data_6P0G # _entry.id 6P0G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6P0G WWPDB D_1000241229 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6P0G _pdbx_database_status.recvd_initial_deposition_date 2019-05-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hosford, C.J.' 1 0000-0001-5756-6505 'Chappie, J.S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 295 _citation.language ? _citation.page_first 743 _citation.page_last 756 _citation.title ;The structure of theThermococcus gammatoleransMcrB N-terminal domain reveals a new mode of substrate recognition and specificity among McrB homologs. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.RA119.010188 _citation.pdbx_database_id_PubMed 31822563 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hosford, C.J.' 1 0000-0001-5756-6505 primary 'Bui, A.Q.' 2 0000-0002-6470-6294 primary 'Chappie, J.S.' 3 0000-0002-5733-7275 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6P0G _cell.details ? _cell.formula_units_Z ? _cell.length_a 41.166 _cell.length_a_esd ? _cell.length_b 57.304 _cell.length_b_esd ? _cell.length_c 107.507 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6P0G _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GTPase subunit of restriction endonuclease' 21737.219 1 ? ? ? ? 2 polymer syn ;DNA (5'-D(P*TP*AP*CP*CP*GP*G)-3') ; 1809.217 1 ? ? ? ? 3 polymer syn ;DNA (5'-D(P*AP*CP*CP*GP*GP*T)-3') ; 1809.217 1 ? ? ? ? 4 water nat water 18.015 4 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;(MSE)ENQLFIIGIGTGTDEYENFEETILKGVKRNELEGQIGPDILDNCCSDVCYFWGRSKETIYEKKIDKGD(MSE)VL FYVGKRISRNKVDLNQETAVYLGIICETVEISENDVSFLNDFWRKGENFRFL(MSE)FFKKKPEKLHHSINEINSKLGYN PDYFPIAGYVKPER(MSE)SGVYDILKNILKKRGILKESDS ; ;MENQLFIIGIGTGTDEYENFEETILKGVKRNELEGQIGPDILDNCCSDVCYFWGRSKETIYEKKIDKGDMVLFYVGKRIS RNKVDLNQETAVYLGIICETVEISENDVSFLNDFWRKGENFRFLMFFKKKPEKLHHSINEINSKLGYNPDYFPIAGYVKP ERMSGVYDILKNILKKRGILKESDS ; A ? 2 polydeoxyribonucleotide no no '(DT)(DA)(DC)(DC)(DG)(DG)' TACCGG B ? 3 polydeoxyribonucleotide no no '(DA)(DC)(DC)(DG)(DG)(DT)' ACCGGT C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLU n 1 3 ASN n 1 4 GLN n 1 5 LEU n 1 6 PHE n 1 7 ILE n 1 8 ILE n 1 9 GLY n 1 10 ILE n 1 11 GLY n 1 12 THR n 1 13 GLY n 1 14 THR n 1 15 ASP n 1 16 GLU n 1 17 TYR n 1 18 GLU n 1 19 ASN n 1 20 PHE n 1 21 GLU n 1 22 GLU n 1 23 THR n 1 24 ILE n 1 25 LEU n 1 26 LYS n 1 27 GLY n 1 28 VAL n 1 29 LYS n 1 30 ARG n 1 31 ASN n 1 32 GLU n 1 33 LEU n 1 34 GLU n 1 35 GLY n 1 36 GLN n 1 37 ILE n 1 38 GLY n 1 39 PRO n 1 40 ASP n 1 41 ILE n 1 42 LEU n 1 43 ASP n 1 44 ASN n 1 45 CYS n 1 46 CYS n 1 47 SER n 1 48 ASP n 1 49 VAL n 1 50 CYS n 1 51 TYR n 1 52 PHE n 1 53 TRP n 1 54 GLY n 1 55 ARG n 1 56 SER n 1 57 LYS n 1 58 GLU n 1 59 THR n 1 60 ILE n 1 61 TYR n 1 62 GLU n 1 63 LYS n 1 64 LYS n 1 65 ILE n 1 66 ASP n 1 67 LYS n 1 68 GLY n 1 69 ASP n 1 70 