data_6PB3 # _entry.id 6PB3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.323 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6PB3 WWPDB D_1000242075 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6PB3 _pdbx_database_status.recvd_initial_deposition_date 2019-06-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ye, Q.' 1 ? 'Corbett, K.D.' 2 0000-0001-5854-2388 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mol.Cell _citation.journal_id_ASTM MOCEFL _citation.journal_id_CSD 2168 _citation.journal_id_ISSN 1097-2765 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 77 _citation.language ? _citation.page_first 709 _citation.page_last ? _citation.title 'HORMA Domain Proteins and a Trip13-like ATPase Regulate Bacterial cGAS-like Enzymes to Mediate Bacteriophage Immunity.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.molcel.2019.12.009 _citation.pdbx_database_id_PubMed 31932165 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ye, Q.' 1 ? primary 'Lau, R.K.' 2 ? primary 'Mathews, I.T.' 3 ? primary 'Birkholz, E.A.' 4 ? primary 'Watrous, J.D.' 5 ? primary 'Azimi, C.S.' 6 ? primary 'Pogliano, J.' 7 ? primary 'Jain, M.' 8 ? primary 'Corbett, K.D.' 9 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6PB3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 100.436 _cell.length_a_esd ? _cell.length_b 100.436 _cell.length_b_esd ? _cell.length_c 48.860 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6PB3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 168 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 6' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Rhizobiales Sp. Pch2' 33710.297 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 41 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)S(MSE)TPDLAGLFEGASTYPDVDARERLNNLVGLDTHKSRLSK(MSE)LAVLVNPDGLSAWAKKHHPAAEALVK NVIRRPPLIVLAGDVGSGKTELAETIGDDVARRESIRITLLPLSLSARGQGRVGE(MSE)TQLISAAFEHTVSEARKLKS SGTKARGAVILLVDEADALAQSREAAQ(MSE)HHEDRAGVNAFIRGIDRLGNGALPAAVI(MSE)CTNRVDSLDPAVRRR AAEIITFDRPNDAQRRAVITTTLQGTGVTGSQIEGLVAATGPARPRDYGFTFSDLTQRLIPSIVLDAYPDTSINPARALA IAQA(MSE)APTAPFQDKSR ; _entity_poly.pdbx_seq_one_letter_code_can ;MSMTPDLAGLFEGASTYPDVDARERLNNLVGLDTHKSRLSKMLAVLVNPDGLSAWAKKHHPAAEALVKNVIRRPPLIVLA GDVGSGKTELAETIGDDVARRESIRITLLPLSLSARGQGRVGEMTQLISAAFEHTVSEARKLKSSGTKARGAVILLVDEA DALAQSREAAQMHHEDRAGVNAFIRGIDRLGNGALPAAVIMCTNRVDSLDPAVRRRAAEIITFDRPNDAQRRAVITTTLQ GTGVTGSQIEGLVAATGPARPRDYGFTFSDLTQRLIPSIVLDAYPDTSINPARALAIAQAMAPTAPFQDKSR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 SER n 1 3 MSE n 1 4 THR n 1 5 PRO n 1 6 ASP n 1 7 LEU n 1 8 ALA n 1 9 GLY n 1 10 LEU n 1 11 PHE n 1 12 GLU n 1 13 GLY n 1 14 ALA n 1 15 SER n 1 16 THR n 1 17 TYR n 1 18 PRO n 1 19 ASP n 1 20 VAL n 1 21 ASP n 1 22 ALA n 1 23 ARG n 1 24 GLU n 1 25 ARG n 1 26 LEU n 1 27 ASN n 1 28 ASN n 1 29 LEU n 1 30 VAL n 1 31 GLY n 1 32 LEU n 1 33 ASP n 1 34 THR n 1 35 HIS n 1 36 LYS n 1 37 SER n 1 38 ARG n 1 39 LEU n 1 40 SER n 1 41 LYS n 1 42 MSE n 1 43 LEU n 1 44 ALA n 1 45 VAL n 1 46 LEU n 1 47 VAL n 1 48 ASN n 1 49 PRO n 1 50 ASP n 1 51 GLY n 1 52 LEU n 1 53 SER n 1 54 ALA n 1 55 TRP n 1 56 ALA n 1 57 LYS n 1 58 LYS n 1 59 HIS n 1 60 HIS n 1 61 PRO n 1 62 ALA n 1 63 ALA n 1 64 GLU n 1 65 ALA n 1 66 LEU n 1 67 VAL n 1 68 LYS n 