35 35 ARG ARG C . n C 1 36 ALA 36 36 36 ALA ALA C . n C 1 37 ILE 37 37 37 ILE ILE C . n C 1 38 VAL 38 38 38 VAL VAL C . n C 1 39 GLU 39 39 39 GLU GLU C . n C 1 40 ASN 40 40 40 ASN ASN C . n C 1 41 ASN 41 41 41 ASN ASN C . n C 1 42 ALA 42 42 42 ALA ALA C . n C 1 43 GLN 43 43 43 GLN GLN C . n C 1 44 ILE 44 44 44 ILE ILE C . n C 1 45 VAL 45 45 45 VAL VAL C . n C 1 46 GLU 46 46 46 GLU GLU C . n C 1 47 ALA 47 47 47 ALA ALA C . n C 1 48 ILE 48 48 48 ILE ILE C . n C 1 49 ARG 49 49 49 ARG ARG C . n C 1 50 ALA 50 50 50 ALA ALA C . n C 1 51 ILE 51 51 51 ILE ILE C . n C 1 52 VAL 52 52 52 VAL VAL C . n C 1 53 GLU 53 53 53 GLU GLU C . n C 1 54 ASN 54 54 54 ASN ASN C . n C 1 55 ASN 55 55 55 ASN ASN C . n C 1 56 ALA 56 56 56 ALA ALA C . n C 1 57 GLN 57 57 57 GLN GLN C . n C 1 58 ILE 58 58 58 ILE ILE C . n C 1 59 VAL 59 59 59 VAL VAL C . n C 1 60 GLU 60 60 60 GLU GLU C . n C 1 61 ASN 61 61 61 ASN ASN C . n C 1 62 ASN 62 62 62 ASN ASN C . n C 1 63 ARG 63 63 63 ARG ARG C . n C 1 64 ALA 64 64 64 ALA ALA C . n C 1 65 ILE 65 65 65 ILE ILE C . n C 1 66 ILE 66 66 66 ILE ILE C . n C 1 67 GLU 67 67 67 GLU GLU C . n C 1 68 ALA 68 68 68 ALA ALA C . n C 1 69 LEU 69 69 69 LEU LEU C . n C 1 70 GLU 70 70 70 GLU GLU C . n C 1 71 ALA 71 71 71 ALA ALA C . n C 1 72 ILE 72 72 72 ILE ILE C . n C 1 73 GLY 73 73 73 GLY GLY C . n C 1 74 GLY 74 74 74 GLY GLY C . n C 1 75 HIS 75 75 75 HIS HIS C . n C 1 76 ASN 76 76 76 ASN ASN C . n C 1 77 LYS 77 77 77 LYS LYS C . n C 1 78 ILE 78 78 78 ILE ILE C . n C 1 79 LEU 79 79 79 LEU LEU C . n C 1 80 GLU 80 80 80 GLU GLU C . n C 1 81 GLU 81 81 81 GLU GLU C . n C 1 82 MET 82 82 82 MET MET C . n C 1 83 LYS 83 83 83 LYS LYS C . n C 1 84 LYS 84 84 84 LYS LYS C . n C 1 85 GLN 85 85 85 GLN GLN C . n C 1 86 LEU 86 86 86 LEU LEU C . n C 1 87 LYS 87 87 87 LYS LYS C . n C 1 88 ASP 88 88 88 ASP ASP C . n C 1 89 LEU 89 89 89 LEU LEU C . n C 1 90 LYS 90 90 90 LYS LYS C . n C 1 91 ARG 91 91 91 ARG ARG C . n C 1 92 SER 92 92 92 SER SER C . n C 1 93 LEU 93 93 93 LEU LEU C . n C 1 94 GLU 94 94 ? ? ? C . n C 1 95 ARG 95 95 ? ? ? C . n C 1 96 GLY 96 96 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 2 CL 1 101 1 CL CL A . E 3 HOH 1 201 8 HOH HOH A . E 3 HOH 2 202 2 HOH HOH A . E 3 HOH 3 203 3 HOH HOH A . E 3 HOH 4 204 10 HOH HOH A . E 3 HOH 5 205 9 HOH HOH A . F 3 HOH 1 101 1 HOH HOH B . F 3 HOH 2 102 4 HOH HOH B . G 3 HOH 1 101 7 HOH HOH C . G 3 HOH 2 102 5 HOH HOH C . G 3 HOH 3 103 6 HOH HOH C . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 2 ? OG ? A SER 2 OG 2 1 Y 1 A LYS 8 ? CD ? A LYS 8 CD 3 1 Y 1 A LYS 8 ? CE ? A LYS 8 CE 4 1 Y 1 A LYS 8 ? NZ ? A LYS 8 NZ 5 1 Y 1 A ARG 13 ? CD ? A ARG 13 CD 6 1 Y 1 A ARG 13 ? NE ? A ARG 13 NE 7 1 Y 1 A ARG 13 ? CZ ? A ARG 13 CZ 8 1 Y 1 A ARG 13 ? NH1 ? A ARG 13 NH1 9 1 Y 1 A ARG 13 ? NH2 ? A ARG 13 NH2 10 1 Y 1 A GLU 19 ? CG ? A GLU 19 CG 11 1 Y 1 A GLU 19 ? CD ? A GLU 19 CD 12 1 Y 1 A GLU 19 ? OE1 ? A GLU 19 OE1 13 1 Y 1 A GLU 19 ? OE2 ? A GLU 19 OE2 14 1 Y 1 A GLU 23 ? CG ? A GLU 23 CG 15 1 Y 1 A GLU 23 ? CD ? A GLU 23 CD 16 1 Y 1 A GLU 23 ? OE1 ? A GLU 23 OE1 17 1 Y 1 A GLU 23 ? OE2 ? A GLU 23 OE2 18 1 Y 1 A ASN 24 ? CG ? A ASN 24 CG 19 1 Y 1 A ASN 24 ? OD1 ? A ASN 24 OD1 20 1 Y 1 A ASN 24 ? ND2 ? A ASN 24 ND2 21 1 Y 1 A LYS 28 ? CG ? A LYS 28 CG 22 1 Y 1 A LYS 28 ? CD ? A LYS 28 CD 23 1 Y 1 A LYS 28 ? CE ? A LYS 28 CE 24 1 Y 1 A LYS 28 ? NZ ? A LYS 28 NZ 25 1 Y 1 A LYS 77 ? CG ? A LYS 77 CG 26 1 Y 1 A LYS 77 ? CD ? A LYS 77 CD 27 1 Y 1 A LYS 77 ? CE ? A LYS 77 CE 28 1 Y 1 A LYS 77 ? NZ ? A LYS 77 NZ 29 1 Y 1 A GLU 80 ? CD ? A GLU 80 CD 30 1 Y 1 A GLU 80 ? OE1 ? A GLU 80 OE1 31 1 Y 1 A GLU 80 ? OE2 ? A GLU 80 OE2 32 1 Y 1 A GLU 81 ? OE1 ? A GLU 81 OE1 33 1 Y 1 A GLU 81 ? OE2 ? A GLU 81 OE2 34 1 Y 1 A LYS 83 ? CG ? A LYS 83 CG 35 1 Y 1 A LYS 83 ? CD ? A LYS 83 CD 36 1 Y 1 A LYS 83 ? CE ? A LYS 83 CE 37 1 Y 1 A LYS 83 ? NZ ? A LYS 83 NZ 38 1 Y 1 A LYS 84 ? CG ? A LYS 84 CG 39 1 Y 1 A LYS 84 ? CD ? A LYS 84 CD 40 1 Y 1 A LYS 84 ? CE ? A LYS 84 CE 41 1 Y 1 A LYS 84 ? NZ ? A LYS 84 NZ 42 1 Y 1 A GLN 85 ? CD ? A GLN 85 CD 43 1 Y 1 A GLN 85 ? OE1 ? A GLN 85 OE1 44 1 Y 1 A GLN 85 ? NE2 ? A GLN 85 NE2 45 1 Y 1 A LYS 87 ? CG ? A LYS 87 CG 46 1 Y 1 A LYS 87 ? CD ? A LYS 87 CD 47 1 Y 1 A LYS 87 ? CE ? A LYS 87 CE 48 1 Y 1 A LYS 87 ? NZ ? A LYS 87 NZ 49 1 Y 1 A LYS 90 ? CE ? A LYS 90 CE 50 1 Y 1 A LYS 90 ? NZ ? A LYS 90 NZ 51 1 Y 1 A ARG 91 ? NE ? A ARG 91 NE 52 1 Y 1 A ARG 91 ? CZ ? A ARG 91 CZ 53 1 Y 1 A ARG 91 ? NH1 ? A ARG 91 NH1 54 1 Y 1 A ARG 91 ? NH2 ? A ARG 91 NH2 55 1 Y 1 A LEU 93 ? CG ? A LEU 93 CG 56 1 Y 1 A LEU 93 ? CD1 ? A LEU 93 CD1 57 1 Y 1 A LEU 93 ? CD2 ? A LEU 93 CD2 58 1 Y 1 B LYS 8 ? CD ? B LYS 8 CD 59 1 Y 1 B LYS 8 ? CE ? B LYS 8 CE 60 1 Y 1 B LYS 8 ? NZ ? B LYS 8 NZ 61 1 Y 1 B GLU 12 ? CG ? B GLU 12 CG 62 1 Y 1 B GLU 12 ? CD ? B GLU 12 CD 63 1 Y 1 B GLU 12 ? OE1 ? B GLU 12 OE1 64 1 Y 1 B GLU 12 ? OE2 ? B GLU 12 OE2 65 1 Y 1 B ARG 13 ? NE ? B ARG 13 NE 66 1 Y 1 B ARG 13 ? CZ ? B ARG 13 CZ 67 1 Y 1 B ARG 13 ? NH1 ? B ARG 13 NH1 