data_6PQE # _entry.id 6PQE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6PQE pdb_00006pqe 10.2210/pdb6pqe/pdb WWPDB D_1000242877 ? ? BMRB 30629 ? 10.13018/BMR30629 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-09-18 2 'Structure model' 1 1 2019-10-23 3 'Structure model' 1 2 2020-01-01 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' pdbx_audit_support 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_database_status 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 3 'Structure model' '_pdbx_audit_support.funding_organization' 7 4 'Structure model' '_database_2.pdbx_DOI' 8 4 'Structure model' '_database_2.pdbx_database_accession' 9 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 10 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6PQE _pdbx_database_status.recvd_initial_deposition_date 2019-07-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 6PQ2 unspecified PDB . 6PPT unspecified BMRB 'Structural Basis for Client Recognition and Activity of Hsp40 Chaperones' 30629 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jiang, Y.' 1 0000-0002-0886-292X 'Rossi, P.' 2 0000-0001-8178-0122 'Kalodimos, C.G.' 3 0000-0001-6354-2796 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 365 _citation.language ? _citation.page_first 1313 _citation.page_last 1319 _citation.title 'Structural basis for client recognition and activity of Hsp40 chaperones.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.aax1280 _citation.pdbx_database_id_PubMed 31604242 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jiang, Y.' 1 ? primary 'Rossi, P.' 2 ? primary 'Kalodimos, C.G.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Alkaline phosphatase,Chaperone protein DnaJ 2 fusion' _entity.formula_weight 9017.255 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.3.1 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name APase # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;METATAGEWQGKGSGGSGGSGGSQDLYATLDVPAPIAVVGGKVRAMTLEGPVEVAVPPRTQAGRKLRLKGKGFPGPAGRG DLYLEVRIT ; _entity_poly.pdbx_seq_one_letter_code_can ;METATAGEWQGKGSGGSGGSGGSQDLYATLDVPAPIAVVGGKVRAMTLEGPVEVAVPPRTQAGRKLRLKGKGFPGPAGRG DLYLEVRIT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 THR n 1 4 ALA n 1 5 THR n 1 6 ALA n 1 7 GLY n 1 8 GLU n 1 9 TRP n 1 10 GLN n 1 11 GLY n 1 12 LYS n 1 13 GLY n 1 14 SER n 1 15 GLY n 1 16 GLY n 1 17 SER n 1 18 GLY n 1 19 GLY n 1 20 SER n 1 21 GLY n 1 22 GLY n 1 23 SER n 1 24 GLN n 1 25 ASP n 1 26 LEU n 1 27 TYR n 1 28 ALA n 1 29 THR n 1 30 LEU n 1 31 ASP n 1 32 VAL n 1 33 PRO n 1 34 ALA n 1 35 PRO n 1 36 ILE n 1 37 ALA n 1 38 VAL n 1 39 VAL n 1 40 GLY n 1 41 GLY n 1 42 LYS n 1 43 VAL n 1 44 ARG n 1 45 ALA n 1 46 MET n 1 47 THR n 1 48 LEU n 1 49 GLU n 1 50 GLY n 1 51 PRO n 1 52 VAL n 1 53 GLU n 1 54 VAL n 1 55 ALA n 1 56 VAL n 1 57 PRO n 1 58 PRO n 1 59 ARG n 1 60 THR n 1 61 GLN n 1 62 ALA n 1 63 GLY n 1 64 ARG n 1 65 LYS n 1 66 LEU n 1 67 ARG n 1 68 LEU n 1 69 LYS n 1 70 GLY n 1 71 LYS n 1 72 GLY n 1 73 PHE n 1 74 PRO n 1 75 GLY n 1 76 PRO n 1 77 ALA n 1 78 GLY n 1 79 ARG n 1 80 GLY n 1 81 ASP n 1 82 LEU n 1 83 TYR n 1 84 LEU n 1 85 GLU n 1 86 VAL n 1 87 ARG n 1 88 ILE n 1 89 THR n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 23 ? ? 