1 69 ASN n 1 70 VAL n 1 71 ILE n 1 72 ARG n 1 73 ARG n 1 74 PRO n 1 75 PRO n 1 76 LEU n 1 77 ILE n 1 78 VAL n 1 79 LEU n 1 80 ALA n 1 81 GLY n 1 82 ASP n 1 83 VAL n 1 84 GLY n 1 85 SER n 1 86 GLY n 1 87 LYS n 1 88 THR n 1 89 GLU n 1 90 LEU n 1 91 ALA n 1 92 GLU n 1 93 THR n 1 94 ILE n 1 95 GLY n 1 96 ASP n 1 97 ASP n 1 98 VAL n 1 99 ALA n 1 100 ARG n 1 101 ARG n 1 102 GLU n 1 103 SER n 1 104 ILE n 1 105 ARG n 1 106 ILE n 1 107 THR n 1 108 LEU n 1 109 LEU n 1 110 PRO n 1 111 LEU n 1 112 SER n 1 113 LEU n 1 114 SER n 1 115 ALA n 1 116 ARG n 1 117 GLY n 1 118 GLN n 1 119 GLY n 1 120 ARG n 1 121 VAL n 1 122 GLY n 1 123 GLU n 1 124 MSE n 1 125 THR n 1 126 GLN n 1 127 LEU n 1 128 ILE n 1 129 SER n 1 130 ALA n 1 131 ALA n 1 132 PHE n 1 133 GLU n 1 134 HIS n 1 135 THR n 1 136 VAL n 1 137 SER n 1 138 GLU n 1 139 ALA n 1 140 ARG n 1 141 LYS n 1 142 LEU n 1 143 LYS n 1 144 SER n 1 145 SER n 1 146 GLY n 1 147 THR n 1 148 LYS n 1 149 ALA n 1 150 ARG n 1 151 GLY n 1 152 ALA n 1 153 VAL n 1 154 ILE n 1 155 LEU n 1 156 LEU n 1 157 VAL n 1 158 ASP n 1 159 GLU n 1 160 ALA n 1 161 ASP n 1 162 ALA n 1 163 LEU n 1 164 ALA n 1 165 GLN n 1 166 SER n 1 167 ARG n 1 168 GLU n 1 169 ALA n 1 170 ALA n 1 171 GLN n 1 172 MSE n 1 173 HIS n 1 174 HIS n 1 175 GLU n 1 176 ASP n 1 177 ARG n 1 178 ALA n 1 179 GLY n 1 180 VAL n 1 181 ASN n 1 182 ALA n 1 183 PHE n 1 184 ILE n 1 185 ARG n 1 186 GLY n 1 187 ILE n 1 188 ASP n 1 189 ARG n 1 190 LEU n 1 191 GLY n 1 192 ASN n 1 193 GLY n 1 194 ALA n 1 195 LEU n 1 196 PRO n 1 197 ALA n 1 198 ALA n 1 199 VAL n 1 200 ILE n 1 201 MSE n 1 202 CYS n 1 203 THR n 1 204 ASN n 1 205 ARG n 1 206 VAL n 1 207 ASP n 1 208 SER n 1 209 LEU n 1 210 ASP n 1 211 PRO n 1 212 ALA n 1 213 VAL n 1 214 ARG n 1 215 ARG n 1 216 ARG n 1 217 ALA n 1 218 ALA n 1 219 GLU n 1 220 ILE n 1 221 ILE n 1 222 THR n 1 223 PHE n 1 224 ASP n 1 225 ARG n 1 226 PRO n 1 227 ASN n 1 228 ASP n 1 229 ALA n 1 230 GLN n 1 231 ARG n 1 232 ARG n 1 233 ALA n 1 234 VAL n 1 235 ILE n 1 236 THR n 1 237 THR n 1 238 THR n 1 239 LEU n 1 240 GLN n 1 241 GLY n 1 242 THR n 1 243 GLY n 1 244 VAL n 1 245 THR n 1 246 GLY n 1 247 SER n 1 248 GLN n 1 249 ILE n 1 250 GLU n 1 251 GLY n 1 252 LEU n 1 253 VAL n 1 254 ALA n 1 255 ALA n 1 256 THR n 1 257 GLY n 1 258 PRO n 1 259 ALA n 1 260 ARG n 1 261 PRO n 1 262 ARG n 1 263 ASP n 1 264 TYR n 1 265 GLY n 1 266 PHE n 1 267 THR n 1 268 PHE n 1 269 SER n 1 270 ASP n 1 271 LEU n 1 272 THR n 1 273 GLN n 1 274 ARG n 1 275 LEU n 1 276 ILE n 1 277 PRO n 1 278 SER n 1 279 ILE n 1 280 VAL n 1 281 LEU n 1 282 ASP n 1 283 ALA n 1 284 TYR n 1 285 PRO n 1 286 ASP n 1 287 THR n 1 288 SER n 1 289 ILE n 1 290 ASN n 1 291 PRO n 1 292 ALA n 1 293 ARG n 1 294 ALA n 1 295 LEU n 1 296 ALA n 1 297 ILE n 1 298 ALA n 1 299 GLN n 1 300 ALA n 1 301 MSE n 1 302 ALA n 1 303 PRO n 1 304 THR n 1 305 ALA n 1 306 PRO n 1 307 PHE n 1 308 GLN n 1 309 ASP n 1 310 LYS n 1 311 SER n 1 312 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 312 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'MARINE METAGENOME' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 408172 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6PB3 _struct_ref.pdbx_db_accession 6PB3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6PB3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 