68 1 Y 1 B ARG 13 ? NH2 ? B ARG 13 NH2 69 1 Y 1 B GLU 19 ? CG ? B GLU 19 CG 70 1 Y 1 B GLU 19 ? CD ? B GLU 19 CD 71 1 Y 1 B GLU 19 ? OE1 ? B GLU 19 OE1 72 1 Y 1 B GLU 19 ? OE2 ? B GLU 19 OE2 73 1 Y 1 B GLU 23 ? CG ? B GLU 23 CG 74 1 Y 1 B GLU 23 ? CD ? B GLU 23 CD 75 1 Y 1 B GLU 23 ? OE1 ? B GLU 23 OE1 76 1 Y 1 B GLU 23 ? OE2 ? B GLU 23 OE2 77 1 Y 1 B ASN 24 ? CG ? B ASN 24 CG 78 1 Y 1 B ASN 24 ? OD1 ? B ASN 24 OD1 79 1 Y 1 B ASN 24 ? ND2 ? B ASN 24 ND2 80 1 Y 1 B LYS 28 ? CG ? B LYS 28 CG 81 1 Y 1 B LYS 28 ? CD ? B LYS 28 CD 82 1 Y 1 B LYS 28 ? CE ? B LYS 28 CE 83 1 Y 1 B LYS 28 ? NZ ? B LYS 28 NZ 84 1 Y 1 B LYS 77 ? CG ? B LYS 77 CG 85 1 Y 1 B LYS 77 ? CD ? B LYS 77 CD 86 1 Y 1 B LYS 77 ? CE ? B LYS 77 CE 87 1 Y 1 B LYS 77 ? NZ ? B LYS 77 NZ 88 1 Y 1 B GLU 80 ? CD ? B GLU 80 CD 89 1 Y 1 B GLU 80 ? OE1 ? B GLU 80 OE1 90 1 Y 1 B GLU 80 ? OE2 ? B GLU 80 OE2 91 1 Y 1 B GLU 81 ? CD ? B GLU 81 CD 92 1 Y 1 B GLU 81 ? OE1 ? B GLU 81 OE1 93 1 Y 1 B GLU 81 ? OE2 ? B GLU 81 OE2 94 1 Y 1 B LYS 83 ? CG ? B LYS 83 CG 95 1 Y 1 B LYS 83 ? CD ? B LYS 83 CD 96 1 Y 1 B LYS 83 ? CE ? B LYS 83 CE 97 1 Y 1 B LYS 83 ? NZ ? B LYS 83 NZ 98 1 Y 1 B LYS 84 ? CD ? B LYS 84 CD 99 1 Y 1 B LYS 84 ? CE ? B LYS 84 CE 100 1 Y 1 B LYS 84 ? NZ ? B LYS 84 NZ 101 1 Y 1 B GLN 85 ? CD ? B GLN 85 CD 102 1 Y 1 B GLN 85 ? OE1 ? B GLN 85 OE1 103 1 Y 1 B GLN 85 ? NE2 ? B GLN 85 NE2 104 1 Y 1 B LYS 87 ? CE ? B LYS 87 CE 105 1 Y 1 B LYS 87 ? NZ ? B LYS 87 NZ 106 1 Y 1 B ASP 88 ? OD1 ? B ASP 88 OD1 107 1 Y 1 B ASP 88 ? OD2 ? B ASP 88 OD2 108 1 Y 1 B LYS 90 ? CD ? B LYS 90 CD 109 1 Y 1 B LYS 90 ? CE ? B LYS 90 CE 110 1 Y 1 B LYS 90 ? NZ ? B LYS 90 NZ 111 1 Y 1 B ARG 91 ? CD ? B ARG 91 CD 112 1 Y 1 B ARG 91 ? NE ? B ARG 91 NE 113 1 Y 1 B ARG 91 ? CZ ? B ARG 91 CZ 114 1 Y 1 B ARG 91 ? NH1 ? B ARG 91 NH1 115 1 Y 1 B ARG 91 ? NH2 ? B ARG 91 NH2 116 1 Y 1 C SER 2 ? OG ? C SER 2 OG 117 1 Y 1 C MET 4 ? CE ? C MET 4 CE 118 1 Y 1 C LYS 8 ? CD ? C LYS 8 CD 119 1 Y 1 C LYS 8 ? CE ? C LYS 8 CE 120 1 Y 1 C LYS 8 ? NZ ? C LYS 8 NZ 121 1 Y 1 C GLU 12 ? CG ? C GLU 12 CG 122 1 Y 1 C GLU 12 ? CD ? C GLU 12 CD 123 1 Y 1 C GLU 12 ? OE1 ? C GLU 12 OE1 124 1 Y 1 C GLU 12 ? OE2 ? C GLU 12 OE2 125 1 Y 1 C ARG 13 ? NE ? C ARG 13 NE 126 1 Y 1 C ARG 13 ? CZ ? C ARG 13 CZ 127 1 Y 1 C ARG 13 ? NH1 ? C ARG 13 NH1 128 1 Y 1 C ARG 13 ? NH2 ? C ARG 13 NH2 129 1 Y 1 C GLU 16 ? CD ? C GLU 16 CD 130 1 Y 1 C GLU 16 ? OE1 ? C GLU 16 OE1 131 1 Y 1 C GLU 16 ? OE2 ? C GLU 16 OE2 132 1 Y 1 C GLU 19 ? CG ? C GLU 19 CG 133 1 