'phoA, b0383, JW0374' ? K12 ? ? ? ? 'Escherichia coli (strain K12)' 83333 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 24 89 ? ? 'dnaJ2, TTHA1489' ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 168 168 MET MET A . n A 1 2 GLU 2 169 169 GLU GLU A . n A 1 3 THR 3 170 170 THR THR A . n A 1 4 ALA 4 171 171 ALA ALA A . n A 1 5 THR 5 172 172 THR THR A . n A 1 6 ALA 6 173 173 ALA ALA A . n A 1 7 GLY 7 174 174 GLY GLY A . n A 1 8 GLU 8 175 175 GLU GLU A . n A 1 9 TRP 9 176 176 TRP TRP A . n A 1 10 GLN 10 177 177 GLN GLN A . n A 1 11 GLY 11 178 178 GLY GLY A . n A 1 12 LYS 12 179 179 LYS LYS A . n A 1 13 GLY 13 180 180 GLY GLY A . n A 1 14 SER 14 181 181 SER SER A . n A 1 15 GLY 15 182 182 GLY GLY A . n A 1 16 GLY 16 183 183 GLY GLY A . n A 1 17 SER 17 184 184 SER SER A . n A 1 18 GLY 18 185 185 GLY GLY A . n A 1 19 GLY 19 186 186 GLY GLY A . n A 1 20 SER 20 187 187 SER SER A . n A 1 21 GLY 21 188 188 GLY GLY A . n A 1 22 GLY 22 189 189 GLY GLY A . n A 1 23 SER 23 190 190 SER SER A . n A 1 24 GLN 24 191 191 GLN GLN A . n A 1 25 ASP 25 192 192 ASP ASP A . n A 1 26 LEU 26 193 193 LEU LEU A . n A 1 27 TYR 27 194 194 TYR TYR A . n A 1 28 ALA 28 195 195 ALA ALA A . n A 1 29 THR 29 196 196 THR THR A . n A 1 30 LEU 30 197 197 LEU LEU A . n A 1 31 ASP 31 198 198 ASP ASP A . n A 1 32 VAL 32 199 199 VAL VAL A . n A 1 33 PRO 33 200 200 PRO PRO A . n A 1 34 ALA 34 201 201 ALA ALA A . n A 1 35 PRO 35 202 202 PRO PRO A . n A 1 36 ILE 36 203 203 ILE ILE A . n A 1 37 ALA 37 204 204 ALA ALA A . n A 1 38 VAL 38 205 205 VAL VAL A . n A 1 39 VAL 39 206 206 VAL VAL A . n A 1 40 GLY 40 207 207 GLY GLY A . n A 1 41 GLY 41 208 208 GLY GLY A . n A 1 42 LYS 42 209 209 LYS LYS A . n A 1 43 VAL 43 210 210 VAL VAL A . n A 1 44 ARG 44 211 211 ARG ARG A . n A 1 45 ALA 45 212 212 ALA ALA A . n A 1 46 MET 46 213 213 MET MET A . n A 1 47 THR 47 214 214 THR THR A . n A 1 48 LEU 48 215 215 LEU LEU A . n A 1 49 GLU 49 216 216 GLU GLU A . n A 1 50 GLY 50 217 217 GLY GLY A . n A 1 51 PRO 51 218 218 PRO PRO A . n A 1 52 VAL 52 219 219 VAL VAL A . n A 1 53 GLU 53 220 220 GLU GLU A . n A 1 54 VAL 54 221 221 VAL VAL A . n A 1 55 ALA 55 222 222 ALA ALA A . n A 1 56 VAL 56 223 223 VAL VAL A . n A 1 57 PRO 57 224 224 PRO PRO A . n A 1 58 PRO 58 225 225 PRO PRO A . n A 1 59 ARG 59 226 226 ARG ARG A . n A 1 60 THR 60 227 227 THR THR A . n A 1 61 GLN 61 228 228 GLN GLN A . n A 1 62 ALA 62 229 229 ALA ALA A . n A 1 63 GLY 63 230 230 GLY GLY A . n A 1 64 ARG 64 231 231 ARG ARG A . n A 1 65 LYS 65 232 232 LYS LYS A . n A 1 66 LEU 66 233 233 LEU LEU A . n A 1 67 ARG 67 234 234 ARG ARG A . n A 1 68 LEU 68 235 235 LEU LEU A . n A 1 69 LYS 69 236 236 LYS LYS A . n A 1 70 GLY 70 237 237 GLY GLY A . n A 1 71 LYS 71 238 238 LYS LYS A . n A 1 72 GLY 72 239 239 GLY GLY A . n A 1 73 PHE 73 240 240 PHE PHE A . n A 1 74 PRO 74 241 241 PRO PRO A . n A 1 75 GLY 75 242 242 GLY GLY A . n A 1 76 PRO 76 243 243 PRO PRO A . n A 1 77 ALA 77 244 244 ALA ALA A . n A 1 78 GLY 78 245 245 GLY GLY A . n A 1 79 ARG 79 246 246 ARG ARG A . n A 1 80 GLY 80 247 247 GLY GLY A . n A 1 81 ASP 81 248 248 ASP ASP A . n A 1 82 LEU 82 249 249 LEU LEU A . n A 1 83 TYR 83 250 250 TYR TYR A . n A 1 84 LEU 84 251 251 LEU LEU A . n A 1 85 GLU 85 252 252 GLU GLU A . n A 1 86 VAL 86 253 253 VAL VAL A . n A 1 87 ARG 87 254 254 ARG ARG A . n A 1 88 ILE 88 255 255 ILE ILE A . n A 1 89 THR 89 256 256 THR THR A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6PQE _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6PQE _struct.title 'Structural Basis for Client Recognition and Activity of Hsp40 Chaperones' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6PQE _struct_keywords.text 'Client Recognition, CHAPERONE' _struct_keywords.pdbx_keywords CHAPERONE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PPB_ECOLI P00634 ? 1 ETATAGEWQGK 235 2 UNP DNAJ2_THET8 Q56237 ? 1 QDLYATLDVPAPIAVVGGKVRAMTLEGPVEVAVPPRTQAGRKLRLKGKGFPGPAGRGDLYLEVRIT 191 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6PQE A 2 ? 12 ? P00634 235 ? 245 ? 169 179 2 2 6PQE A 24 ? 89 ? Q56237 191 ? 256 ? 191 256 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6PQE MET A 1 ? UNP P00634 ? ? 'initiating methionine' 168 1 1 6PQE GLY A 13 ? UNP P00634 ? ? linker 180 2 1 6PQE SER A 14 ? UNP P00634 ? ? linker 181 3 1 6PQE GLY A 15 ? UNP P00634 ? ? linker 182 4 1 6PQE GLY A 16 ? UNP P00634 ? ? linker 183 5 1 6PQE SER A 17 ? UNP P00634 ? ? linker 184 6 1 6PQE GLY A 18 ? UNP P00634 ? ? linker 185 7 1 6PQE GLY A 19 ? UNP P00634 ? ? linker 186 8 1 6PQE SER A 20 ? UNP P00634 ? ? linker 187 9 1 6PQE GLY A 21 ? UNP P00634 ? ? linker 188 10 1 6PQE GLY A 22 ? UNP P00634 ? ? linker 189 11 1 6PQE SER A 23 ? UNP P00634 ? ? linker 190 12 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ;PhoA ETATAGEWQGK (E235-K245) fused to Hsp40/DnaJ CBD2 QDLYATLDVPAPIAVVGGKVRAMTLEGPVEVAVPPRTQAGRKLRLKGKGFPGPAGRG DLYLEVRIT (Q191-T256) ; # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 34 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 40 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 201 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 207 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 26 ? PRO A 33 ? LEU A 193 PRO A 200 AA1 2 GLY A 78 ? THR A 89 ? GLY A 245 THR A 256 AA1 3 LYS A 65 ? GLY A 75 ? LYS