312 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6PB3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 312 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 312 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6PB3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.13 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.28 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM sodium citrate pH 6.0, 1.6 M NH2SO4, and 0.2 M sodium/potassium tartrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-11-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6PB3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.048 _reflns.d_resolution_low 86.98 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17737 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.2 _reflns.pdbx_Rmerge_I_obs 0.058 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.061 _reflns.pdbx_Rpim_I_all 0.019 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.05 _reflns_shell.d_res_low 2.10 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1347 _reflns_shell.percent_possible_all 99 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.955 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 10.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.057 _reflns_shell.pdbx_Rpim_I_all 0.635 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.540 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6PB3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.048 _refine.ls_d_res_low 86.980 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17728 _refine.ls_number_reflns_R_free 866 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.11 _refine.ls_percent_reflns_R_free 4.88 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2106 _refine.ls_R_factor_R_free 0.2517 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2085 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.49 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.32 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.048 _refine_hist.d_res_low 86.980 _refine_hist.number_atoms_solvent 41 _refine_hist.number_atoms_total 1969 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1923 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1952 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.829 ? 2656 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 9.904 ? 1194 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.047 ? 328 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 344 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.0484 2.1768 . . 134 2774 99.00 . . . 0.4217 . 0.3304 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1768 2.3449 . . 159 2770 99.00 . . . 0.2785 . 0.2491 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3449 2.5809 . . 144 2772 98.00 . . . 0.2778 . 0.2118 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5809 2.9543 . . 132 2830 100.00 . . . 0.2662 . 0.2020 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9543 3.7222 . . 141 2832 99.00 . . . 0.2552 . 0.2241 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7222 87.0586 . . 156 2884 99.00 . . . 0.2332 . 