data_6O0C # _entry.id 6O0C # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6O0C pdb_00006o0c 10.2210/pdb6o0c/pdb WWPDB D_1000239487 ? ? BMRB 30573 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR ensemble of computationally designed protein XAA_GVDQ mutant M4L' _pdbx_database_related.db_id 30573 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6O0C _pdbx_database_status.recvd_initial_deposition_date 2019-02-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wei, K.Y.' 1 0000-0002-8794-1385 'Moschidi, D.' 2 ? 'Nerli, S.' 3 ? 'Sgourakis, N.' 4 0000-0003-3655-3902 'Baker, D.' 5 0000-0001-7896-6217 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 117 _citation.language ? _citation.page_first 7208 _citation.page_last 7215 _citation.title 'Computational design of closely related proteins that adopt two well-defined but structurally divergent folds.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1914808117 _citation.pdbx_database_id_PubMed 32188784 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wei, K.Y.' 1 0000-0002-8794-1385 primary 'Moschidi, D.' 2 0000-0003-2186-7693 primary 'Bick, M.J.' 3 0000-0002-9585-859X primary 'Nerli, S.' 4 0000-0001-6573-8661 primary 'McShan, A.C.' 5 0000-0002-3212-9867 primary 'Carter, L.P.' 6 ? primary 'Huang, P.S.' 7 0000-0002-7948-2895 primary 'Fletcher, D.A.' 8 0000-0002-1890-5364 primary 'Sgourakis, N.G.' 9 0000-0003-3655-3902 primary 'Boyken, S.E.' 10 0000-0002-5378-0632 primary 'Baker, D.' 11 0000-0001-7896-6217 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Design construct XAA_GVDQ mutant M4L' _entity.formula_weight 10973.532 _entity.pdbx_number_of_molecules 3 _entity.pdbx_ec ? _entity.pdbx_mutation M4L _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHLGDLKYSLERLREILERLEENPSEKQIVEAIRAIVENNAQIVEAIRAIVENNAQIVENNRAIIEALEAIGVDQKILE EMKKQLKDLKRSLERG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHLGDLKYSLERLREILERLEENPSEKQIVEAIRAIVENNAQIVEAIRAIVENNAQIVENNRAIIEALEAIGVDQKILE EMKKQLKDLKRSLERG ; _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 LEU n 1 5 GLY n 1 6 ASP n 1 7 LEU n 1 8 LYS n 1 9 TYR n 1 10 SER n 1 11 LEU n 1 12 GLU n 1 13 ARG n 1 14 LEU n 1 15 ARG n 1 16 GLU n 1 17 ILE n 1 18 LEU n 1 19 GLU n 1 20 ARG n 1 21 LEU n 1 22 GLU n 1 23 GLU n 1 24 ASN n 1 25 PRO n 1 26 SER n 1 27 GLU n 1 28 LYS n 1 29 GLN n 1 30 ILE n 1 31 VAL n 1 32 GLU n 1 33 ALA n 1 34 ILE n 1 35 ARG n 1 36 ALA n 1 37 ILE n 1 38 VAL n 1 39 GLU n 1 40 ASN n 1 41 ASN n 1 42 ALA n 1 43 GLN n 1 44 ILE n 1 45 VAL n 1 46 GLU n 1 47 ALA n 1 48 ILE n 1 49 ARG n 1 50 ALA n 1 51 ILE n 1 52 VAL n 1 53 GLU n 1 54 ASN n 1 55 ASN n 1 56 ALA n 1 57 GLN n 1 58 ILE n 1 59 VAL n 1 60 GLU n 1 61 ASN