A 232 GLY A 242 AA2 1 LYS A 42 ? MET A 46 ? LYS A 209 MET A 213 AA2 2 PRO A 51 ? ALA A 55 ? PRO A 218 ALA A 222 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 30 ? N LEU A 197 O ARG A 87 ? O ARG A 254 AA1 2 3 O GLY A 78 ? O GLY A 245 N GLY A 75 ? N GLY A 242 AA2 1 2 N ALA A 45 ? N ALA A 212 O VAL A 52 ? O VAL A 219 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 176 ? ? -85.26 -76.09 2 1 GLN A 177 ? ? -168.92 34.80 3 1 SER A 184 ? ? -164.71 99.65 4 2 GLN A 177 ? ? 168.70 -131.56 5 2 LYS A 179 ? ? 31.99 48.97 6 2 SER A 184 ? ? -85.73 -74.14 7 2 SER A 187 ? ? 63.62 92.32 8 2 SER A 190 ? ? 78.50 -41.10 9 3 TRP A 176 ? ? -87.29 -73.10 10 3 GLN A 177 ? ? -169.51 32.43 11 3 LEU A 215 ? ? -66.04 -70.18 12 4 THR A 172 ? ? -147.14 -40.76 13 4 TRP A 176 ? ? -87.03 -86.74 14 4 SER A 181 ? ? -162.48 -52.32 15 5 GLN A 177 ? ? -173.19 -131.99 16 5 SER A 181 ? ? -141.35 -54.46 17 5 ARG A 226 ? ? 49.56 72.84 18 6 GLU A 169 ? ? -171.32 143.02 19 6 TRP A 176 ? ? -72.32 -81.52 20 6 GLN A 177 ? ? -172.12 121.46 21 6 SER A 184 ? ? -166.11 97.47 22 6 SER A 190 ? ? -146.24 -89.99 23 6 GLN A 191 ? ? 54.61 16.58 24 7 TRP A 176 ? ? -84.90 -94.90 25 7 GLN A 177 ? ? 179.91 165.47 26 7 LEU A 215 ? ? -63.53 -70.34 27 7 ARG A 226 ? ? 51.51 70.37 28 8 GLN A 177 ? ? -174.27 -165.08 29 8 SER A 190 ? ? 71.72 -7.82 30 9 TRP A 176 ? ? -70.88 -77.66 31 9 GLN A 177 ? ? -173.71 -162.32 32 9 SER A 190 ? ? -91.66 -73.43 33 9 LEU A 215 ? ? -65.99 -70.24 34 10 THR A 172 ? ? -153.17 -41.36 35 10 TRP A 176 ? ? -85.78 -90.50 36 10 SER A 181 ? ? -147.70 -64.94 37 10 SER A 187 ? ? -147.01 19.83 38 10 ARG A 226 ? ? 41.44 73.93 39 11 TRP A 176 ? ? -77.79 -83.56 40 11 GLN A 177 ? ? -131.25 -59.63 41 11 SER A 184 ? ? -164.25 -17.59 42 11 SER A 190 ? ? -81.87 -70.91 43 11 ARG A 226 ? ? 51.54 71.80 44 12 THR A 170 ? ? -57.02 95.77 45 12 TRP A 176 ? ? -92.00 -102.99 46 12 GLN A 177 ? ? 165.21 161.68 47 12 SER A 190 ? ? -162.01 -56.46 48 12 LEU A 215 ? ? -59.32 -70.14 49 13 TRP A 176 ? ? -80.58 -91.90 50 13 GLN A 177 ? ? -174.83 80.77 51 13 ARG A 226 ? ? 49.70 71.23 52 14 TRP A 176 ? ? -82.99 -83.56 53 14 LYS A 179 ? ? -177.94 -175.22 54 14 SER A 184 ? ? -149.57 -79.99 55 14 THR A 214 ? ? -111.54 -169.66 56 14 LEU A 215 ? ? -45.81 -70.33 57 14 ARG A 226 ? ? 49.58 73.27 58 14 ARG A 231 ? ? -58.92 171.72 59 15 GLU A 169 ? ? -80.18 -150.09 60 15 THR A 170 ? ? -63.08 80.84 61 15 GLN A 177 ? ? 75.87 -40.95 62 15 SER A 187 ? ? 71.10 108.01 63 15 SER A 190 ? ? -91.09 -65.60 64 16 ALA A 173 ? ? -75.90 -168.79 65 16 TRP A 176 ? ? -82.33 -84.78 66 16 GLN A 177 ? ? 176.25 -173.14 67 16 SER A 190 ? ? -89.44 -95.00 68 16 ARG A 226 ? ? 52.79 72.21 69 17 TRP A 176 ? ? -76.11 -87.72 70 17 LYS A 179 ? ? 170.02 101.62 71 17 SER A 190 ? ? -145.66 -62.11 72 17 ARG A 231 ? ? -68.57 -179.35 73 18 GLU A 169 ? ? -156.70 -154.54 74 19 THR A 170 ? ? 