MSE n 1 71 VAL n 1 72 LEU n 1 73 PHE n 1 74 TYR n 1 75 VAL n 1 76 GLY n 1 77 LYS n 1 78 ARG n 1 79 ILE n 1 80 SER n 1 81 ARG n 1 82 ASN n 1 83 LYS n 1 84 VAL n 1 85 ASP n 1 86 LEU n 1 87 ASN n 1 88 GLN n 1 89 GLU n 1 90 THR n 1 91 ALA n 1 92 VAL n 1 93 TYR n 1 94 LEU n 1 95 GLY n 1 96 ILE n 1 97 ILE n 1 98 CYS n 1 99 GLU n 1 100 THR n 1 101 VAL n 1 102 GLU n 1 103 ILE n 1 104 SER n 1 105 GLU n 1 106 ASN n 1 107 ASP n 1 108 VAL n 1 109 SER n 1 110 PHE n 1 111 LEU n 1 112 ASN n 1 113 ASP n 1 114 PHE n 1 115 TRP n 1 116 ARG n 1 117 LYS n 1 118 GLY n 1 119 GLU n 1 120 ASN n 1 121 PHE n 1 122 ARG n 1 123 PHE n 1 124 LEU n 1 125 MSE n 1 126 PHE n 1 127 PHE n 1 128 LYS n 1 129 LYS n 1 130 LYS n 1 131 PRO n 1 132 GLU n 1 133 LYS n 1 134 LEU n 1 135 HIS n 1 136 HIS n 1 137 SER n 1 138 ILE n 1 139 ASN n 1 140 GLU n 1 141 ILE n 1 142 ASN n 1 143 SER n 1 144 LYS n 1 145 LEU n 1 146 GLY n 1 147 TYR n 1 148 ASN n 1 149 PRO n 1 150 ASP n 1 151 TYR n 1 152 PHE n 1 153 PRO n 1 154 ILE n 1 155 ALA n 1 156 GLY n 1 157 TYR n 1 158 VAL n 1 159 LYS n 1 160 PRO n 1 161 GLU n 1 162 ARG n 1 163 MSE n 1 164 SER n 1 165 GLY n 1 166 VAL n 1 167 TYR n 1 168 ASP n 1 169 ILE n 1 170 LEU n 1 171 LYS n 1 172 ASN n 1 173 ILE n 1 174 LEU n 1 175 LYS n 1 176 LYS n 1 177 ARG n 1 178 GLY n 1 179 ILE n 1 180 LEU n 1 181 LYS n 1 182 GLU n 1 183 SER n 1 184 ASP n 1 185 SER n 2 1 DT n 2 2 DA n 2 3 DC n 2 4 DC n 2 5 DG n 2 6 DG n 3 1 DA n 3 2 DC n 3 3 DC n 3 4 DG n 3 5 DG n 3 6 DT n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 185 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TGAM_0453 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 15229 / JCM 11827 / EJ3' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 593117 _entity_src_gen.pdbx_gene_src_variant 'DSM 15229 / JCM 11827 / EJ3' _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 2 1 sample 1 6 'synthetic construct' ? 32630 ? 3 1 sample 1 6 'synthetic construct' ? 32630 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP C5A3Z3_THEGJ C5A3Z3 ? 1 ;MENQLFIIGIGTGTDEYENFEETILKGVKRNELEGQIGPDILDNCCSDVCYFWGRSKETIYEKKIDKGDMVLFYVGKRIS RNKVDLNQETAVYLGIICETVEISENDVSFLNDFWRKGENFRFLMFFKKKPEKLHHSINEINSKLGYNPDYFPIAGYVKP ERMSGVYDILKNILKKRGILKESDS ; 1 2 PDB 6P0G 6P0G ? 2 ? 1 3 PDB 6P0G 6P0G ? 3 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6P0G A 1 ? 185 ? C5A3Z3 1 ? 185 ? 1 185 2 2 6P0G B 1 ? 6 ? 6P0G 2 ? 7 ? 2 7 3 3 6P0G C 1 ? 6 ? 6P0G 2 ? 7 ? 2 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DA 'DNA linking' y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 DC 'DNA linking' y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P' 307.197 DG 'DNA linking' y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 DT 'DNA linking' y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P' 322.208 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6P0G _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.50 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES pH 7.5, 18% PEG 3350, 0.20 M Ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range '7.0 - 8.0' # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-11-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6P0G _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.27 _reflns.d_resolution_low 53.754 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17710 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.11 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.27 _reflns_shell.d_res_low 2.45 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.59 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2477 _reflns_shell.percent_possible_all 100.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.85 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6P0G _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.270 _refine.ls_d_res_low 53.754 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12299 _refine.ls_number_reflns_R_free 627 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.85 _refine.ls_percent_reflns_R_free 5.10 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2405 _refine.ls_R_factor_R_free 0.2893 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2378 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 39.30 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.36 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1367 _refine_hist.pdbx_number_atoms_nucleic_acid 246 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 4 _refine_hist.number_atoms_total 1617 _refine_hist.d_res_high 2.270 _refine_hist.d_res_low 53.754 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 1673 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.190 ? 2312 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 22.326 ? 613 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.058 ? 253 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 261 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2701 2.4986 . . 154 2857 100.00 . . . 0.4107 . 0.3190 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4986 2.8601 . . 136 2879 100.00 . . . 0.3477 . 0.3080 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8601 3.6033 . . 158 2901 100.00 . . . 0.3799 . 0.2985 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6033 53.7685 . . 179 3035 100.00 . . . 0.2480 . 0.2010 . . . . . . . . . . # _struct.entry_id 6P0G _struct.title 'N-terminal domain of Thermococcus Gammatolerans McrB bound to m5C DNA' _struct.pdbx_descriptor 'GTPase subunit of restriction endonuclease, DNA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6P0G _struct_keywords.text 'YTH domain, restriction endonuclease, DNA Binding Protein, DNA BINDING PROTEIN-DNA complex' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN/DNA' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 14 ? ILE A 24 ? THR A 14 ILE A 24 1 ? 