n 1 62 ASN n 1 63 ARG n 1 64 ALA n 1 65 ILE n 1 66 ILE n 1 67 GLU n 1 68 ALA n 1 69 LEU n 1 70 GLU n 1 71 ALA n 1 72 ILE n 1 73 GLY n 1 74 VAL n 1 75 ASP n 1 76 GLN n 1 77 LYS n 1 78 ILE n 1 79 LEU n 1 80 GLU n 1 81 GLU n 1 82 MET n 1 83 LYS n 1 84 LYS n 1 85 GLN n 1 86 LEU n 1 87 LYS n 1 88 ASP n 1 89 LEU n 1 90 LYS n 1 91 ARG n 1 92 SER n 1 93 LEU n 1 94 GLU n 1 95 ARG n 1 96 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 96 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6O0C _struct_ref.pdbx_db_accession 6O0C _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6O0C A 1 ? 96 ? 6O0C 1 ? 96 ? 1 96 2 1 6O0C B 1 ? 96 ? 6O0C 1 ? 96 ? 1 96 3 1 6O0C C 1 ? 96 ? 6O0C 1 ? 96 ? 1 96 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-13C HSQC' 1 isotropic 2 1 1 '3D CM-CMHM NOESY' 1 isotropic 3 1 1 '3D CM-NHN NOESY' 1 isotropic 4 1 1 '3D HNHa-CMHM NOESY' 1 isotropic 6 1 2 '2D 1H-15N HSQC' 1 isotropic 7 1 2 '3D HNCO' 1 isotropic 9 1 2 '3D HNCA' 1 isotropic 8 1 2 '3D HNCACB' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310.15 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM NaCl' _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 'conditions_k170_MAI(LV)proS' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '600 uM U-[15N, 12C, 2H] 13Ce Met 13Cb Ala 13Cd1 Ile 13Cd2 Leu 13Cg2 Val k170_MAI(LV)proS, 95% H2O/5% D2O' '95% H2O/5% D2O' 'k170_MAI(LV)proS' solution 'NMR buffer 20mM Sodium Phosphate pH 6.2 100mM NaCl, 0.01% NaN3, 1 U Roche protease inhibitor cocktail' 2 '400 uM U-[15N, 13C, 2H] k170_ILVstar, 95% H2O/5% D2O' '95% H2O/5% D2O' k170_ILVstar solution 'NMR buffer 20mM Sodium Phosphate pH 6.2 100mM NaCl, 0.01% NaN3, 1 U Roche protease inhibitor cocktail' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details 'TCI cryoprobe' # _pdbx_nmr_refine.entry_id 6O0C _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6O0C _pdbx_nmr_ensemble.conformers_calculated_total_number 5000 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'back calculated data agree with experimental NOESY spectrum' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6O0C _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement Rosetta ? 'Rohl CA, Strauss CE, Misura KM, Baker D' 2 'data analysis' Sparky ? Goddard 5 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'chemical shift assignment' Sparky ? Goddard 4 'structure calculation' Rosetta ? 'Rohl CA, Strauss CE, Misura KM, Baker D' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6O0C _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6O0C _struct.title 'NMR ensemble of computationally designed protein XAA_GVDQ mutant M4L' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6O0C _struct_keywords.text 'de novo protein' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 3 ? ASN A 24 ? HIS A 3 ASN A 24 1 ? 