47.59 80.66 75 19 TRP A 176 ? ? -88.12 -80.59 76 19 LYS A 179 ? ? -137.32 -78.25 77 19 ARG A 226 ? ? 55.56 74.21 78 20 GLU A 169 ? ? -75.48 -168.88 79 20 TRP A 176 ? ? -79.52 -82.33 80 20 ARG A 226 ? ? 56.15 74.65 # _pdbx_nmr_ensemble.entry_id 6PQE _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6PQE _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1 mM [U-13C; U-15N] PhoA_235-245_DnaJ_191-256, 20 mM potassium phosphate, 75 mM potassium chloride, 0.04 % sodium azide, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 13C_15N_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details 'double labeled' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 PhoA_235-245_DnaJ_191-256 1 ? mM '[U-13C; U-15N]' 1 'potassium phosphate' 20 ? mM 'natural abundance' 1 'potassium chloride' 75 ? mM 'natural abundance' 1 'sodium azide' 0.04 ? % 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-13C HSQC' 1 isotropic 10 1 1 '2D 1H-15N HSQC' 1 isotropic 9 1 1 '3D 1H-13C NOESY' 1 isotropic 8 1 1 '3D 1H-15N NOESY' 1 isotropic 7 1 1 '3D HNCACB' 1 isotropic 6 1 1 '3D H(CCO)NH' 1 isotropic 2 1 1 '3D HNCO' 1 isotropic 3 1 1 '3D HBHA(CO)NH' 1 isotropic 4 1 1 '3D CCH-NOESY' 1 isotropic 5 1 1 '3D CCH_TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 6PQE _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details 'restrained MD in explicit H2O' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' PINE ? 'Bahrami, Markley, Assadi, and Eghbalnia' 4 'peak picking' Sparky ? Goddard 10 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 9 collection TopSpin 4.0 'Bruker Biospin' 8 'geometry optimization' TALOS ? 'Cornilescu, Delaglio and Bax' 7 processing PSVS ? 'Bhattacharya and Montelione' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 ILE N N N N 106 ILE CA C N S 107 ILE C C N N 108 ILE O O N N 109 ILE CB C N S 110 ILE CG1 C N N 111 ILE CG2 C N N 112 ILE CD1 C N N 113 ILE OXT O N N 114 ILE H H N N 115 ILE H2 H N N 116 ILE HA H N N 117 ILE HB H N N 118 ILE HG12 H N N 119 ILE HG13 H N N 120 ILE HG21 H N N 121 ILE HG22 H N N 122 ILE HG23 H N N 123 ILE HD11 H N N 124 ILE HD12 H N N 125 ILE HD13 H N N 126 ILE HXT H N N 127 LEU N N N N 128 LEU CA C N S 129 LEU C C N N 130 LEU O O N N 131 LEU CB C N N 132 LEU CG C N N 133 LEU CD1 C N N 134 LEU CD2 C N N 135 LEU OXT O N N 136 LEU H H N N 137 LEU H2 H N N 138 LEU HA H N N 139 LEU HB2 H N N 140 LEU HB3 H N N 141 LEU HG H N N 142 LEU HD11 H N N 143 LEU HD12 H N N 144 LEU HD13 H N N 145 LEU HD21 H N N 146 LEU HD22 H N N 147 LEU HD23 H N N 148 LEU HXT H N N 149 LYS N N N N 150 LYS CA C N S 151 LYS C C N N 152 LYS O O N N 153 LYS CB C N N 154 LYS CG C N N 155 LYS CD C N N 156 LYS CE C N N 157 LYS NZ N N N 158 LYS OXT O N N 159 LYS H H N N 160 LYS H2 H N N 161 LYS HA H N N 162 LYS HB2 H N N 163 LYS HB3 H N N 164 LYS HG2 H N N 165 LYS HG3 H N N 166 