data_6O1Q # _entry.id 6O1Q # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.313 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6O1Q WWPDB D_1000239865 BMRB 30575 # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'The putative coiled coil domain of NPHP1 folds as a three helix bundle' _pdbx_database_related.db_id 30575 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6O1Q _pdbx_database_status.recvd_initial_deposition_date 2019-02-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Musco, G.' 1 ? 'Mannella, V.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Chem.Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1554-8937 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 1845 _citation.page_last 1854 _citation.title ;The N-Terminal Domain of NPHP1 Folds into a Monomeric Left-Handed Antiparallel Three-Stranded Coiled Coil with Anti-apoptotic Function. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acschembio.9b00582 _citation.pdbx_database_id_PubMed 31345020 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mannella, V.' 1 ? primary 'Quilici, G.' 2 ? primary 'Nigro, E.A.' 3 ? primary 'Lampis, M.' 4 ? primary 'Minici, C.' 5 ? primary 'Degano, M.' 6 ? primary 'Boletta, A.' 7 ? primary 'Musco, G.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Nephrocystin-1 _entity.formula_weight 13676.493 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal residues 1-115' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Juvenile nephronophthisis 1 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPMAMLARRQRDPLQALRRRNQELKQQVDSLLSESQLKEALEPNKRQHIYQRCIQLKQAIDENKNALQKLSKADESAPVA NYNQRKEEEHTLLDKLTQQLQGLAVTISRENITEVGAPT ; _entity_poly.pdbx_seq_one_letter_code_can ;GPMAMLARRQRDPLQALRRRNQELKQQVDSLLSESQLKEALEPNKRQHIYQRCIQLKQAIDENKNALQKLSKADESAPVA NYNQRKEEEHTLLDKLTQQLQGLAVTISRENITEVGAPT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 MET n 1 4 ALA n 1 5 MET n 1 6 LEU n 1 7 ALA n 1 8 ARG n 1 9 ARG n 1 10 GLN n 1 11 ARG n 1 12 ASP n 1 13 PRO n 1 14 LEU n 1 15 GLN n 1 16 ALA n 1 17 LEU n 1 18 ARG n 1 19 ARG n 1 20 ARG n 1 21 ASN n 1 22 GLN n 1 23 GLU n 1 24 LEU n 1 25 LYS n 1 26 GLN n 1 27 GLN n 1 28 VAL n 1 29 ASP n 1 30 SER n 1 31 LEU n 1 32 LEU n 1 33 SER n 1 34 GLU n 1 35 SER n 1 36 GLN n 1 37 LEU n 1 38 LYS n 1 39 GLU n 1 40 ALA n 1 41 LEU n 1 42 GLU n 1 43 PRO n 1 44 ASN n 1 45 LYS n 1 46 ARG n 1 47 GLN n 1 48 HIS n 1 49 ILE n 1 50 TYR n 1 51 GLN n 1 52 ARG n 1 53 CYS n 1 54 ILE n 1 55 GLN n 1 56 LEU n 1 57 LYS n 1 58 GLN n 1 59 ALA n 1 60 ILE n 1 61 ASP n 1 62 GLU n 1 63 ASN n 1 64 LYS n 1 65 ASN n 1 66 ALA n 1 67 LEU n 1 68 GLN n 1 69 LYS n 1 70 LEU n 1 71 SER n 1 72 LYS n 1 73 ALA n 1 74 ASP n 1 75 GLU n 1 76 SER n 1 77 ALA n 1 78 PRO n 1 79 VAL n 1 80 ALA n 1 81 ASN n 1 82 TYR n 1 83 ASN n 1 84 GLN n 1 85 ARG n 1 86 LYS n 1 87 GLU n 1 88 GLU n 1 89 GLU n 1 90 HIS n 1 91 THR n 1 92 LEU n 1 93 LEU n 1 94 ASP n 1 95 LYS n 1 96 LEU n 1 97 THR n 1 98 GLN n 1 99 GLN n 1 100 LEU n 1 101 GLN n 1 102 GLY n 1 103 LEU n 1 104 ALA n 1 105 VAL n 1 106 THR n 1 107 ILE n 1 108 SER n 1 109 ARG n 1 110 GLU n 1 111 ASN n 1 112 ILE n 1 113 