11 HELX_P HELX_P2 AA2 ASN A 31 ? LEU A 33 ? ASN A 31 LEU A 33 5 ? 3 HELX_P HELX_P3 AA3 GLY A 38 ? CYS A 46 ? GLY A 38 CYS A 46 1 ? 9 HELX_P HELX_P4 AA4 ASP A 107 ? PHE A 114 ? ASP A 107 PHE A 114 5 ? 8 HELX_P HELX_P5 AA5 LYS A 117 ? PHE A 121 ? LYS A 117 PHE A 121 5 ? 5 HELX_P HELX_P6 AA6 SER A 137 ? LEU A 145 ? SER A 137 LEU A 145 1 ? 9 HELX_P HELX_P7 AA7 LYS A 159 ? SER A 164 ? LYS A 159 SER A 164 1 ? 6 HELX_P HELX_P8 AA8 VAL A 166 ? LEU A 174 ? VAL A 166 LEU A 174 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 45 SG ? ? ? 1_555 A CYS 98 SG ? ? A CYS 45 A CYS 98 1_555 ? ? ? ? ? ? ? 2.057 ? disulf2 disulf ? ? A CYS 46 SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 46 A CYS 50 1_555 ? ? ? ? ? ? ? 2.040 ? covale1 covale both ? A ASP 69 C ? ? ? 1_555 A MSE 70 N ? ? A ASP 69 A MSE 70 1_555 ? ? ? ? ? ? ? 1.325 ? covale2 covale both ? A MSE 70 C ? ? ? 1_555 A VAL 71 N ? ? A MSE 70 A VAL 71 1_555 ? ? ? ? ? ? ? 1.327 ? covale3 covale both ? A LEU 124 C ? ? ? 1_555 A MSE 125 N ? ? A LEU 124 A MSE 125 1_555 ? ? ? ? ? ? ? 1.328 ? covale4 covale both ? A MSE 125 C ? ? ? 1_555 A PHE 126 N ? ? A MSE 125 A PHE 126 1_555 ? ? ? ? ? ? ? 1.329 ? covale5 covale both ? A ARG 162 C ? ? ? 1_555 A MSE 163 N ? ? A ARG 162 A MSE 163 1_555 ? ? ? ? ? ? ? 1.335 ? covale6 covale both ? A MSE 163 C ? ? ? 1_555 A SER 164 N ? ? A MSE 163 A SER 164 1_555 ? ? ? ? ? ? ? 1.331 ? hydrog1 hydrog ? ? B DT 1 N3 ? ? ? 1_555 C DT 6 O4 ? ? B DT 2 C DT 7 1_555 ? ? ? ? ? ? 'DT-DT MISPAIR' ? ? hydrog2 hydrog ? ? B DC 3 N4 ? ? ? 1_555 C DG 5 O6 ? ? B DC 4 C DG 6 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? hydrog3 hydrog ? ? B DC 3 N4 ? ? ? 1_555 C DT 6 O4 ? ? B DC 4 C DT 7 1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ? ? hydrog4 hydrog ? ? B DC 4 N3 ? ? ? 1_555 C DG 4 N1 ? ? B DC 5 C DG 5 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? hydrog5 hydrog ? ? B DG 5 N7 ? ? ? 1_555 C DC 3 N4 ? ? B DG 6 C DC 4 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? hydrog6 hydrog ? ? B DG 5 O6 ? ? ? 1_555 C DG 4 N1 ? ? B DG 6 C DG 5 1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ? ? hydrog7 hydrog ? ? B DG 6 O6 ? ? ? 1_555 C DC 2 N4 ? ? B DG 7 C DC 3 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? hydrog ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 6 ? AA3 ? 2 ? AA4 ? 