LYS HD2 H N N 167 LYS HD3 H N N 168 LYS HE2 H N N 169 LYS HE3 H N N 170 LYS HZ1 H N N 171 LYS HZ2 H N N 172 LYS HZ3 H N N 173 LYS HXT H N N 174 MET N N N N 175 MET CA C N S 176 MET C C N N 177 MET O O N N 178 MET CB C N N 179 MET CG C N N 180 MET SD S N N 181 MET CE C N N 182 MET OXT O N N 183 MET H H N N 184 MET H2 H N N 185 MET HA H N N 186 MET HB2 H N N 187 MET HB3 H N N 188 MET HG2 H N N 189 MET HG3 H N N 190 MET HE1 H N N 191 MET HE2 H N N 192 MET HE3 H N N 193 MET HXT H N N 194 PHE N N N N 195 PHE CA C N S 196 PHE C C N N 197 PHE O O N N 198 PHE CB C N N 199 PHE CG C Y N 200 PHE CD1 C Y N 201 PHE CD2 C Y N 202 PHE CE1 C Y N 203 PHE CE2 C Y N 204 PHE CZ C Y N 205 PHE OXT O N N 206 PHE H H N N 207 PHE H2 H N N 208 PHE HA H N N 209 PHE HB2 H N N 210 PHE HB3 H N N 211 PHE HD1 H N N 212 PHE HD2 H N N 213 PHE HE1 H N N 214 PHE HE2 H N N 215 PHE HZ H N N 216 PHE HXT H N N 217 PRO N N N N 218 PRO CA C N S 219 PRO C C N N 220 PRO O O N N 221 PRO CB C N N 222 PRO CG C N N 223 PRO CD C N N 224 PRO OXT O N N 225 PRO H H N N 226 PRO HA H N N 227 PRO HB2 H N N 228 PRO HB3 H N N 229 PRO HG2 H N N 230 PRO HG3 H N N 231 PRO HD2 H N N 232 PRO HD3 H N N 233 PRO HXT H N N 234 SER N N N N 235 SER CA C N S 236 SER C C N N 237 SER O O N N 238 SER CB C N N 239 SER OG O N N 240 SER OXT O N N 241 SER H H N N 242 SER H2 H N N 243 SER HA H N N 244 SER HB2 H N N 245 SER HB3 H N N 246 SER HG H N N 247 SER HXT H N N 248 THR N N N N 249 THR CA C N S 250 THR C C N N 251 THR O O N N 252 THR CB C N R 253 THR OG1 O N N 254 THR CG2 C N N 255 THR OXT O N N 256 THR H H N N 257 THR H2 H N N 258 THR HA H N N 259 THR HB H N N 260 THR HG1 H N N 261 THR HG21 H N N 262 THR HG22 H N N 263 THR HG23 H N N 264 THR HXT H N N 265 TRP N N N N 266 TRP CA C N S 267 TRP C C N N 268 TRP O O N N 269 TRP CB C N N 270 TRP CG C Y N 271 TRP CD1 C Y N 272 TRP CD2 C Y N 273 TRP NE1 N Y N 274 TRP CE2 C Y N 275 TRP CE3 C Y N 276 TRP CZ2 C Y N 277 TRP CZ3 C Y N 278 TRP CH2 C Y N 279 TRP OXT O N N 280 TRP H H N N 281 TRP H2 H N N 282 TRP HA H N N 283 TRP HB2 H N N 284 TRP HB3 H N N 285 TRP HD1 H N N 286 TRP HE1 H N N 287 TRP HE3 H N N 288 TRP HZ2 H N N 289 TRP HZ3 H N N 290 TRP HH2 H N N 291 TRP HXT H N N 292 TYR N N N N 293 TYR CA C N S 294 TYR C C N N 295 TYR O O N N 296 TYR CB C N N 297 TYR CG C Y N 298 TYR CD1 C Y N 299 TYR CD2 C Y N 300 TYR CE1 C Y N 301 TYR CE2 C Y N 302 TYR CZ C Y N 303 TYR OH O N N 304 TYR OXT O N N 305 TYR H H N N 306 TYR H2 H N N 307 TYR HA H N N 308 TYR HB2 H N N 309 TYR HB3 H N N 310 TYR HD1 H N N 311 TYR HD2 H N N 312 TYR HE1 H N N 313 TYR HE2 H N N 314 TYR HH H N N 315 TYR HXT H N N 316 VAL N N N N 317 VAL CA C N S 318 VAL C C N N 319 VAL O O N N 320 VAL CB C N N 321 VAL CG1 C N N 322 VAL CG2 C N N 323 VAL OXT O N N 324 VAL H H N N 325 VAL H2 H N N 326 VAL HA H N N 327 VAL HB H N N 328 VAL HG11 H N N 329 VAL HG12 H