Y 1 C GLU 19 ? CD ? C GLU 19 CD 134 1 Y 1 C GLU 19 ? OE1 ? C GLU 19 OE1 135 1 Y 1 C GLU 19 ? OE2 ? C GLU 19 OE2 136 1 Y 1 C GLU 23 ? CG ? C GLU 23 CG 137 1 Y 1 C GLU 23 ? CD ? C GLU 23 CD 138 1 Y 1 C GLU 23 ? OE1 ? C GLU 23 OE1 139 1 Y 1 C GLU 23 ? OE2 ? C GLU 23 OE2 140 1 Y 1 C ASN 24 ? CG ? C ASN 24 CG 141 1 Y 1 C ASN 24 ? OD1 ? C ASN 24 OD1 142 1 Y 1 C ASN 24 ? ND2 ? C ASN 24 ND2 143 1 Y 1 C LYS 28 ? CG ? C LYS 28 CG 144 1 Y 1 C LYS 28 ? CD ? C LYS 28 CD 145 1 Y 1 C LYS 28 ? CE ? C LYS 28 CE 146 1 Y 1 C LYS 28 ? NZ ? C LYS 28 NZ 147 1 Y 1 C LYS 77 ? CG ? C LYS 77 CG 148 1 Y 1 C LYS 77 ? CD ? C LYS 77 CD 149 1 Y 1 C LYS 77 ? CE ? C LYS 77 CE 150 1 Y 1 C LYS 77 ? NZ ? C LYS 77 NZ 151 1 Y 1 C GLU 80 ? CD ? C GLU 80 CD 152 1 Y 1 C GLU 80 ? OE1 ? C GLU 80 OE1 153 1 Y 1 C GLU 80 ? OE2 ? C GLU 80 OE2 154 1 Y 1 C LYS 83 ? CG ? C LYS 83 CG 155 1 Y 1 C LYS 83 ? CD ? C LYS 83 CD 156 1 Y 1 C LYS 83 ? CE ? C LYS 83 CE 157 1 Y 1 C LYS 83 ? NZ ? C LYS 83 NZ 158 1 Y 1 C LYS 84 ? CG ? C LYS 84 CG 159 1 Y 1 C LYS 84 ? CD ? C LYS 84 CD 160 1 Y 1 C LYS 84 ? CE ? C LYS 84 CE 161 1 Y 1 C LYS 84 ? NZ ? C LYS 84 NZ 162 1 Y 1 C GLN 85 ? CD ? C GLN 85 CD 163 1 Y 1 C GLN 85 ? OE1 ? C GLN 85 OE1 164 1 Y 1 C GLN 85 ? NE2 ? C GLN 85 NE2 165 1 Y 1 C LYS 87 ? CG ? C LYS 87 CG 166 1 Y 1 C LYS 87 ? CD ? C LYS 87 CD 167 1 Y 1 C LYS 87 ? CE ? C LYS 87 CE 168 1 Y 1 C LYS 87 ? NZ ? C LYS 87 NZ 169 1 Y 1 C ASP 88 ? OD1 ? C ASP 88 OD1 170 1 Y 1 C ASP 88 ? OD2 ? C ASP 88 OD2 171 1 Y 1 C LYS 90 ? CD ? C LYS 90 CD 172 1 Y 1 C LYS 90 ? CE ? C LYS 90 CE 173 1 Y 1 C LYS 90 ? NZ ? C LYS 90 NZ 174 1 Y 1 C ARG 91 ? CD ? C ARG 91 CD 175 1 Y 1 C ARG 91 ? NE ? C ARG 91 NE 176 1 Y 1 C ARG 91 ? CZ ? C ARG 91 CZ 177 1 Y 1 C ARG 91 ? NH1 ? C ARG 91 NH1 178 1 Y 1 C ARG 91 ? NH2 ? C ARG 91 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 110.080 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6NZ3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 88.741 _cell.length_a_esd ? _cell.length_b 51.271 _cell.length_b_esd ? _cell.length_c 85.873 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6NZ3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6NZ3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.79 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.92 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 10.