0.1932 . . . . . . . . . . # _struct.entry_id 6PB3 _struct.title 'Structure of Rhizobiales Trip13' _struct.pdbx_descriptor 'Rhizobiales Sp. Pch2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6PB3 _struct_keywords.text 'ATPase, Remodeller, HORMA domain, TRIP13, Pch2, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 19 ? LEU A 29 ? ASP A 19 LEU A 29 1 ? 11 HELX_P HELX_P2 AA2 LEU A 32 ? ASN A 48 ? LEU A 32 ASN A 48 1 ? 17 HELX_P HELX_P3 AA3 ASN A 48 ? HIS A 60 ? ASN A 48 HIS A 60 1 ? 13 HELX_P HELX_P4 AA4 VAL A 67 ? ARG A 72 ? VAL A 67 ARG A 72 1 ? 6 HELX_P HELX_P5 AA5 GLY A 86 ? ILE A 94 ? GLY A 86 ILE A 94 1 ? 9 HELX_P HELX_P6 AA6 ILE A 94 ? SER A 103 ? ILE A 94 SER A 103 1 ? 10 HELX_P HELX_P7 AA7 MSE A 124 ? LEU A 142 ? MSE A 124 LEU A 142 1 ? 19 HELX_P HELX_P8 AA8 GLY A 179 ? GLY A 193 ? GLY A 179 GLY A 193 1 ? 15 HELX_P HELX_P9 AA9 ARG A 205 ? LEU A 209 ? ARG A 205 LEU A 209 5 ? 5 HELX_P HELX_P10 AB1 ASP A 210 ? ARG A 215 ? ASP A 210 ARG A 215 1 ? 6 HELX_P HELX_P11 AB2 ASN A 227 ? GLN A 240 ? ASN A 227 GLN A 240 1 ? 14 HELX_P HELX_P12 AB3 THR A 245 ? THR A 256 ? THR A 245 THR A 256 1 ? 12 HELX_P HELX_P13 AB4 THR A 267 ? GLN A 273 ? THR A 267 GLN A 273 1 ? 7 HELX_P HELX_P14 AB5 ARG A 274 ? TYR A 284 ? ARG A 274 TYR A 284 1 ? 11 HELX_P HELX_P15 AB6 ASN A 290 ? MSE A 301 ? ASN A 290 MSE A 301 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A LYS 41 C ? ? ? 1_555 A MSE 42 N ? ? A LYS 41 A MSE 42 1_555 ? ? ? ? ? ? ? 1.336 ? covale2 covale both ? A MSE 42 C ? ? ? 1_555 A LEU 43 N ? ? A MSE 42 A LEU 43 1_555 ? ? ? ? ? ? ? 1.335 ? covale3 covale both ? A GLU 123 C ? ? ? 1_555 A MSE 124 N ? ? A GLU 123 A MSE 124 1_555 ? ? ? ? ? ? ? 1.328 ? covale4 covale both ? A MSE 124 C ? ? ? 1_555 A THR 125 N ? ? A MSE 124 A THR 125 1_555 ? ? ? ? ? ? ? 1.334 ? covale5 covale both ? A ILE 200 C ? ? ? 1_555 A MSE 201 N ? ? A ILE 200 A MSE 201 1_555 ? ? ? ? ? ? ? 1.313 ? covale6 covale both ? A MSE 201 C ? ? ? 1_555 A CYS 202 N ? ? A MSE 201 A CYS 202 1_555 ? ? ? ? ? ? ? 1.326 ? covale7 covale both ? A ALA 300 C ? ? ? 1_555 A MSE 301 N ? ? A ALA 300 A MSE 301 1_555 ? ? ? ? ? ? ? 1.326 ? covale8 covale both ? A MSE 301 C ? ? ? 1_555 A ALA 302 N ? ? A MSE 301 A ALA 302 1_555 ? ? ? ? ? ? ? 1.339 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 17 A . ? TYR 17 A PRO 18 A ? PRO 18 A 1 0.00 2 GLU 159 A . ? GLU 159 A ALA 160 A ? ALA 160 A 1 -3.34 3 TYR 284 A . ? TYR 284 A PRO 285 A ? PRO 285 A 1 -1.92 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 15 ? TYR A 17 ? SER A 15 TYR A 17 AA1 2 ARG A 105 ? LEU A 111 ? ARG A 105 LEU A 111 AA1 3 GLY A 151 ? VAL A 157 ? GLY A 151 VAL A 157 AA1 4 ALA A 197 ? THR A 203 ? ALA A 197 THR A 203 AA1 5 LEU A 76 ? GLY A 81 ? LEU A 76 GLY A 81 AA1 6 GLU A 219 ? PHE A 223 ? GLU A 219 PHE A 223 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 15 ? N SER A 15 O LEU A 108 ? O LEU A 108 AA1 2 3 N LEU A 109 ? N LEU A 109 O ILE A 154 ? O ILE A 154 AA1 3 4 N LEU A 155 ? N LEU A 155 O ALA A 198 ? O ALA A 198 AA1 4 5 O MSE A 201 ? O MSE A 201 N LEU A 79 ? N LEU A 79 AA1 5 6 N VAL A 78 ? N VAL A 78 O ILE A 221 ? O ILE A 221 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id SO4 _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 10 _struct_site.details 'binding site for residue SO4 A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 ASP A 82 ? ASP A 82 . ? 