N N 330 VAL HG13 H N N 331 VAL HG21 H N N 332 VAL HG22 H N N 333 VAL HG23 H N N 334 VAL HXT H N N 335 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 ILE N CA sing N N 100 ILE N H sing N N 101 ILE N H2 sing N N 102 ILE CA C sing N N 103 ILE CA CB sing N N 104 ILE CA HA sing N N 105 ILE C O doub N N 106 ILE C OXT sing N N 107 ILE CB CG1 sing N N 108 ILE CB CG2 sing N N 109 ILE CB HB sing N N 110 ILE CG1 CD1 sing N N 111 ILE CG1 HG12 sing N N 112 ILE CG1 HG13 sing N N 113 ILE CG2 HG21 sing N N 114 ILE CG2 HG22 sing N N 115 ILE CG2 HG23 sing N N 116 ILE CD1 HD11 sing N N 117 ILE CD1 HD12 sing N N 118 ILE CD1 HD13 sing N N 119 ILE OXT HXT sing N N 120 LEU N CA sing N N 121 LEU N H sing N N 122 LEU N H2 sing N N 123 LEU CA C sing N N 124 LEU CA CB sing N N 125 LEU CA HA sing N N 126 LEU C O doub N N 127 LEU C OXT sing N N 128 LEU CB CG sing N N 129 LEU CB HB2 sing N N 130 LEU CB HB3 sing N N 131 LEU CG CD1 sing N N 132 LEU CG CD2 sing N N 133 LEU CG HG sing N N 134 LEU CD1 HD11 sing N N 135 LEU CD1 HD12 sing N N 136 LEU CD1 HD13 sing N N 137 LEU CD2 HD21 sing N N 138 LEU CD2 HD22 sing N N 139 LEU CD2 HD23 sing N N 140 LEU OXT HXT sing N N 141 LYS N CA sing N N 142 LYS N H sing N N 143 LYS N H2 sing N N 144 LYS CA C sing N N 145 LYS CA CB sing N N 146 LYS CA HA sing N N 147 LYS C O doub N N 148 LYS C OXT sing N N 149 LYS CB CG sing N N 150 LYS CB HB2 sing N N 151 LYS CB HB3 sing N N 152 LYS CG CD sing N N 153 LYS CG HG2 sing N N 154 LYS CG HG3 sing N N 155 LYS CD CE sing N N 156 LYS CD HD2 sing N N 157 LYS CD HD3 sing N N 158 LYS CE NZ sing N N 159 LYS CE HE2 sing N N 160 LYS CE HE3 sing N N 161 LYS NZ HZ1 sing N N 162 LYS NZ HZ2 sing N N 163 LYS NZ HZ3 sing N N 164 LYS OXT HXT sing N N 165 MET N CA sing N N 166 MET N H sing N N 167 MET N H2 sing N N 168 MET CA C sing N N 169 MET CA CB sing N N 170 MET CA HA sing N N 171 MET C O doub N N 172 MET C OXT sing N N 173 MET CB CG sing N N 174 MET CB HB2 sing N N 175 MET CB HB3 sing N N 176 MET CG SD sing N N 177 MET CG HG2 sing N N 178 MET CG HG3 sing N N 179 MET SD CE sing N N 180 MET CE HE1 sing N N 181 MET CE HE2 sing N N 182 MET CE HE3 sing N N 183 MET OXT HXT sing N N 184 PHE N CA sing N N 185 PHE N H sing N N 186 PHE N H2 sing N N 187 PHE CA C sing N N 188 PHE CA CB sing N N 189 PHE CA HA sing N N 190 PHE C O doub N N 191 PHE C OXT sing N N 192 PHE CB CG sing N N 193 PHE CB HB2 sing N N 194 PHE CB HB3 sing N N 195 PHE CG CD1 doub Y N 196 PHE CG CD2 sing Y N 197 PHE CD1 CE1 sing Y N 198 PHE CD1 HD1 sing N N 199 PHE CD2 CE2 doub Y N 200 PHE CD2 HD2 sing N N 201 PHE CE1 CZ doub Y N 202 PHE CE1 HE1 sing N N 203 PHE CE2 CZ sing Y N 204 PHE CE2 HE2 sing N N 205 PHE CZ HZ sing N N 206 PHE OXT HXT sing N N 207 PRO N CA sing N N 208 PRO N CD sing N N 209 PRO N H sing N N 210 PRO CA C sing N N 211 PRO CA CB sing N N 212 PRO CA HA sing N N 213 