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M CAPS pH 10.5, 40% (v/v) MPD' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-09-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.1111 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.1111 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6NZ3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.66 _reflns.d_resolution_low 80.66 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 34486 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 80.71 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.9 _reflns.pdbx_Rmerge_I_obs 0.035 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.039 _reflns.pdbx_Rpim_I_all 0.015 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.66 _reflns_shell.d_res_low 1.72 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1008 _reflns_shell.percent_possible_all 23.64 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 149.430 _refine.B_iso_mean 69.3967 _refine.B_iso_min 40.690 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6NZ3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3000 _refine.ls_d_res_low 80.6550 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16014 _refine.ls_number_reflns_R_free 922 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.0300 _refine.ls_percent_reflns_R_free 5.7600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2641 _refine.ls_R_factor_R_free 0.3017 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2620 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.8900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.3000 _refine_hist.d_res_low 80.6550 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 2041 _refine_hist.pdbx_number_residues_total 275 _refine_hist.pdbx_B_iso_mean_ligand 56.69 _refine_hist.pdbx_B_iso_mean_solvent 60.62 _refine_hist.pdbx_number_atoms_protein 2030 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3000 2.4213 2223 . 135 2088 96.0000 . . . 0.2913 0.0000 0.2586 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.4213 2.5730 2265 . 127 2138 97.0000 . . . 0.3548 0.0000 0.2764 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.5730 2.7716 2252 . 130 2122 98.0000 . . . 0.3953 0.0000 0.2995 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.7716 3.0506 2307 . 126 2181 99.0000 . . . 0.3478 0.0000 0.2926 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.0506 3.4920 2286 . 130 2156 99.0000 . . . 0.3013 0.0000 0.2847 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.4920 4.3995 2334 . 142 2192 100.0000 . . . 0.2530 0.0000 0.2339 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 4.3995 80.7048 2347 . 