1_555 ? 2 AC1 10 VAL A 83 ? VAL A 83 . ? 1_555 ? 3 AC1 10 GLY A 84 ? GLY A 84 . ? 1_555 ? 4 AC1 10 SER A 85 ? SER A 85 . ? 1_555 ? 5 AC1 10 GLY A 86 ? GLY A 86 . ? 1_555 ? 6 AC1 10 LYS A 87 ? LYS A 87 . ? 1_555 ? 7 AC1 10 THR A 88 ? THR A 88 . ? 1_555 ? 8 AC1 10 ARG A 215 ? ARG A 215 . ? 6_555 ? 9 AC1 10 HOH C . ? HOH A 514 . ? 6_555 ? 10 AC1 10 HOH C . ? HOH A 520 . ? 1_555 ? # _atom_sites.entry_id 6PB3 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009957 _atom_sites.fract_transf_matrix[1][2] 0.005748 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011497 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020467 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 MSE 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 PRO 5 5 ? ? ? A . n A 1 6 ASP 6 6 ? ? ? A . n A 1 7 LEU 7 7 ? ? ? A . n A 1 8 ALA 8 8 ? ? ? A . n A 1 9 GLY 9 9 ? ? ? A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 MSE 42 42 42 MSE MSE A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 TRP 55 55 55 TRP TRP A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 LEU 113 113 ? ? ? A . n A 1 114 SER 114 114 ? ? ? A . n A 1 115 ALA 115 115 ? ? ? A . n A 1 116 ARG 116 116 ? ? ? A . n A 1 117 GLY 117 117 ? ? ? A . n A 1 118 GLN 118 118 ? ? ? A . n A 1 119 GLY 119 119 ? ? ? A . n A 1 120 ARG 120 120 ? ? ? A . n A 1 121 VAL 121 121 ? ? ? A . n A 1 122 GLY 122 122 ? ? ? A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 MSE 124 124 124 MSE MSE A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 HIS 134 134 134 HIS HIS A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 LYS 143 143 ? ? ? A . n A 1 144 SER 144 144 ? ? ? A . n A 1 145 SER 145 145 ? ? ? A . n A 1 146 GLY 146 146 ? ? ? A . n A 1 147 THR 147 147 ? ? ? A . n A 1 148 LYS 148 148 ? ? ? A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 ARG 150 150 150 ARG ARG A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 ASP 161 161 ? ? ? A . n A 1 162 ALA 162 162 ? ? ? A . n A 1 163 LEU 163 163 ? ? ? A . n A 1 164 ALA 164 164 ? ? ? A . n A 1 165 GLN 165 165 ? ? ? A . n A 1 166 SER 166 166 ? ? ? A . n A 1 167 ARG 167 167 ? ? ? A . n A 1 168 GLU 168 168 ? ? ? A . n A 1 169 ALA 169 169 ? ? ? A . n A 1 170 ALA 170 170 ? ? ? A . n A 1 171 GLN 171 171 ? ? ? A . n A 1 172 MSE 172 172 ? ? ? A . n A 1 173 HIS 173 173 ? ? ? A . n A 1 174 HIS 174 174 ? ? ? A . n A 1 175 GLU 175 175 ? ? ? A . n A 1 176 ASP 176 176 ? ? ? A . n A 1 177 ARG 177 177 ? ? ? A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 ASN 181 181 181 ASN ASN A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 PHE 183 183 183 PHE PHE A . n A 1 184 ILE 184 184 184 ILE ILE A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ASP 188 188 188 ASP ASP A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 ASN 192 192 192 ASN ASN A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 PRO 196 196 196 PRO PRO A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 MSE 201 201 201 MSE MSE A . n A 1 202 CYS 202 202 202 CYS CYS A . n A 1 203 THR 203 203 203 THR THR A . n A 1 204 ASN 204 204 204 ASN ASN A . n A 1 205 ARG 205 205 205 ARG ARG A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 ASP 207 207 207 ASP ASP A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 ASP 210 210 210 ASP ASP A . n A 1 211 PRO 211 211 211 PRO PRO A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 ARG 214 214 214 ARG ARG A . n A 1 215 ARG 215 215 215 ARG ARG A . n A 1 216 ARG 216 216 216 ARG ARG A . n A 1 217 ALA 217 217 217 ALA ALA A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 ILE 220 220 220 ILE ILE A . n A 1 221 ILE 221 221 221 ILE ILE A . n A 1 222 THR 222 222 222 THR THR A . n A 1 223 PHE 223 223 223 PHE PHE A . n A 1 224 ASP 224 224 224 ASP ASP A . n A 1 225 ARG 225 225 225 ARG ARG A . n A 1 226 PRO 226 226 226 PRO PRO A . n A 1 227 ASN 227 227 227 ASN ASN A . n A 1 228 ASP 228 228 228 ASP ASP A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 GLN 230 230 230 GLN GLN A . n A 1 231 ARG 231 231 231 ARG ARG A . n A 1 232 ARG 232 232 232 ARG ARG A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 THR 236 236 236 THR THR A . n A 1 237 THR 237 237 237 THR THR A . n A 1 238 THR 238 238 238 THR THR A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 GLN 240 240 240 GLN GLN A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 THR 242 242 242 THR THR A . n A 1 243 GLY 243 243 243 GLY GLY A . n A 1 244 VAL 244 244 244 VAL VAL A . n A 1 245 THR 245 245 245 THR THR A . n A 1 246 GLY 246 246 246 GLY GLY A . n A 1 247 SER 247 247 247 SER SER A . n A 1 248 GLN 248 248 248 GLN GLN A . n A 1 249 ILE 249 249 249 ILE ILE A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 GLY 251 251 251 GLY GLY A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 VAL 253 253 253 VAL VAL A . n A 1 254 ALA 254 254 254 ALA ALA A . n A 1 255 ALA 255 255 255 ALA ALA A . n A 1 256 THR 256 256 256 THR THR A . n A 1 257 GLY 257 257 257 GLY GLY A . n A 1 258 PRO 258 258 258 PRO PRO A . n A 1 259 ALA 259 259 259 ALA ALA A . n A 1 260 ARG 260 260 ? ? ? A . n A 1 261 PRO 261 261 ? ? ? A . n A 1 262 ARG 262 262 ? ? ? A . n A 1 263 ASP 263 263 263 ASP ASP A . n A 1 264 TYR 264 264 264 TYR TYR A . n A 1 265 GLY 265 265 265 GLY GLY A . n A 1 266 PHE 266 266 266 PHE PHE A . n A 1 267 THR 267 267 267 THR THR A . n A 1 268 PHE 268 268 268 PHE PHE A . n A 1 269 SER 269 269 269 SER SER A . n A 1 270 ASP 270 270 270 ASP ASP A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 THR 272 272 272 THR THR A . n A 1 273 GLN 273 273 273 GLN GLN A . n A 1 274 ARG 274 274 274 ARG ARG A . n A 1 275 LEU 275 275 275 LEU LEU A . n A 1 276 ILE 276 276 276 ILE ILE A . n A 1 277 PRO 277 277 277 PRO PRO A . n A 1 278 SER 278 278 278 SER SER A . n A 1 279 ILE 279 279 279 ILE ILE A . n A 1 280 VAL 280 280 280 VAL VAL A . n A 1 281 LEU 281 281 281 LEU LEU A . n A 1 282 ASP 282 282 282 ASP ASP A . n A 1 283 ALA 283 283 283 ALA ALA A . n A 1 284 TYR 284 284 284 TYR TYR A . n A 1 285 PRO 285 285 285 PRO PRO A . n A 1 286 ASP 286 286 286 ASP ASP A . n A 1 287 THR 287 287 287 THR THR A . n A 1 288 SER 288 288 288 SER SER A . n A 1 289 ILE 289 289 289 ILE ILE A . n A 1 290 ASN 290 290 290 ASN ASN A . n A 1 291 PRO 291 291 291 PRO PRO A . n A 1 292 ALA 292 292 292 ALA ALA A . n A 1 293 ARG 293 293 293 ARG ARG A . n A 1 294 ALA 294 294 294 ALA ALA A . n A 1 295 LEU 295 295 295 LEU LEU A . n A 1 296 ALA 296 296 296 ALA ALA A . n A 1 297 ILE 297 297 297 ILE ILE A . n A 1 298 ALA 298 298 298 ALA ALA A . n A 1 299 GLN 299 299 