22 HELX_P HELX_P2 AA2 SER A 26 ? ILE A 72 ? SER A 26 ILE A 72 1 ? 47 HELX_P HELX_P3 AA3 ASP A 75 ? GLU A 94 ? ASP A 75 GLU A 94 1 ? 20 HELX_P HELX_P4 AA4 HIS B 3 ? ASN B 24 ? HIS B 3 ASN B 24 1 ? 22 HELX_P HELX_P5 AA5 SER B 26 ? ILE B 72 ? SER B 26 ILE B 72 1 ? 47 HELX_P HELX_P6 AA6 ASP B 75 ? GLU B 94 ? ASP B 75 GLU B 94 1 ? 20 HELX_P HELX_P7 AA7 HIS C 3 ? ASN C 24 ? HIS C 3 ASN C 24 1 ? 22 HELX_P HELX_P8 AA8 SER C 26 ? ILE C 72 ? SER C 26 ILE C 72 1 ? 47 HELX_P HELX_P9 AA9 ASP C 75 ? GLU C 94 ? ASP C 75 GLU C 94 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 6O0C _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 GLY 96 96 96 GLY GLY A . n B 1 1 GLY 1 1 1 GLY GLY B . n B 1 2 SER 2 2 2 SER SER B . n B 1 3 HIS 3 3 3 HIS HIS B . n B 1 4 LEU 4 4 4 LEU LEU B . n B 1 5 GLY 5 5 5 GLY GLY B . n B 1 6 ASP 6 6 6 ASP ASP B . n B 1 7 LEU 7 7 7 LEU LEU B . n B 1 8 LYS 8 8 8 LYS LYS B . n B 1 9 TYR 9 9 9 TYR TYR B . n B 1 10 SER 10 10 10 SER SER B . n B 1 11 LEU 11 11 11 LEU LEU B . n B 1 12 GLU 12 12 12 GLU GLU B . n B 1 13 ARG 13 13 13 ARG ARG B . n B 1 14 LEU 14 14 14 LEU LEU B . n B 1 15 ARG 15 15 15 ARG ARG B . n B 1 16 GLU 16 16 16 GLU GLU B . n B 1 17 ILE 17 17 17 ILE ILE B . n B 1 18 LEU 18 18 18 LEU LEU B . n B 1 19 GLU 19 19 19 GLU GLU B . n B 1 20 ARG 20 20 20 ARG ARG B . n B 1 21 LEU 21 21 21 LEU LEU B . n B 1 22 GLU 22 22 22 GLU GLU B . n B 1 23 GLU 23 23 23 GLU GLU B . n B 1 24 ASN 24 24 24 ASN ASN B . n B 1 25 PRO 25 25 25 PRO PRO B . n B 1 26 SER 26 26 26 SER SER B . n B 1 27 GLU 27 27 27 GLU GLU B . n B 1 28 LYS 28 28 28 LYS LYS B . n B 1 29 GLN 29 29 29 GLN GLN B . n B 1 30 ILE 30 30 30 ILE ILE B . n B 1 31 VAL 31 31 31 VAL VAL B . n B 1 32 GLU 32 32 32 GLU GLU B . n B 1 33 ALA 33 33 33 ALA ALA B . n B 1 34 ILE 34 34 34 ILE ILE B . n B 1 35 ARG 35 35 35 ARG ARG B . n B 1 36 ALA 36 36 36 ALA ALA B . n B 1 37 ILE 37 37 37 ILE ILE B . n B 1 38 VAL 38 38 38 VAL VAL B . n B 1 39 GLU 39 39 39 GLU GLU B . n B 1 40 ASN 40 40 40 ASN ASN B . n B 1 41 ASN 41 41 41 ASN ASN B . n B 1 42 ALA 42 42 42 ALA ALA B . n B 1 43 GLN 43 43 43 GLN GLN B . n B 1 44 ILE 44 44 44 ILE ILE B . n B 1 45 VAL 45 45 45 VAL VAL B . n B 1 46 GLU 46 46 46 GLU GLU B . n B 1 47 ALA 47 47 47 ALA ALA B . n B 1 48 ILE 48 48 48 ILE ILE B . n B 1 49 ARG 49 49 49 ARG ARG B . n B 1 50 ALA 50 50 50 ALA ALA B . n B 1 51 ILE 51 51 51 ILE ILE B . n B 1 52 VAL 52 52 52 VAL VAL B . n B 1 53 GLU 53 53 53 GLU GLU B . n B 1 54 ASN 54 54 54 ASN ASN B . n B 1 55 ASN 55 55 55 ASN ASN B . n B 1 56 ALA 56 56 56 ALA ALA B . n B 1 57 GLN 57 