THR n 1 114 GLU n 1 115 VAL n 1 116 GLY n 1 117 ALA n 1 118 PRO n 1 119 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 119 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NPHP1, NPH1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NPHP1_HUMAN _struct_ref.pdbx_db_accession O15259 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLARRQRDPLQALRRRNQELKQQVDSLLSESQLKEALEPNKRQHIYQRCIQLKQAIDENKNALQKLSKADESAPVANYNQ RKEEEHTLLDKLTQQLQGLAVTISRENITEVGAPT ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6O1Q _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 119 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O15259 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 115 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 119 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6O1Q GLY A 1 ? UNP O15259 ? ? 'expression tag' 1 1 1 6O1Q PRO A 2 ? UNP O15259 ? ? 'expression tag' 2 2 1 6O1Q MET A 3 ? UNP O15259 ? ? 'expression tag' 3 3 1 6O1Q ALA A 4 ? UNP O15259 ? ? 'expression tag' 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 4 '2D 1H-1H NOESY' 1 isotropic 2 1 4 '2D 1H-1H TOCSY' 1 isotropic 3 1 5 '2D 1H-1H NOESY' 1 isotropic 4 1 5 '2D 1H-1H TOCSY' 1 isotropic 5 1 3 '2D 1H-15N HSQC' 1 isotropic 6 1 3 '3D HNHA' 1 isotropic 7 1 3 '3D 1H-15N NOESY' 2 isotropic 8 1 2 '3D HNCA' 1 isotropic 9 1 2 '3D H(CCO)NH' 1 isotropic 10 1 2 '3D HNCACB' 1 isotropic 11 1 2 '3D CBCA(CO)NH' 1 isotropic 12 1 2 '3D C(CO)NH' 1 isotropic 13 1 2 '3D HNCO' 1 isotropic 14 1 1 '3D HCCH-TOCSY' 2 isotropic 15 1 1 '2D 1H-13C HSQC' 2 isotropic 16 1 1 '3D 1H-13C NOESY' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.15 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label condition_15N-13C_sample _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.8 mM [U-99% 13C; U-99% 15N] NPHP1 CC, 100% D2O' '100% D2O' 15N-13C_sample solution ? 2 '0.8 mM [U-99% 13C; U-99% 15N] NPHP1CC, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N-13C_sample_2 solution ? 3 '0.9 mM [U-99% 15N] NPHP1CC, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? 4 '0.7 mM NPHP1CC, 90% H2O/10% D2O' '90% H2O/10% D2O' unlab_sample solution ? 5 '0.7 mM NPHP1CC, 100% D2O' '100% D2O' unlab_sample_2 solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 Avance ? Bruker 600 ? 2 Avance ? Bruker 900 ? # _pdbx_nmr_refine.entry_id 6O1Q _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6O1Q _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6O1Q _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement ARIA ? ;Linge, O'Donoghue and Nilges ; 2 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; 3 'chemical shift assignment' Analysis ? CCPN # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6O1Q _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6O1Q _struct.title 'The N-terminal domain of NPHP1 folds into an antiparallel three-stranded coiled coil' _struct.pdbx_descriptor Nephrocystin-1 _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6O1Q _struct_keywords.text 'nephronophthisis, apoptosis' _struct_keywords.pdbx_keywords APOPTOSIS # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 12 ? GLN A 36 ? ASP A 12 GLN A 36 1 ? 25 HELX_P HELX_P2 AA2 LYS A 38 ? LEU A 41 ? LYS A 38 LEU A 41 5 ? 4 HELX_P HELX_P3 AA3 GLU A 42 ? LEU A 70 ? GLU A 42 LEU A 70 1 ? 29 HELX_P HELX_P4 AA4 ALA A 80 ? ARG A 109 ? ALA A 80 ARG A 109 1 ? 30 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 6O1Q _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 THR 119 119 119 THR THR A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 9110 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-08-14 2 'Structure model' 1 1 2019-08-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'NPHP1 CC' 0.8 ? mM '[U-99% 13C; U-99% 15N]' 2 NPHP1CC 0.8 ? mM '[U-99% 13C; U-99% 15N]' 3 NPHP1CC 0.9 ? mM '[U-99% 15N]' 4 NPHP1CC 0.7 ? mM 'natural abundance' 5 NPHP1CC 0.7 ? mM 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A ILE 112 ? ? HG1 A THR 113 ? ? 1.59 2 9 OE1 A GLU 75 ? ? HZ3 A LYS 86 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 5 ? ? -155.67 44.73 2 1 PRO A 78 ? ? -63.10 95.60 3 1 ALA A 80 ? ? 48.28 -91.27 4 1 ASN A 111 ? ? -104.79 54.05 5 1 THR A 113 ? ? -95.13 -60.37 6 2 GLN A 10 ? ? -152.33 63.59 7 2 ARG A 11 ? ? -140.00 -38.06 8 2 LEU A 70 ? ? -82.37 43.08 9 2 LYS A 72 ? ? -117.13 63.45 10 2 VAL A 115 ? ? -104.39 47.41 11 3 ARG A 8 ? ? 55.33 71.79 12 3 SER A 71 ? ? 69.04 61.50 13 3 PRO A 78 ? ? -94.33 58.22 14 3 VAL A 79 ? ? -67.53 -73.56 15 3 ALA A 80 ? ? -149.25 -84.45 16 3 ASN A 111 ? ? -116.66 57.32 17 3 THR A 113 ? ? -97.60 -67.52 18 4 ASP A 12 ? ? 57.57 76.88 19 4 SER A 76 ? ? -156.37 36.99 20 4 VAL A 79 ? ? -101.78 51.91 21 4 GLU A 114 ? ? 68.09 -75.84 22 5 MET A 5 ? ? -97.29 39.57 23 5 ASP A 12 ? ? 59.50 76.27 24 5 LEU A 70 ? ? -103.71 51.90 25 5 GLU A 75 ? ? 66.55 175.91 26 5 SER A 76 ? ? 66.45 -173.86 27 5 PRO A 78 ? ? -68.51 80.03 28 5 VAL A 115 ? ? -96.42 48.13 29 6 LYS A 72 ? ? -147.07 10.69 30 6 ARG A 109 ? ? -119.64 54.25 31 6 ASN A 111 ? ? -153.95 69.94 32 6 ILE A 112 ? ? -91.72 -80.92 33 7 ARG A 9 ? ? 70.66 -54.63 34 7 SER A 71 ? ? -94.41 42.81 35 7 GLU A 75 ? ? -91.18 41.71 36 7 VAL A 79 ? ? -80.91 -70.81 37 7 ALA A 80 ? ? -155.57 -63.95 38 7 ARG A 109 ? ? 65.76 -166.92 39 7 GLU A 110 ? ? -78.23 46.45 40 8 MET A 3 ? ? 60.94 -159.01 41 8 ALA A 4 ? ? -90.47 -60.01 42 8 ASP A 12 ? ? 59.53 72.82 43 8 LYS A 72 ? ? -103.38 48.07 44 8 GLU A 75 ? ? 81.25 108.64 45 8 SER A 76 ? ? -103.86 -61.70 46 8 ALA A 77 ? ? -162.02 63.00 47 8 ALA A 80 ? ? -158.70 -58.29 48 8 ASN A 111 ? ? -100.02 52.98 49 8 GLU A 114 ? ? 70.37 135.25 50 9 LEU A 70 ? ? -92.85 39.59 51 9 SER A 76 ? ? -153.19 41.02 52 9 ALA A 77 ? ? 63.61 103.19 53 9 ALA A 80 ? ? -161.04 -68.65 54 9 GLU A 110 ? ? -86.39 41.09 55 10 ALA A 4 ? ? 55.97 78.70 56 10 ARG A 8 ? ? -85.49 48.85 57 10 PRO A 78 ? ? -63.60 93.18 58 10 ALA A 80 ? ? 71.99 -61.32 59 10 ARG A 109 ? ? 65.69 101.67 60 10 GLU A 114 ? ? 69.53 -60.60 # _pdbx_audit_support.funding_organization 'Fondazione CARIPLO' _pdbx_audit_support.country Italy _pdbx_audit_support.grant_number R0532 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'equilibrium centrifugation' _pdbx_struct_assembly_auth_evidence.details ? #