132 2215 97.0000 . . . 0.3102 0.0000 0.2564 . . . . . . 7 . . . # _struct.entry_id 6NZ3 _struct.title 'Crystal structure of computationally designed protein XAA_GGHN' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6NZ3 _struct_keywords.text 'homotrimer, helix, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 3 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6NZ3 _struct_ref.pdbx_db_accession 6NZ3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6NZ3 A 1 ? 96 ? 6NZ3 1 ? 96 ? 1 96 2 1 6NZ3 B 1 ? 96 ? 6NZ3 1 ? 96 ? 1 96 3 1 6NZ3 C 1 ? 96 ? 6NZ3 1 ? 96 ? 1 96 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9000 ? 1 MORE -110 ? 1 'SSA (A^2)' 13730 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? ASN A 24 ? SER A 2 ASN A 24 1 ? 23 HELX_P HELX_P2 AA2 SER A 26 ? LEU A 93 ? SER A 26 LEU A 93 1 ? 68 HELX_P HELX_P3 AA3 MET B 4 ? ASN B 24 ? MET B 4 ASN B 24 1 ? 21 HELX_P HELX_P4 AA4 SER B 26 ? LEU B 93 ? SER B 26 LEU B 93 1 ? 68 HELX_P HELX_P5 AA5 HIS C 3 ? ASN C 24 ? HIS C 3 ASN C 24 1 ? 22 HELX_P HELX_P6 AA6 SER C 26 ? LEU C 93 ? SER C 26 LEU C 93 1 ? 68 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CL _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'binding site for residue CL A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ASN A 61 ? ASN A 61 . ? 1_555 ? 2 AC1 3 ASN B 61 ? ASN B 61 . ? 1_555 ? 3 AC1 3 ASN C 61 ? ASN C 61 . ? 1_555 ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A GLU 94 ? A GLU 94 3 1 Y 1 A ARG 95 ? A ARG 95 4 1 Y 1 A GLY 96 ? A GLY 96 5 1 Y 1 B GLY 1 ? B GLY 1 6 1 Y 1 B SER 2 ? B SER 2 7 1 Y 1 B GLU 94 ? B GLU 94 8 1 Y 1 B ARG 95 ? B ARG 95 9 1 Y 1 B GLY 96 ? B GLY 96 10 1 Y 1 C GLY 1 ? C GLY 1 11 1 Y 1 C GLU 94 ? C GLU 94 12 1 Y 1 C ARG 95 ? C ARG 95 13 1 Y 1 C GLY 96 ? C GLY 96 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MET N N N N 217 MET CA C N S 218 MET C C N N 219 MET O O N N 220 MET CB C N N 221 MET CG C N N 222 MET SD S N N 223 MET CE C N N 224 MET OXT O N N 225 MET H H N N 226 MET H2 H N N 227 MET HA H N N 228 MET HB2 H N N 229 MET HB3 H N N 230 MET HG2 H N N 231 MET HG3 H N N 232 MET HE1 H N N 233 MET HE2 H N N 234 MET HE3 H N N 235 MET HXT H N N 236 PRO N N N N 237 PRO CA C N S 238 PRO C C N N 239 PRO O O N N 240 PRO CB C N N 241 PRO CG C N N 242 PRO CD C N N 243 PRO OXT O N N 244 PRO H H N N 245 PRO HA H N N 246 PRO HB2 H N N 247 PRO HB3 H N N 248 PRO HG2 H N N 249 PRO HG3 H N N 250 PRO HD2 H N N 251 PRO HD3 H N N 252 PRO HXT H N N 253 SER N N N N 254 SER