PRO C O doub N N 214 PRO C OXT sing N N 215 PRO CB CG sing N N 216 PRO CB HB2 sing N N 217 PRO CB HB3 sing N N 218 PRO CG CD sing N N 219 PRO CG HG2 sing N N 220 PRO CG HG3 sing N N 221 PRO CD HD2 sing N N 222 PRO CD HD3 sing N N 223 PRO OXT HXT sing N N 224 SER N CA sing N N 225 SER N H sing N N 226 SER N H2 sing N N 227 SER CA C sing N N 228 SER CA CB sing N N 229 SER CA HA sing N N 230 SER C O doub N N 231 SER C OXT sing N N 232 SER CB OG sing N N 233 SER CB HB2 sing N N 234 SER CB HB3 sing N N 235 SER OG HG sing N N 236 SER OXT HXT sing N N 237 THR N CA sing N N 238 THR N H sing N N 239 THR N H2 sing N N 240 THR CA C sing N N 241 THR CA CB sing N N 242 THR CA HA sing N N 243 THR C O doub N N 244 THR C OXT sing N N 245 THR CB OG1 sing N N 246 THR CB CG2 sing N N 247 THR CB HB sing N N 248 THR OG1 HG1 sing N N 249 THR CG2 HG21 sing N N 250 THR CG2 HG22 sing N N 251 THR CG2 HG23 sing N N 252 THR OXT HXT sing N N 253 TRP N CA sing N N 254 TRP N H sing N N 255 TRP N H2 sing N N 256 TRP CA C sing N N 257 TRP CA CB sing N N 258 TRP CA HA sing N N 259 TRP C O doub N N 260 TRP C OXT sing N N 261 TRP CB CG sing N N 262 TRP CB HB2 sing N N 263 TRP CB HB3 sing N N 264 TRP CG CD1 doub Y N 265 TRP CG CD2 sing Y N 266 TRP CD1 NE1 sing Y N 267 TRP CD1 HD1 sing N N 268 TRP CD2 CE2 doub Y N 269 TRP CD2 CE3 sing Y N 270 TRP NE1 CE2 sing Y N 271 TRP NE1 HE1 sing N N 272 TRP CE2 CZ2 sing Y N 273 TRP CE3 CZ3 doub Y N 274 TRP CE3 HE3 sing N N 275 TRP CZ2 CH2 doub Y N 276 TRP CZ2 HZ2 sing N N 277 TRP CZ3 CH2 sing Y N 278 TRP CZ3 HZ3 sing N N 279 TRP CH2 HH2 sing N N 280 TRP OXT HXT sing N N 281 TYR N CA sing N N 282 TYR N H sing N N 283 TYR N H2 sing N N 284 TYR CA C sing N N 285 TYR CA CB sing N N 286 TYR CA HA sing N N 287 TYR C O doub N N 288 TYR C OXT sing N N 289 TYR CB CG sing N N 290 TYR CB HB2 sing N N 291 TYR CB HB3 sing N N 292 TYR CG CD1 doub Y N 293 TYR CG CD2 sing Y N 294 TYR CD1 CE1 sing Y N 295 TYR CD1 HD1 sing N N 296 TYR CD2 CE2 doub Y N 297 TYR CD2 HD2 sing N N 298 TYR CE1 CZ doub Y N 299 TYR CE1 HE1 sing N N 300 TYR CE2 CZ sing Y N 301 TYR CE2 HE2 sing N N 302 TYR CZ OH sing N N 303 TYR OH HH sing N N 304 TYR OXT HXT sing N N 305 VAL N CA sing N N 306 VAL N H sing N N 307 VAL N H2 sing N N 308 VAL CA C sing N N 309 VAL CA CB sing N N 310 VAL CA HA sing N N 311 VAL C O doub N N 312 VAL C OXT sing N N 313 VAL CB CG1 sing N N 314 VAL CB CG2 sing N N 315 VAL CB HB sing N N 316 VAL CG1 HG11 sing N N 317 VAL CG1 HG12 sing N N 318 VAL CG1 HG13 sing N N 319 VAL CG2 HG21 sing N N 320 VAL CG2 HG22 sing N N 321 VAL CG2 HG23 sing N N 322 VAL OXT HXT sing N N 323 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 5R35GM122462-04 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE NEO' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 6PQE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_