2 ? AA5 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 52 ? ARG A 55 ? PHE A 52 ARG A 55 AA1 2 PHE A 123 ? PHE A 127 ? PHE A 123 PHE A 127 AA1 3 ALA A 91 ? GLU A 102 ? ALA A 91 GLU A 102 AA1 4 GLU A 132 ? LYS A 133 ? GLU A 132 LYS A 133 AA2 1 PHE A 52 ? ARG A 55 ? PHE A 52 ARG A 55 AA2 2 PHE A 123 ? PHE A 127 ? PHE A 123 PHE A 127 AA2 3 ALA A 91 ? GLU A 102 ? ALA A 91 GLU A 102 AA2 4 MSE A 70 ? GLY A 76 ? MSE A 70 GLY A 76 AA2 5 LEU A 5 ? GLY A 11 ? LEU A 5 GLY A 11 AA2 6 ALA A 155 ? TYR A 157 ? ALA A 155 TYR A 157 AA3 1 VAL A 28 ? LYS A 29 ? VAL A 28 LYS A 29 AA3 2 VAL A 49 ? CYS A 50 ? VAL A 49 CYS A 50 AA4 1 THR A 59 ? ILE A 60 ? THR A 59 ILE A 60 AA4 2 LYS A 63 ? LYS A 64 ? LYS A 63 LYS A 64 AA5 1 ARG A 78 ? SER A 80 ? ARG A 78 SER A 80 AA5 2 LYS A 83 ? VAL A 84 ? LYS A 83 VAL A 84 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TRP A 53 ? N TRP A 53 O MSE A 125 ? O MSE A 125 AA1 2 3 O PHE A 126 ? O PHE A 126 N CYS A 98 ? N CYS A 98 AA1 3 4 N LEU A 94 ? N LEU A 94 O GLU A 132 ? O GLU A 132 AA2 1 2 N TRP A 53 ? N TRP A 53 O MSE A 125 ? O MSE A 125 AA2 2 3 O PHE A 126 ? O PHE A 126 N CYS A 98 ? N CYS A 98 AA2 3 4 O ALA A 91 ? O ALA A 91 N VAL A 75 ? N VAL A 75 AA2 4 5 O TYR A 74 ? O TYR A 74 N ILE A 10 ? N ILE A 10 AA2 5 6 N ILE A 7 ? N ILE A 7 O GLY A 156 ? O GLY A 156 AA3 1 2 N VAL A 28 ? N VAL A 28 O CYS A 50 ? O CYS A 50 AA4 1 2 N ILE A 60 ? N ILE A 60 O LYS A 63 ? O LYS A 63 AA5 1 2 N ILE A 79 ? N ILE A 79 O LYS A 83 ? O LYS A 83 # _atom_sites.entry_id 6P0G _atom_sites.fract_transf_matrix[1][1] 0.024292 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017451 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009302 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 TRP 53 53 53 TRP TRP A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 MSE 70 70 70 MSE MSE A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ARG 81 81 81 ARG ALA A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 TRP 115 115 115 TRP TRP A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 MSE 125 125 125 MSE MSE A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 PRO 131 131 131 PRO PRO A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 HIS 135 135 135 HIS HIS A . n A 1 136 HIS 136 136 136 HIS HIS A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 ASN 142 142 142 ASN ASN A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 MSE 163 163 163 MSE MSE A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 TYR 167 167 167 TYR TYR A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 ASN 172 172 172 ASN ASN A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 LYS 175 175 175 LYS ALA A . n A 1 176 LYS 176 176 ? ? ? A . n A 1 177 ARG 177 177 ? ? ? A . n A 1 178 GLY 178 178 ? ? ? A . n A 1 179 ILE 179 179 ? ? ? A . n A 1 180 LEU 180 180 ? ? ? A . n A 1 181 LYS 181 181 ? ? ? A . n A 1 182 GLU 182 182 ? ? ? A . n A 1 183 SER 183 183 ? ? ? A . n A 1 184 ASP 184 184 ? ? ? A . n A 1 185 SER 185 185 ? ? ? A . n B 2 1 DT 1 2 2 DT DT B . n B 2 2 DA 2 3 3 DA DA B . n B 2 3 DC 3 4 4 DC DC B . n B 2 4 DC 4 5 5 DC DC B . n B 2 5 DG 5 6 6 DG DG B . n B 2 6 DG 6 7 7 DG DG B . n C 3 1 DA 1 2 2 DA DA C . n C 3 2 DC 2 3 3 DC DC C . n C 3 3 DC 3 4 4 DC DC C . n C 3 4 DG 4 5 5 DG DG C . n C 3 5 DG 5 6 6 DG DG C . n C 3 6 DT 6 7 7 DT DT C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 4 HOH 1 201 1 HOH HOH A . D 4 HOH 2 202 3 HOH HOH A . D 4 HOH 3 203 4 HOH HOH A . D 4 HOH 4 204 2 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 70 A MSE 70 ? MET 'modified residue' 2 A MSE 125 A MSE 125 ? MET 'modified residue' 3 A MSE 163 A MSE 163 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2370 ? 