CA C N S 255 SER C C N N 256 SER O O N N 257 SER CB C N N 258 SER OG O N N 259 SER OXT O N N 260 SER H H N N 261 SER H2 H N N 262 SER HA H N N 263 SER HB2 H N N 264 SER HB3 H N N 265 SER HG H N N 266 SER HXT H N N 267 TYR N N N N 268 TYR CA C N S 269 TYR C C N N 270 TYR O O N N 271 TYR CB C N N 272 TYR CG C Y N 273 TYR CD1 C Y N 274 TYR CD2 C Y N 275 TYR CE1 C Y N 276 TYR CE2 C Y N 277 TYR CZ C Y N 278 TYR OH O N N 279 TYR OXT O N N 280 TYR H H N N 281 TYR H2 H N N 282 TYR HA H N N 283 TYR HB2 H N N 284 TYR HB3 H N N 285 TYR HD1 H N N 286 TYR HD2 H N N 287 TYR HE1 H N N 288 TYR HE2 H N N 289 TYR HH H N N 290 TYR HXT H N N 291 VAL N N N N 292 VAL CA C N S 293 VAL C C N N 294 VAL O O N N 295 VAL CB C N N 296 VAL CG1 C N N 297 VAL CG2 C N N 298 VAL OXT O N N 299 VAL H H N N 300 VAL H2 H N N 301 VAL HA H N N 302 VAL HB H N N 303 VAL HG11 H N N 304 VAL HG12 H N N 305 VAL HG13 H N N 306 VAL HG21 H N N 307 VAL HG22 H N N 308 VAL HG23 H N N 309 VAL HXT H N N 310 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 TYR N CA sing N N 254 TYR N H sing N N 255 TYR N H2 sing N N 256 TYR CA C sing N N 257 TYR CA CB sing N N 258 TYR CA HA sing N N 259 TYR C O doub N N 260 TYR C OXT sing N N 261 TYR CB CG sing N N 262 TYR CB HB2 sing N N 263 TYR CB HB3 sing N N 264 TYR CG CD1 doub Y N 265 TYR CG CD2 sing Y N 266 TYR CD1 CE1 sing Y N 267 TYR CD1 HD1 sing N N 268 TYR CD2 CE2 doub Y N 269 TYR CD2 HD2 sing N N 270 TYR CE1 CZ doub Y N 271 TYR CE1 HE1 sing N N 272 TYR CE2 CZ sing Y N 273 TYR CE2 HE2 sing N N 274 TYR CZ OH sing N N 275 TYR OH HH sing N N 276 TYR OXT HXT sing N N 277 VAL N CA sing N N 278 VAL N H sing N N 279 VAL N H2 sing N N 280 VAL CA C sing N N 281 VAL CA CB sing N N 282 VAL CA HA sing N N 283 VAL C O doub N N 284 VAL C OXT sing N N 285 VAL CB CG1 sing N N 286 VAL CB CG2 sing N N 287 VAL CB HB sing N N 288 VAL CG1 HG11 sing N N 289 VAL CG1 HG12 sing N N 290 VAL CG1 HG13 sing N N 291 VAL CG2 HG21 sing N N 292 VAL CG2 HG22 sing N N 293 VAL CG2 HG23 sing N N 294 VAL OXT HXT sing N N 295 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'P30 GM124169' 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'R01 GM124149' 2 # _atom_sites.entry_id 6NZ3 _atom_sites.fract_transf_matrix[1][1] 0.011269 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004118 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019504 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012398 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL H N O S # loop_