299 GLN GLN A . n A 1 300 ALA 300 300 300 ALA ALA A . n A 1 301 MSE 301 301 301 MSE MSE A . n A 1 302 ALA 302 302 302 ALA ALA A . n A 1 303 PRO 303 303 303 PRO PRO A . n A 1 304 THR 304 304 304 THR THR A . n A 1 305 ALA 305 305 305 ALA ALA A . n A 1 306 PRO 306 306 306 PRO PRO A . n A 1 307 PHE 307 307 ? ? ? A . n A 1 308 GLN 308 308 ? ? ? A . n A 1 309 ASP 309 309 ? ? ? A . n A 1 310 LYS 310 310 ? ? ? A . n A 1 311 SER 311 311 ? ? ? A . n A 1 312 ARG 312 312 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 401 1 SO4 SO4 A . C 3 HOH 1 501 53 HOH HOH A . C 3 HOH 2 502 30 HOH HOH A . C 3 HOH 3 503 25 HOH HOH A . C 3 HOH 4 504 16 HOH HOH A . C 3 HOH 5 505 24 HOH HOH A . C 3 HOH 6 506 14 HOH HOH A . C 3 HOH 7 507 9 HOH HOH A . C 3 HOH 8 508 8 HOH HOH A . C 3 HOH 9 509 11 HOH HOH A . C 3 HOH 10 510 6 HOH HOH A . C 3 HOH 11 511 4 HOH HOH A . C 3 HOH 12 512 2 HOH HOH A . C 3 HOH 13 513 21 HOH HOH A . C 3 HOH 14 514 13 HOH HOH A . C 3 HOH 15 515 5 HOH HOH A . C 3 HOH 16 516 3 HOH HOH A . C 3 HOH 17 517 29 HOH HOH A . C 3 HOH 18 518 50 HOH HOH A . C 3 HOH 19 519 55 HOH HOH A . C 3 HOH 20 520 10 HOH HOH A . C 3 HOH 21 521 1 HOH HOH A . C 3 HOH 22 522 18 HOH HOH A . C 3 HOH 23 523 7 HOH HOH A . C 3 HOH 24 524 49 HOH HOH A . C 3 HOH 25 525 36 HOH HOH A . C 3 HOH 26 526 54 HOH HOH A . C 3 HOH 27 527 20 HOH HOH A . C 3 HOH 28 528 33 HOH HOH A . C 3 HOH 29 529 12 HOH HOH A . C 3 HOH 30 530 37 HOH HOH A . C 3 HOH 31 531 43 HOH HOH A . C 3 HOH 32 532 27 HOH HOH A . C 3 HOH 33 533 17 HOH HOH A . C 3 HOH 34 534 31 HOH HOH A . C 3 HOH 35 535 52 HOH HOH A . C 3 HOH 36 536 32 HOH HOH A . C 3 HOH 37 537 34 HOH HOH A . C 3 HOH 38 538 23 HOH HOH A . C 3 HOH 39 539 51 HOH HOH A . C 3 HOH 40 540 19 HOH HOH A . C 3 HOH 41 541 35 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 17480 ? 1 MORE -195 ? 1 'SSA (A^2)' 65360 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 y,-x+y,z 0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 x-y,x,z 0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-12-25 2 'Structure model' 1 1 2020-01-22 3 'Structure model' 1 2 2020-03-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' struct 3 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_struct.title' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.page_first' 13 3 'Structure model' '_citation.year' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 34.3700 -6.6825 -18.1426 0.3898 ? 0.0261 ? -0.0322 ? 0.4729 ? -0.0228 ? 0.4735 ? 3.7423 ? 1.8841 ? -0.7819 ? 5.3991 ? -0.1718 ? 4.3111 ? -0.0382 ? 0.2056 ? 0.1093 ? -0.3598 ? 0.0191 ? 0.0965 ? 0.1466 ? 0.2654 ? -0.0611 ? 2 'X-RAY DIFFRACTION' ? refined 26.9937 16.8268 1.6365 0.7611 ? 0.0602 ? 0.0516 ? 0.6086 ? -0.0762 ? 0.5670 ? 1.7612 ? -0.0523 ? 1.0344 ? 2.7971 ? 0.2747 ? 3.2643 ? -0.0853 ? -0.7797 ? 0.1596 ? 1.0214 ? 0.0022 ? 0.2635 ? -0.2708 ? 0.0115 ? 0.1132 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 10 through 224 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 225 through 306 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.15.2_3472: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_entry_details.entry_id 6PB3 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NH1 A ARG 38 ? ? O A HOH 501 ? ? 2.07 2 1 NH1 A ARG 100 ? ? O A HOH 502 ? ? 2.10 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 11 ? ? -126.54 -78.43 2 1 GLU A 12 ? ? -167.07 -111.25 3 1 ASP A 224 ? ? -113.47 -166.91 4 1 ARG A 274 ? ? -122.54 -61.33 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 12 ? CG ? A GLU 12 CG 2 1 Y 1 A GLU 12 ? CD ? A GLU 12 CD 3 1 Y 1 A GLU 12 ? OE1 ? A GLU 12 OE1 4 1 Y 1 A GLU 12 ? OE2 ? A GLU 12 OE2 5 1 Y 1 A LYS 68 ? CG ? A LYS 68 CG 6 1 Y 1 A LYS 68 ? CD ? A LYS 68 CD 7 1 Y 1 A LYS 68 ? CE ? A LYS 68 CE 8 1 Y 1 A LYS 68 ? NZ ? A LYS 68 NZ 9 1 Y 1 A ARG 72 ? CG ? A ARG 72 CG 10 1 Y 1 A ARG 72 ? CD ? A ARG 72 CD 11 1 Y 1 A ARG 72 ? NE ? A ARG 72 NE 12 1 Y 1 A ARG 72 ? CZ ? A ARG 72 CZ 13 1 Y 1 A ARG 72 ? NH1 ? A ARG 72 NH1 14 1 Y 1 A ARG 72 ? NH2 ? A ARG 72 NH2 15 1 Y 1 A GLU 123 ? CG ? A GLU 123 CG 16 1 Y 1 A GLU 123 ? CD ? A GLU 123 CD 17 1 Y 1 A GLU 123 ? OE1 ? A GLU 123 OE1 18 1 Y 1 A GLU 123 ? OE2 ? A GLU 123 OE2 19 1 Y 1 A ASP 158 ? CG ? A ASP 158 CG 20 1 Y 1 A ASP 158 ? OD1 ? A ASP 158 OD1 21 1 Y 1 A ASP 158 ? OD2 ? A ASP 158 OD2 22 1 Y 1 A ASP 263 ? CG ? A ASP 263 CG 23 1 Y 1 A ASP 263 ? OD1 ? A ASP 263 OD1 24 1 Y 1 A ASP 263 ? OD2 ? A ASP 263 OD2 25 1 Y 1 A ASP 286 ? CG ? A ASP 286 CG 26 1 Y 1 A ASP 286 ? OD1 ? A ASP 286 OD1 27 1 Y 1 A ASP 286 ? OD2 ? A ASP 286 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A MSE 3 ? A MSE 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A PRO 5 ? A PRO 5 6 1 Y 1 A ASP 6 ? A ASP 6 7 1 Y 1 A LEU 7 ? A LEU 7 8 1 Y 1 A ALA 8 ? A ALA 8 9 1 Y 1 A GLY 9 ? A GLY 9 10 1 Y 1 A LEU 113 ? A LEU 113 11 1 Y 1 A SER 114 ? A SER 114 12 1 Y 1 A ALA 115 ? A ALA 115 13 1 Y 1 A ARG 116 ? A ARG 116 14 1 Y 1 A GLY 117 ? A GLY 117 15 1 Y 1 A GLN 118 ? A GLN 118 16 1 Y 1 A GLY 119 ? A GLY 119 17 1 Y 1 A ARG 120 ? A ARG 120 18 1 Y 1 A VAL 121 ? A VAL 121 19 1 Y 1 A GLY 122 ? A GLY 122 20 1 Y 1 A LYS 143 ? A LYS 143 21 1 Y 1 A SER 144 ? A SER 144 22 1 Y 1 A SER 145 ? A SER 145 23 1 Y 1 A GLY 146 ? A GLY 146 24 1 Y 1 A THR 147 ? A THR 147 25 1 Y 1 A LYS 148 ? A LYS 148 26 1 Y 1 A ASP 161 ? A ASP 161 27 1 Y 1 A ALA 162 ? A ALA 162 28 1 Y 1 A LEU 163 ? A LEU 163 29 1 Y 1 A ALA 164 ? A ALA 164 30 1 Y 1 A GLN 165 ? A GLN 165 31 1 Y 1 A SER 166 ? A SER 166 32 1 Y 1 A ARG 167 ? A ARG 167 33 1 Y 1 A GLU 168 ? A GLU 168 34 1 Y 1 A ALA 169 ? A ALA 169 35 1 Y 1 A ALA 170 ? A ALA 170 36 1 Y 1 A GLN 171 ? A GLN 171 37 1 Y 1 A MSE 172 ? A MSE 172 38 1 Y 1 A HIS 173 ? A HIS 173 39 1 Y 1 A HIS 174 ? A HIS 174 40 1 Y 1 A GLU 175 ? A GLU 175 41 1 Y 1 A ASP 176 ? A ASP 176 42 1 Y 1 A ARG 177 ? A ARG 177 43 1 Y 1 A ARG 260 ? A ARG 260 44 1 Y 1 A PRO 261 ? A PRO 261 45 1 Y 1 A ARG 262 ? A ARG 262 46 1 Y 1 A PHE 307 ? A PHE 307 47 1 Y 1 A GLN 308 ? A GLN 308 48 1 Y 1 A ASP 309 ? A ASP 309 49 1 Y 1 A LYS 310 ? A LYS 310 50 1 Y 1 A SER 311 ? A SER 311 51 1 Y 1 A ARG 312 ? A ARG 312 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # _pdbx_related_exp_data_set.ordinal 1 _pdbx_related_exp_data_set.data_reference 10.15785/SBGRID/681 _pdbx_related_exp_data_set.metadata_reference ? _pdbx_related_exp_data_set.data_set_type 'diffraction image data' _pdbx_related_exp_data_set.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Confirmed by size exclusion chromatography coupled to multi-angle light scattering' #