1 MORE -8 ? 1 'SSA (A^2)' 9650 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-12-18 2 'Structure model' 1 1 2019-12-25 3 'Structure model' 1 2 2020-01-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_DOI' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_citation.title' 9 3 'Structure model' '_citation.year' 10 3 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O6 _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 DG _pdbx_validate_close_contact.auth_seq_id_1 6 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 N4 _pdbx_validate_close_contact.auth_asym_id_2 C _pdbx_validate_close_contact.auth_comp_id_2 DC _pdbx_validate_close_contact.auth_seq_id_2 4 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.10 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 "O4'" B DT 2 ? ? "C1'" B DT 2 ? ? N1 B DT 2 ? ? 112.43 108.30 4.13 0.30 N 2 1 "O4'" B DC 5 ? ? "C1'" B DC 5 ? ? N1 B DC 5 ? ? 112.29 108.30 3.99 0.30 N 3 1 "O4'" B DG 6 ? ? "C1'" B DG 6 ? ? N9 B DG 6 ? ? 110.18 108.30 1.88 0.30 N 4 1 "O4'" B DG 7 ? ? "C1'" B DG 7 ? ? N9 B DG 7 ? ? 110.87 108.30 2.57 0.30 N 5 1 "O4'" C DC 4 ? ? "C1'" C DC 4 ? ? N1 C DC 4 ? ? 110.49 108.30 2.19 0.30 N 6 1 "O4'" C DG 6 ? ? "C1'" C DG 6 ? ? N9 C DG 6 ? ? 111.73 108.30 3.43 0.30 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 47 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -96.93 _pdbx_validate_torsion.psi -121.75 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 57 ? CG ? A LYS 57 CG 2 1 Y 1 A LYS 57 ? CD ? A LYS 57 CD 3 1 Y 1 A LYS 57 ? CE ? A LYS 57 CE 4 1 Y 1 A LYS 57 ? NZ ? A LYS 57 NZ 5 1 Y 1 A LYS 63 ? CG ? A LYS 63 CG 6 1 Y 1 A LYS 63 ? CD ? A LYS 63 CD 7 1 Y 1 A LYS 63 ? CE ? A LYS 63 CE 8 1 Y 1 A LYS 63 ? NZ ? A LYS 63 NZ 9 1 Y 1 A LYS 64 ? CG ? A LYS 64 CG 10 1 Y 1 A LYS 64 ? CD ? A LYS 64 CD 11 1 Y 1 A LYS 64 ? CE ? A LYS 64 CE 12 1 Y 1 A LYS 64 ? NZ ? A LYS 64 NZ 13 1 Y 1 A LYS 67 ? CG ? A LYS 67 CG 14 1 Y 1 A LYS 67 ? CD ? A LYS 67 CD 15 1 Y 1 A LYS 67 ? CE ? A LYS 67 CE 16 1 Y 1 A LYS 67 ? NZ ? A LYS 67 NZ 17 1 Y 1 A LYS 77 ? CG ? A LYS 77 CG 18 1 Y 1 A LYS 77 ? CD ? A LYS 77 CD 19 1 Y 1 A LYS 77 ? CE ? A LYS 77 CE 20 1 Y 1 A LYS 77 ? NZ ? A LYS 77 NZ 21 1 Y 1 A ARG 81 ? CG ? A ARG 81 CG 22 1 Y 1 A ARG 81 ? CD ? A ARG 81 CD 23 1 Y 1 A ARG 81 ? NE ? A ARG 81 NE 24 1 Y 1 A ARG 81 ? CZ ? A ARG 81 CZ 25 1 Y 1 A ARG 81 ? NH1 ? A ARG 81 NH1 26 1 Y 1 A ARG 81 ? NH2 ? A ARG 81 NH2 27 1 Y 1 A ARG 116 ? CG ? A