57 57 GLN GLN B . n B 1 58 ILE 58 58 58 ILE ILE B . n B 1 59 VAL 59 59 59 VAL VAL B . n B 1 60 GLU 60 60 60 GLU GLU B . n B 1 61 ASN 61 61 61 ASN ASN B . n B 1 62 ASN 62 62 62 ASN ASN B . n B 1 63 ARG 63 63 63 ARG ARG B . n B 1 64 ALA 64 64 64 ALA ALA B . n B 1 65 ILE 65 65 65 ILE ILE B . n B 1 66 ILE 66 66 66 ILE ILE B . n B 1 67 GLU 67 67 67 GLU GLU B . n B 1 68 ALA 68 68 68 ALA ALA B . n B 1 69 LEU 69 69 69 LEU LEU B . n B 1 70 GLU 70 70 70 GLU GLU B . n B 1 71 ALA 71 71 71 ALA ALA B . n B 1 72 ILE 72 72 72 ILE ILE B . n B 1 73 GLY 73 73 73 GLY GLY B . n B 1 74 VAL 74 74 74 VAL VAL B . n B 1 75 ASP 75 75 75 ASP ASP B . n B 1 76 GLN 76 76 76 GLN GLN B . n B 1 77 LYS 77 77 77 LYS LYS B . n B 1 78 ILE 78 78 78 ILE ILE B . n B 1 79 LEU 79 79 79 LEU LEU B . n B 1 80 GLU 80 80 80 GLU GLU B . n B 1 81 GLU 81 81 81 GLU GLU B . n B 1 82 MET 82 82 82 MET MET B . n B 1 83 LYS 83 83 83 LYS LYS B . n B 1 84 LYS 84 84 84 LYS LYS B . n B 1 85 GLN 85 85 85 GLN GLN B . n B 1 86 LEU 86 86 86 LEU LEU B . n B 1 87 LYS 87 87 87 LYS LYS B . n B 1 88 ASP 88 88 88 ASP ASP B . n B 1 89 LEU 89 89 89 LEU LEU B . n B 1 90 LYS 90 90 90 LYS LYS B . n B 1 91 ARG 91 91 91 ARG ARG B . n B 1 92 SER 92 92 92 SER SER B . n B 1 93 LEU 93 93 93 LEU LEU B . n B 1 94 GLU 94 94 94 GLU GLU B . n B 1 95 ARG 95 95 95 ARG ARG B . n B 1 96 GLY 96 96 96 GLY GLY B . n C 1 1 GLY 1 1 1 GLY GLY C . n C 1 2 SER 2 2 2 SER SER C . n C 1 3 HIS 3 3 3 HIS HIS C . n C 1 4 LEU 4 4 4 LEU LEU C . n C 1 5 GLY 5 5 5 GLY GLY C . n C 1 6 ASP 6 6 6 ASP ASP C . n C 1 7 LEU 7 7 7 LEU LEU C . n C 1 8 LYS 8 8 8 LYS LYS C . n C 1 9 TYR 9 9 9 TYR TYR C . n C 1 10 SER 10 10 10 SER SER C . n C 1 11 LEU 11 11 11 LEU LEU C . n C 1 12 GLU 12 12 12 GLU GLU C . n C 1 13 ARG 13 13 13 ARG ARG C . n C 1 14 LEU 14 14 14 LEU LEU C . n C 1 15 ARG 15 15 15 ARG ARG C . n C 1 16 GLU 16 16 16 GLU GLU C . n C 1 17 ILE 17 17 17 ILE ILE C . n C 1 18 LEU 18 18 18 LEU LEU C . n C 1 19 GLU 19 19 19 GLU GLU C . n C 1 20 ARG 20 20 20 ARG ARG C . n C 1 21 LEU 21 21 21 LEU LEU C . n C 1 22 GLU 22 22 22 GLU GLU C . n C 1 23 GLU 23 23 23 GLU GLU C . n C 1 24 ASN 24 24 24 ASN ASN C . n C 1 25 PRO 25 25 25 PRO PRO C . n C 1 26 SER 26 26 26 SER SER C . n C 1 27 GLU 27 27 27 GLU GLU C . n C 1 28 LYS 28 28 28 LYS LYS C . n C 1 29 GLN 29 29 29 GLN GLN C . n C 1 30 ILE 30 30 30 ILE ILE C . n C 1 31 VAL 31 31 31 VAL VAL C . n C 1 32 GLU 32 32 32 GLU GLU C . n C 1 33 ALA 33 33 33 ALA ALA C . n C 1 34 ILE 34 34 34 ILE ILE C . n C 1 35 ARG 35 35 35 ARG ARG C . n C 1 36 ALA 36 36 36 ALA ALA C . n C 1 37 ILE 37 37 37 ILE ILE C . n C 1 38 VAL 38 38 38 VAL VAL C . n C 1 39 GLU 39 39 39 GLU GLU C . n C 1 40 ASN 40 40 40 ASN ASN C . n C 1 41 ASN 41 41 41 ASN ASN C . n C 1 42 ALA 42 42 42 ALA ALA C . n C 1 43 GLN 43 43 43 GLN GLN C . n C 1 44 ILE 44 44 44 ILE ILE C . n C 1 45 VAL 45 45 45 VAL VAL C . n C 1 46 GLU 46 46 46 GLU GLU C . n C 1 47 ALA 47 47 47 ALA ALA C . n C 1 48 ILE 48 48 48 ILE ILE C . n C 1 49 ARG 49 49 49 ARG ARG C . n C 1 50 ALA 50 50 50 ALA ALA C . n C 1 51 ILE 51 51 51 ILE ILE C . n C 1 52 VAL 52 52 52 VAL VAL C . n C 1 53 GLU 53 53 53 GLU GLU C . n C 1 54 ASN 54 54 54 ASN ASN C . n C 1 55 ASN 55 55 55 ASN ASN C . n C 1 56 ALA 56 56 56 ALA ALA C . n C 1 57 GLN 57 57 57 GLN GLN C . n C 1 58 ILE 58 58 58 ILE ILE C . n C 1 59 VAL 59 59 59 VAL VAL C . n C 1 60 GLU 60 60 60 GLU GLU C . n C 1 61 ASN 61 61 61 ASN ASN C . n C 1 62 ASN 62 62 62 ASN ASN C . n C 1 63 ARG 63 63 63 ARG ARG C . n C 1 64 ALA 64 64 64 ALA ALA C . n C 1 65 ILE 65 65 65 ILE ILE C . n C 1 66 ILE 66 66 66 ILE ILE C . n C 1 67 GLU 67 67 67 GLU GLU C . n C 1 68 ALA 68 68 68 ALA ALA C . n C 1 69 LEU 69 69 69 LEU LEU C . n C 1 70 GLU 70 70 70 GLU GLU C . n C 1 71 ALA 71 71 71 ALA ALA C . n C 1 72 ILE 72 72 72 ILE ILE C . n C 1 73 GLY 73 73 73 GLY GLY C . n C 1 74 VAL 74 74 74 VAL VAL C . n C 1 75 ASP 75 75 75 ASP ASP C . n C 1 76 GLN 76 76 76 GLN GLN C . n C 1 77 LYS 77 77 77 LYS LYS C . n C 1 78 ILE 78 78 78 ILE ILE C . n C 1 79 LEU 79 79 79 LEU LEU C . n C 1 80 GLU 80 80 80 GLU GLU C . n C 1 81 GLU 81 81 81 GLU GLU C . n C 1 82 MET 82 82 82 MET MET C . n C 1 83 LYS 83 83 83 LYS LYS C . n C 1 84 LYS 84 84 84 LYS LYS C . n C 1 85 GLN 85 85 85 GLN GLN C . n C 1 86 LEU 86 86 86 LEU LEU C . n C 1 87 LYS 87 87 87 LYS LYS C . n C 1 88 ASP 88 88 88 ASP ASP C . n C 1 89 LEU 89 89 89 LEU LEU C . n C 1 90 LYS 90 90 90 LYS LYS C . n C 1 91 ARG 91 91 91 ARG ARG C . n C 1 92 SER 92 92 92 SER SER C . n C 1 93 LEU 93 93 93 LEU LEU C . n C 1 94 GLU 94 94 94 GLU GLU C . n C 1 95 ARG 95 95 95 ARG ARG C . n C 1 96 GLY 96 96 96 GLY GLY C . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 8350 ? 1 MORE -90 ? 1 'SSA (A^2)' 14310 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-22 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'k170_MAI(LV)proS' 600 ? uM 'U-[15N, 12C, 2H] 13Ce Met 13Cb Ala 13Cd1 Ile 13Cd2 Leu 13Cg2 Val' 2 k170_ILVstar 400 ? uM 'U-[15N, 13C, 2H]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 5 ASP A 75 ? ? -37.86 131.90 2 5 ASP B 75 ? ? -37.90 131.89 3 5 ASP C 75 ? ? -37.89 131.90 4 7 ASP A 75 ? ? -37.77 134.63 5 7 ASP B 75 ? ? -37.77 134.62 6 7 ASP C 75 ? ? -37.81 134.69 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Human Genome Research Institute (NIH/NHGRI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R01AI143997 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? #