ARG 116 CG 28 1 Y 1 A ARG 116 ? CD ? A ARG 116 CD 29 1 Y 1 A ARG 116 ? NE ? A ARG 116 NE 30 1 Y 1 A ARG 116 ? CZ ? A ARG 116 CZ 31 1 Y 1 A ARG 116 ? NH1 ? A ARG 116 NH1 32 1 Y 1 A ARG 116 ? NH2 ? A ARG 116 NH2 33 1 Y 1 A LYS 117 ? CG ? A LYS 117 CG 34 1 Y 1 A LYS 117 ? CD ? A LYS 117 CD 35 1 Y 1 A LYS 117 ? CE ? A LYS 117 CE 36 1 Y 1 A LYS 117 ? NZ ? A LYS 117 NZ 37 1 Y 1 A LYS 128 ? CG ? A LYS 128 CG 38 1 Y 1 A LYS 128 ? CD ? A LYS 128 CD 39 1 Y 1 A LYS 128 ? CE ? A LYS 128 CE 40 1 Y 1 A LYS 128 ? NZ ? A LYS 128 NZ 41 1 Y 1 A LYS 129 ? CG ? A LYS 129 CG 42 1 Y 1 A LYS 129 ? CD ? A LYS 129 CD 43 1 Y 1 A LYS 129 ? CE ? A LYS 129 CE 44 1 Y 1 A LYS 129 ? NZ ? A LYS 129 NZ 45 1 Y 1 A LYS 171 ? CG ? A LYS 171 CG 46 1 Y 1 A LYS 171 ? CD ? A LYS 171 CD 47 1 Y 1 A LYS 171 ? CE ? A LYS 171 CE 48 1 Y 1 A LYS 171 ? NZ ? A LYS 171 NZ 49 1 Y 1 A LYS 175 ? CG ? A LYS 175 CG 50 1 Y 1 A LYS 175 ? CD ? A LYS 175 CD 51 1 Y 1 A LYS 175 ? CE ? A LYS 175 CE 52 1 Y 1 A LYS 175 ? NZ ? A LYS 175 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A LYS 176 ? A LYS 176 4 1 Y 1 A ARG 177 ? A ARG 177 5 1 Y 1 A GLY 178 ? A GLY 178 6 1 Y 1 A ILE 179 ? A ILE 179 7 1 Y 1 A LEU 180 ? A LEU 180 8 1 Y 1 A LYS 181 ? A LYS 181 9 1 Y 1 A GLU 182 ? A GLU 182 10 1 Y 1 A SER 183 ? A SER 183 11 1 Y 1 A ASP 184 ? A ASP 184 12 1 Y 1 A SER 185 ? A SER 185 # _ndb_struct_conf_na.entry_id 6P0G _ndb_struct_conf_na.feature 'double helix' # loop_ _ndb_struct_na_base_pair.model_number _ndb_struct_na_base_pair.i_label_asym_id _ndb_struct_na_base_pair.i_label_comp_id _ndb_struct_na_base_pair.i_label_seq_id _ndb_struct_na_base_pair.i_symmetry _ndb_struct_na_base_pair.j_label_asym_id _ndb_struct_na_base_pair.j_label_comp_id _ndb_struct_na_base_pair.j_label_seq_id _ndb_struct_na_base_pair.j_symmetry _ndb_struct_na_base_pair.shear _ndb_struct_na_base_pair.stretch _ndb_struct_na_base_pair.stagger _ndb_struct_na_base_pair.buckle _ndb_struct_na_base_pair.propeller _ndb_struct_na_base_pair.opening _ndb_struct_na_base_pair.pair_number _ndb_struct_na_base_pair.pair_name _ndb_struct_na_base_pair.i_auth_asym_id _ndb_struct_na_base_pair.i_auth_seq_id _ndb_struct_na_base_pair.i_PDB_ins_code _ndb_struct_na_base_pair.j_auth_asym_id _ndb_struct_na_base_pair.j_auth_seq_id _ndb_struct_na_base_pair.j_PDB_ins_code _ndb_struct_na_base_pair.hbond_type_28 _ndb_struct_na_base_pair.hbond_type_12 1 B DT 1 1_555 C DT 6 1_555 2.218 -0.747 0.798 15.798 -23.027 -45.381 1 B_DT2:DT7_C B 2 ? C 7 ? ? ? 1 B DC 3 1_555 C DG 5 1_555 1.702 -3.087 -2.398 -15.380 35.553 140.862 2 B_DC4:DG6_C B 4 ? C 6 ? ? 3 1 B DC 4 1_555 C DG 4 1_555 -0.039 0.795 0.185 -28.069 -18.761 -173.855 3 B_DC5:DG5_C B 5 ? C 5 ? ? 2 1 B DG 5 1_555 C DC 3 1_555 3.405 -4.832 -0.962 9.925 25.397 167.815 4 B_DG6:DC4_C B 6 ? C 4 ? ? 8 1 B DG 6 1_555 C DC 2 1_555 -1.255 1.325 -0.831 8.330 -21.964 -106.814 5 B_DG7:DC3_C B 7 ? C 3 ? ? 4 # loop_ _ndb_struct_na_base_pair_step.model_number _ndb_struct_na_base_pair_step.i_label_asym_id_1 _ndb_struct_na_base_pair_step.i_label_comp_id_1 _ndb_struct_na_base_pair_step.i_label_seq_id_1 _ndb_struct_na_base_pair_step.i_symmetry_1 _ndb_struct_na_base_pair_step.j_label_asym_id_1 _ndb_struct_na_base_pair_step.j_label_comp_id_1 _ndb_struct_na_base_pair_step.j_label_seq_id_1 _ndb_struct_na_base_pair_step.j_symmetry_1 _ndb_struct_na_base_pair_step.i_label_asym_id_2 _ndb_struct_na_base_pair_step.i_label_comp_id_2 _ndb_struct_na_base_pair_step.i_label_seq_id_2 _ndb_struct_na_base_pair_step.i_symmetry_2 _ndb_struct_na_base_pair_step.j_label_asym_id_2 _ndb_struct_na_base_pair_step.j_label_comp_id_2 _ndb_struct_na_base_pair_step.j_label_seq_id_2 _ndb_struct_na_base_pair_step.j_symmetry_2 _ndb_struct_na_base_pair_step.shift _ndb_struct_na_base_pair_step.slide _ndb_struct_na_base_pair_step.rise _ndb_struct_na_base_pair_step.tilt _ndb_struct_na_base_pair_step.roll _ndb_struct_na_base_pair_step.twist _ndb_struct_na_base_pair_step.x_displacement _ndb_struct_na_base_pair_step.y_displacement _ndb_struct_na_base_pair_step.helical_rise _ndb_struct_na_base_pair_step.inclination _ndb_struct_na_base_pair_step.tip _ndb_struct_na_base_pair_step.helical_twist _ndb_struct_na_base_pair_step.step_number _ndb_struct_na_base_pair_step.step_name _ndb_struct_na_base_pair_step.i_auth_asym_id_1 _ndb_struct_na_base_pair_step.i_auth_seq_id_1 _ndb_struct_na_base_pair_step.i_PDB_ins_code_1 _ndb_struct_na_base_pair_step.j_auth_asym_id_1 _ndb_struct_na_base_pair_step.j_auth_seq_id_1 _ndb_struct_na_base_pair_step.j_PDB_ins_code_1 _ndb_struct_na_base_pair_step.i_auth_asym_id_2 _ndb_struct_na_base_pair_step.i_auth_seq_id_2 _ndb_struct_na_base_pair_step.i_PDB_ins_code_2 _ndb_struct_na_base_pair_step.j_auth_asym_id_2 _ndb_struct_na_base_pair_step.j_auth_seq_id_2 _ndb_struct_na_base_pair_step.j_PDB_ins_code_2 1 B DT 1 1_555 C DT 6 1_555 B DC 3 1_555 C DG 5 1_555 -0.880 -4.023 -1.369 114.964 -98.193 82.099 -2.171 0.303 0.530 -52.234 -61.155 158.374 1 BB_DT2DC4:DG6DT7_CC B 2 ? C 7 ? B 4 ? C 6 ? 1 B DC 3 1_555 C DG 5 1_555 B DC 4 1_555 C DG 4 1_555 -4.591 -2.631 1.515 -135.467 104.785 55.385 -2.061 1.341 2.494 53.821 69.581 172.266 2 BB_DC4DC5:DG5DG6_CC B 4 ? C 6 ? B 5 ? C 5 ? 1 B DC 4 1_555 C DG 4 1_555 B DG 5 1_555 C DC 3 1_555 -2.579 -0.361 -0.677 72.434 -158.545 -138.380 0.093 -1.330 -0.369 79.441 36.294 -177.978 3 BB_DC5DG6:DC4DG5_CC B 5 ? C 5 ? B 6 ? C 4 ? 1 B DG 5 1_555 C DC 3 1_555 B DG 6 1_555 C DC 2 1_555 -0.358 -2.724 3.976 -5.285 -6.300 173.489 -1.358 0.174 3.986 -3.155 2.647 173.506 4 BB_DG6DG7:DC3DC4_CC B 6 ? C 4 ? B 7 ? C 3 ? # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM120242 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 4 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #