data_6Q6T # _entry.id 6Q6T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6Q6T pdb_00006q6t 10.2210/pdb6q6t/pdb WWPDB D_1200013314 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-01-16 2 'Structure model' 1 1 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' citation 4 2 'Structure model' database_2 5 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_database_2.pdbx_DOI' 3 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6Q6T _pdbx_database_status.recvd_initial_deposition_date 2018-12-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fermani, S.' 1 0000-0002-3056-3432 'Zaffagnini, M.' 2 0000-0001-5115-0859 'Lemaire, S.D.' 3 0000-0001-6442-0547 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Antioxidants (Basel)' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2076-3921 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural and Biochemical Insights into the Reactivity of Thioredoxin h1 fromChlamydomonas reinhardtii.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/antiox8010010 _citation.pdbx_database_id_PubMed 30609656 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Marchand, C.H.' 1 0000-0002-0729-3841 primary 'Fermani, S.' 2 0000-0002-3056-3432 primary 'Rossi, J.' 3 ? primary 'Gurrieri, L.' 4 0000-0002-3537-2512 primary 'Tedesco, D.' 5 0000-0003-2585-7791 primary 'Henri, J.' 6 0000-0003-0772-8881 primary 'Sparla, F.' 7 0000-0002-2103-4870 primary 'Trost, P.' 8 ? primary 'Lemaire, S.D.' 9 0000-0001-6442-0547 primary 'Zaffagnini, M.' 10 0000-0001-5115-0859 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Thioredoxin H-type' 11842.665 1 ? C36S ? ? 2 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 4 ? ? ? ? 3 water nat water 18.015 207 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Trx-H,Thioredoxin-CH1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWSGPCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAM PTFHVYKDGVKADDLVGASQDKLKALVAKHAAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MGGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWSGPCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAM PTFHVYKDGVKADDLVGASQDKLKALVAKHAAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'DI(HYDROXYETHYL)ETHER' PEG 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 GLY n 1 4 SER n 1 5 VAL n 1 6 ILE n 1 7 VAL n 1 8 ILE n 1 9 ASP n 1 10 SER n 1 11 LYS n 1 12 ALA n 1 13 ALA n 1 14 TRP n 1 15 ASP n 1 16 ALA n 1 17 GLN n 1 18 LEU n 1 19 ALA n 1 20 LYS n 1 21 GLY n 1 22 LYS n 1 23 GLU n 1 24 GLU n 1 25 HIS n 1 26 LYS n 1 27 PRO n 1 28 ILE n 1 29 VAL n 1 30 VAL n 1 31 ASP n 1 32 PHE n 1 33 THR n 1 34 ALA n 1 35 THR n 1 36 TRP n 1 37 SER n 1 38 GLY n 1 39 PRO n 1 40 CYS n 1 41 LYS n 1 42 MET n 1 43 ILE n 1 44 ALA n 1 45 PRO n 1 46 LEU n 1 47 PHE n 1 48 GLU n 1 49 THR n 1 50 LEU n 1 51 SER n 1 52 ASN n 1 53 ASP n 1 54 TYR n 1 55 ALA n 1 56 GLY n 1 57 LYS n 1 58 VAL n 1 59 ILE n 1 60 PHE n 1 61 LEU n 1 62 LYS n 1 63 VAL n 1 64 ASP n 1 65 VAL n 1 66 ASP n 1 67 ALA n 1 68 VAL n 1 69 ALA n 1 70 ALA n 1 71 VAL n 1 72 ALA n 1 73 GLU n 1 74 ALA n 1 75 ALA n 1 76 GLY n 1 77 ILE n 1 78 THR n 1 79 ALA n 1 80 MET n 1 81 PRO n 1 82 THR n 1 83 PHE n 1 84 HIS n 1 85 VAL n 1 86 TYR n 1 87 LYS n 1 88 ASP n 1 89 GLY n 1 90 VAL n 1 91 LYS n 1 92 ALA n 1 93 ASP n 1 94 ASP n 1 95 LEU n 1 96 VAL n 1 97 GLY n 1 98 ALA n 1 99 SER n 1 100 GLN n 1 101 ASP n 1 102 LYS n 1 103 LEU n 1 104 LYS n 1 105 ALA n 1 106 LEU n 1 107 VAL n 1 108 ALA n 1 109 LYS n 1 110 HIS n 1 111 ALA n 1 112 ALA n 1 113 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 113 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TRXH _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Chlamydomonas reinhardtii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3055 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ cytoplasm _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 GLY 2 1 1 GLY GLY A . n A 1 3 GLY 3 2 2 GLY GLY A . n A 1 4 SER 4 3 3 SER SER A . n A 1 5 VAL 5 4 4 VAL VAL A . n A 1 6 ILE 6 5 5 ILE ILE A . n A 1 7 VAL 7 6 6 VAL VAL A . n A 1 8 ILE 8 7 7 ILE ILE A . n A 1 9 ASP 9 8 8 ASP ASP A . n A 1 10 SER 10 9 9 SER SER A . n A 1 11 LYS 11 10 10 LYS LYS A . n A 1 12 ALA 12 11 11 ALA ALA A . n A 1 13 ALA 13 12 12 ALA ALA A . n A 1 14 TRP 14 13 13 TRP TRP A . n A 1 15 ASP 15 14 14 ASP ASP A . n A 1 16 ALA 16 15 15 ALA ALA A . n A 1 17 GLN 17 16 16 GLN GLN A . n A 1 18 LEU 18 17 17 LEU LEU A . n A 1 19 ALA 19 18 18 ALA ALA A . n A 1 20 LYS 20 19 19 LYS LYS A . n A 1 21 GLY 21 20 20 GLY GLY A . n A 1 22 LYS 22 21 21 LYS LYS A . n A 1 23 GLU 23 22 22 GLU GLU A . n A 1 24 GLU 24 23 23 GLU GLU A . n A 1 25 HIS 25 24 24 HIS HIS A . n A 1 26 LYS 26 25 25 LYS LYS A . n A 1 27 PRO 27 26 26 PRO PRO A . n A 1 28 ILE 28 27 27 ILE ILE A . n A 1 29 VAL 29 28 28 VAL VAL A . n A 1 30 VAL 30 29 29 VAL VAL A . n A 1 31 ASP 31 30 30 ASP ASP A . n A 1 32 PHE 32 31 31 PHE PHE A . n A 1 33 THR 33 32 32 THR THR A . n A 1 34 ALA 34 33 33 ALA ALA A . n A 1 35 THR 35 34 34 THR THR A . n A 1 36 TRP 36 35 35 TRP TRP A . n A 1 37 SER 37 36 36 SER SER A . n A 1 38 GLY 38 37 37 GLY GLY A . n A 1 39 PRO 39 38 38 PRO PRO A . n A 1 40 CYS 40 39 39 CYS CYS A . n A 1 41 LYS 41 40 40 LYS LYS A . n A 1 42 MET 42 41 41 MET MET A . n A 1 43 ILE 43 42 42 ILE ILE A . n A 1 44 ALA 44 43 43 ALA ALA A . n A 1 45 PRO 45 44 44 PRO PRO A . n A 1 46 LEU 46 45 45 LEU LEU A . n A 1 47 PHE 47 46 46 PHE PHE A . n A 1 48 GLU 48 47 47 GLU GLU A . n A 1 49 THR 49 48 48 THR THR A . n A 1 50 LEU 50 49 49 LEU LEU A . n A 1 51 SER 51 50 50 SER SER A . n A 1 52 ASN 52 51 51 ASN ASN A . n A 1 53 ASP 53 52 52 ASP ASP A . n A 1 54 TYR 54 53 53 TYR TYR A . n A 1 55 ALA 55 54 54 ALA ALA A . n A 1 56 GLY 56 55 55 GLY GLY A . n A 1 57 LYS 57 56 56 LYS LYS A . n A 1 58 VAL 58 57 57 VAL VAL A . n A 1 59 ILE 59 58 58 ILE ILE A . n A 1 60 PHE 60 59 59 PHE PHE A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 LYS 62 61 61 LYS LYS A . n A 1 63 VAL 63 62 62 VAL VAL A . n A 1 64 ASP 64 63 63 ASP ASP A . n A 1 65 VAL 65 64 64 VAL VAL A . n A 1 66 ASP 66 65 65 ASP ASP A . n A 1 67 ALA 67 66 66 ALA ALA A . n A 1 68 VAL 68 67 67 VAL VAL A . n A 1 69 ALA 69 68 68 ALA ALA A . n A 1 70 ALA 70 69 69 ALA ALA A . n A 1 71 VAL 71 70 70 VAL VAL A . n A 1 72 ALA 72 71 71 ALA ALA A . n A 1 73 GLU 73 72 72 GLU GLU A . n A 1 74 ALA 74 73 73 ALA ALA A . n A 1 75 ALA 75 74 74 ALA ALA A . n A 1 76 GLY 76 75 75 GLY GLY A . n A 1 77 ILE 77 76 76 ILE ILE A . n A 1 78 THR 78 77 77 THR THR A . n A 1 79 ALA 79 78 78 ALA ALA A . n A 1 80 MET 80 79 79 MET MET A . n A 1 81 PRO 81 80 80 PRO PRO A . n A 1 82 THR 82 81 81 THR THR A . n A 1 83 PHE 83 82 82 PHE PHE A . n A 1 84 HIS 84 83 83 HIS HIS A . n A 1 85 VAL 85 84 84 VAL VAL A . n A 1 86 TYR 86 85 85 TYR TYR A . n A 1 87 LYS 87 86 86 LYS LYS A . n A 1 88 ASP 88 87 87 ASP ASP A . n A 1 89 GLY 89 88 88 GLY GLY A . n A 1 90 VAL 90 89 89 VAL VAL A . n A 1 91 LYS 91 90 90 LYS LYS A . n A 1 92 ALA 92 91 91 ALA ALA A . n A 1 93 ASP 93 92 92 ASP ASP A . n A 1 94 ASP 94 93 93 ASP ASP A . n A 1 95 LEU 95 94 94 LEU LEU A . n A 1 96 VAL 96 95 95 VAL VAL A . n A 1 97 GLY 97 96 96 GLY GLY A . n A 1 98 ALA 98 97 97 ALA ALA A . n A 1 99 SER 99 98 98 SER SER A . n A 1 100 GLN 100 99 99 GLN GLN A . n A 1 101 ASP 101 100 100 ASP ASP A . n A 1 102 LYS 102 101 101 LYS LYS A . n A 1 103 LEU 103 102 102 LEU LEU A . n A 1 104 LYS 104 103 103 LYS LYS A . n A 1 105 ALA 105 104 104 ALA ALA A . n A 1 106 LEU 106 105 105 LEU LEU A . n A 1 107 VAL 107 106 106 VAL VAL A . n A 1 108 ALA 108 107 107 ALA ALA A . n A 1 109 LYS 109 108 108 LYS LYS A . n A 1 110 HIS 110 109 109 HIS HIS A . n A 1 111 ALA 111 110 110 ALA ALA A . n A 1 112 ALA 112 111 ? ? ? A . n A 1 113 ALA 113 112 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PEG 1 201 1 PEG PEG A . C 2 PEG 1 202 2 PEG PEG A . D 2 PEG 1 203 3 PEG PEG A . E 2 PEG 1 204 4 PEG PEG A . F 3 HOH 1 301 203 HOH HOH A . F 3 HOH 2 302 177 HOH HOH A . F 3 HOH 3 303 88 HOH HOH A . F 3 HOH 4 304 146 HOH HOH A . F 3 HOH 5 305 130 HOH HOH A . F 3 HOH 6 306 85 HOH HOH A . F 3 HOH 7 307 175 HOH HOH A . F 3 HOH 8 308 65 HOH HOH A . F 3 HOH 9 309 183 HOH HOH A . F 3 HOH 10 310 207 HOH HOH A . F 3 HOH 11 311 198 HOH HOH A . F 3 HOH 12 312 113 HOH HOH A . F 3 HOH 13 313 91 HOH HOH A . F 3 HOH 14 314 81 HOH HOH A . F 3 HOH 15 315 23 HOH HOH A . F 3 HOH 16 316 189 HOH HOH A . F 3 HOH 17 317 12 HOH HOH A . F 3 HOH 18 318 104 HOH HOH A . F 3 HOH 19 319 74 HOH HOH A . F 3 HOH 20 320 21 HOH HOH A . F 3 HOH 21 321 180 HOH HOH A . F 3 HOH 22 322 163 HOH HOH A . F 3 HOH 23 323 162 HOH HOH A . F 3 HOH 24 324 2 HOH HOH A . F 3 HOH 25 325 16 HOH HOH A . F 3 HOH 26 326 86 HOH HOH A . F 3 HOH 27 327 194 HOH HOH A . F 3 HOH 28 328 131 HOH HOH A . F 3 HOH 29 329 67 HOH HOH A . F 3 HOH 30 330 143 HOH HOH A . F 3 HOH 31 331 87 HOH HOH A . F 3 HOH 32 332 9 HOH HOH A . F 3 HOH 33 333 54 HOH HOH A . F 3 HOH 34 334 193 HOH HOH A . F 3 HOH 35 335 47 HOH HOH A . F 3 HOH 36 336 128 HOH HOH A . F 3 HOH 37 337 15 HOH HOH A . F 3 HOH 38 338 60 HOH HOH A . F 3 HOH 39 339 1 HOH HOH A . F 3 HOH 40 340 118 HOH HOH A . F 3 HOH 41 341 123 HOH HOH A . F 3 HOH 42 342 107 HOH HOH A . F 3 HOH 43 343 79 HOH HOH A . F 3 HOH 44 344 30 HOH HOH A . F 3 HOH 45 345 133 HOH HOH A . F 3 HOH 46 346 105 HOH HOH A . F 3 HOH 47 347 26 HOH HOH A . F 3 HOH 48 348 13 HOH HOH A . F 3 HOH 49 349 124 HOH HOH A . F 3 HOH 50 350 190 HOH HOH A . F 3 HOH 51 351 4 HOH HOH A . F 3 HOH 52 352 69 HOH HOH A . F 3 HOH 53 353 115 HOH HOH A . F 3 HOH 54 354 48 HOH HOH A . F 3 HOH 55 355 62 HOH HOH A . F 3 HOH 56 356 17 HOH HOH A . F 3 HOH 57 357 73 HOH HOH A . F 3 HOH 58 358 43 HOH HOH A . F 3 HOH 59 359 34 HOH HOH A . F 3 HOH 60 360 24 HOH HOH A . F 3 HOH 61 361 38 HOH HOH A . F 3 HOH 62 362 120 HOH HOH A . F 3 HOH 63 363 200 HOH HOH A . F 3 HOH 64 364 154 HOH HOH A . F 3 HOH 65 365 3 HOH HOH A . F 3 HOH 66 366 98 HOH HOH A . F 3 HOH 67 367 57 HOH HOH A . F 3 HOH 68 368 10 HOH HOH A . F 3 HOH 69 369 46 HOH HOH A . F 3 HOH 70 370 61 HOH HOH A . F 3 HOH 71 371 53 HOH HOH A . F 3 HOH 72 372 64 HOH HOH A . F 3 HOH 73 373 103 HOH HOH A . F 3 HOH 74 374 36 HOH HOH A . F 3 HOH 75 375 59 HOH HOH A . F 3 HOH 76 376 42 HOH HOH A . F 3 HOH 77 377 63 HOH HOH A . F 3 HOH 78 378 55 HOH HOH A . F 3 HOH 79 379 184 HOH HOH A . F 3 HOH 80 380 44 HOH HOH A . F 3 HOH 81 381 106 HOH HOH A . F 3 HOH 82 382 156 HOH HOH A . F 3 HOH 83 383 182 HOH HOH A . F 3 HOH 84 384 178 HOH HOH A . F 3 HOH 85 385 39 HOH HOH A . F 3 HOH 86 386 70 HOH HOH A . F 3 HOH 87 387 165 HOH HOH A . F 3 HOH 88 388 191 HOH HOH A . F 3 HOH 89 389 138 HOH HOH A . F 3 HOH 90 390 28 HOH HOH A . F 3 HOH 91 391 11 HOH HOH A . F 3 HOH 92 392 119 HOH HOH A . F 3 HOH 93 393 6 HOH HOH A . F 3 HOH 94 394 76 HOH HOH A . F 3 HOH 95 395 7 HOH HOH A . F 3 HOH 96 396 19 HOH HOH A . F 3 HOH 97 397 157 HOH HOH A . F 3 HOH 98 398 114 HOH HOH A . F 3 HOH 99 399 99 HOH HOH A . F 3 HOH 100 400 14 HOH HOH A . F 3 HOH 101 401 58 HOH HOH A . F 3 HOH 102 402 108 HOH HOH A . F 3 HOH 103 403 109 HOH HOH A . F 3 HOH 104 404 144 HOH HOH A . F 3 HOH 105 405 142 HOH HOH A . F 3 HOH 106 406 41 HOH HOH A . F 3 HOH 107 407 140 HOH HOH A . F 3 HOH 108 408 185 HOH HOH A . F 3 HOH 109 409 35 HOH HOH A . F 3 HOH 110 410 94 HOH HOH A . F 3 HOH 111 411 66 HOH HOH A . F 3 HOH 112 412 100 HOH HOH A . F 3 HOH 113 413 82 HOH HOH A . F 3 HOH 114 414 152 HOH HOH A . F 3 HOH 115 415 71 HOH HOH A . F 3 HOH 116 416 20 HOH HOH A . F 3 HOH 117 417 90 HOH HOH A . F 3 HOH 118 418 32 HOH HOH A . F 3 HOH 119 419 29 HOH HOH A . F 3 HOH 120 420 18 HOH HOH A . F 3 HOH 121 421 72 HOH HOH A . F 3 HOH 122 422 37 HOH HOH A . F 3 HOH 123 423 122 HOH HOH A . F 3 HOH 124 424 97 HOH HOH A . F 3 HOH 125 425 8 HOH HOH A . F 3 HOH 126 426 27 HOH HOH A . F 3 HOH 127 427 204 HOH HOH A . F 3 HOH 128 428 51 HOH HOH A . F 3 HOH 129 429 49 HOH HOH A . F 3 HOH 130 430 31 HOH HOH A . F 3 HOH 131 431 33 HOH HOH A . F 3 HOH 132 432 68 HOH HOH A . F 3 HOH 133 433 176 HOH HOH A . F 3 HOH 134 434 153 HOH HOH A . F 3 HOH 135 435 83 HOH HOH A . F 3 HOH 136 436 96 HOH HOH A . F 3 HOH 137 437 117 HOH HOH A . F 3 HOH 138 438 80 HOH HOH A . F 3 HOH 139 439 181 HOH HOH A . F 3 HOH 140 440 188 HOH HOH A . F 3 HOH 141 441 125 HOH HOH A . F 3 HOH 142 442 186 HOH HOH A . F 3 HOH 143 443 192 HOH HOH A . F 3 HOH 144 444 110 HOH HOH A . F 3 HOH 145 445 40 HOH HOH A . F 3 HOH 146 446 170 HOH HOH A . F 3 HOH 147 447 201 HOH HOH A . F 3 HOH 148 448 173 HOH HOH A . F 3 HOH 149 449 93 HOH HOH A . F 3 HOH 150 450 167 HOH HOH A . F 3 HOH 151 451 179 HOH HOH A . F 3 HOH 152 452 196 HOH HOH A . F 3 HOH 153 453 5 HOH HOH A . F 3 HOH 154 454 158 HOH HOH A . F 3 HOH 155 455 92 HOH HOH A . F 3 HOH 156 456 25 HOH HOH A . F 3 HOH 157 457 50 HOH HOH A . F 3 HOH 158 458 116 HOH HOH A . F 3 HOH 159 459 187 HOH HOH A . F 3 HOH 160 460 22 HOH HOH A . F 3 HOH 161 461 135 HOH HOH A . F 3 HOH 162 462 197 HOH HOH A . F 3 HOH 163 463 169 HOH HOH A . F 3 HOH 164 464 147 HOH HOH A . F 3 HOH 165 465 132 HOH HOH A . F 3 HOH 166 466 174 HOH HOH A . F 3 HOH 167 467 150 HOH HOH A . F 3 HOH 168 468 134 HOH HOH A . F 3 HOH 169 469 136 HOH HOH A . F 3 HOH 170 470 129 HOH HOH A . F 3 HOH 171 471 160 HOH HOH A . F 3 HOH 172 472 195 HOH HOH A . F 3 HOH 173 473 168 HOH HOH A . F 3 HOH 174 474 171 HOH HOH A . F 3 HOH 175 475 101 HOH HOH A . F 3 HOH 176 476 126 HOH HOH A . F 3 HOH 177 477 202 HOH HOH A . F 3 HOH 178 478 89 HOH HOH A . F 3 HOH 179 479 145 HOH HOH A . F 3 HOH 180 480 137 HOH HOH A . F 3 HOH 181 481 52 HOH HOH A . F 3 HOH 182 482 121 HOH HOH A . F 3 HOH 183 483 199 HOH HOH A . F 3 HOH 184 484 78 HOH HOH A . F 3 HOH 185 485 77 HOH HOH A . F 3 HOH 186 486 102 HOH HOH A . F 3 HOH 187 487 206 HOH HOH A . F 3 HOH 188 488 159 HOH HOH A . F 3 HOH 189 489 45 HOH HOH A . F 3 HOH 190 490 84 HOH HOH A . F 3 HOH 191 491 172 HOH HOH A . F 3 HOH 192 492 161 HOH HOH A . F 3 HOH 193 493 155 HOH HOH A . F 3 HOH 194 494 151 HOH HOH A . F 3 HOH 195 495 127 HOH HOH A . F 3 HOH 196 496 111 HOH HOH A . F 3 HOH 197 497 148 HOH HOH A . F 3 HOH 198 498 112 HOH HOH A . F 3 HOH 199 499 166 HOH HOH A . F 3 HOH 200 500 205 HOH HOH A . F 3 HOH 201 501 56 HOH HOH A . F 3 HOH 202 502 141 HOH HOH A . F 3 HOH 203 503 95 HOH HOH A . F 3 HOH 204 504 149 HOH HOH A . F 3 HOH 205 505 164 HOH HOH A . F 3 HOH 206 506 75 HOH HOH A . F 3 HOH 207 507 139 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13_2998: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6Q6T _cell.details ? _cell.formula_units_Z ? _cell.length_a 60.777 _cell.length_a_esd ? _cell.length_b 34.815 _cell.length_b_esd ? _cell.length_c 48.158 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6Q6T _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6Q6T _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.02 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.2 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% (w/v) PEG 10K, 0.1 M sodium cacodylate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'Silicon toroidal mirror coated with Rhodium' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-05-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Silicon (1 1 1) channel-cut' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 8.4 _reflns.entry_id 6Q6T _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 0.94 _reflns.d_resolution_low 48.16 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 64505 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F 3.0 _reflns.observed_criterion_sigma_I -3.0 _reflns.percent_possible_obs 96.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.1 _reflns.pdbx_Rmerge_I_obs 0.043 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.054 _reflns.pdbx_Rpim_I_all 0.033 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 0.94 _reflns_shell.d_res_low 0.96 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1579 _reflns_shell.percent_possible_all 47.1 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.369 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.520 _reflns_shell.pdbx_Rpim_I_all 0.367 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.625 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 12.6 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6Q6T _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 0.940 _refine.ls_d_res_low 48.158 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 64420 _refine.ls_number_reflns_R_free 5883 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.45 _refine.ls_percent_reflns_R_free 4.95 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1578 _refine.ls_R_factor_R_free 0.1655 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1574 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.20 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1EP7 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 15.77 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.07 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 814 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 207 _refine_hist.number_atoms_total 1049 _refine_hist.d_res_high 0.940 _refine_hist.d_res_low 48.158 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 872 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.007 ? 1177 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.846 ? 316 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.081 ? 137 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 146 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 0.9400 0.9507 . . 61 981 24.00 . . . 0.3346 . 0.2872 . . . . . . . . . . 'X-RAY DIFFRACTION' 0.9507 0.9619 . . 130 2188 54.00 . . . 0.2680 . 0.2920 . . . . . . . . . . 'X-RAY DIFFRACTION' 0.9619 0.9736 . . 139 2965 72.00 . . . 0.2571 . 0.2461 . . . . . . . . . . 'X-RAY DIFFRACTION' 0.9736 0.9859 . . 202 3358 84.00 . . . 0.2354 . 0.2356 . . . . . . . . . . 'X-RAY DIFFRACTION' 0.9859 0.9989 . . 211 3813 94.00 . . . 0.2194 . 0.2212 . . . . . . . . . . 'X-RAY DIFFRACTION' 0.9989 1.0126 . . 238 3958 99.00 . . . 0.2105 . 0.2074 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.0126 1.0271 . . 201 4087 99.00 . . . 0.2035 . 0.1949 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.0271 1.0424 . . 199 3951 98.00 . . . 0.1806 . 0.1966 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.0424 1.0587 . . 196 3952 97.00 . . . 0.1644 . 0.1918 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.0587 1.0760 . . 225 3930 97.00 . . . 0.1962 . 0.1817 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.0760 1.0946 . . 222 4001 99.00 . . . 0.2010 . 0.1738 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.0946 1.1145 . . 227 4001 99.00 . . . 0.1859 . 0.1676 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1145 1.1359 . . 180 3998 98.00 . . . 0.1692 . 0.1626 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1359 1.1591 . . 206 4043 98.00 . . . 0.1783 . 0.1619 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1591 1.1843 . . 187 3943 96.00 . . . 0.1346 . 0.1640 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1843 1.2119 . . 248 3986 99.00 . . . 0.1746 . 0.1615 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2119 1.2422 . . 193 4047 99.00 . . . 0.1412 . 0.1613 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2422 1.2758 . . 181 4023 99.00 . . . 0.1694 . 0.1581 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2758 1.3133 . . 232 4017 99.00 . . . 0.1654 . 0.1565 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3133 1.3557 . . 251 3989 99.00 . . . 0.1733 . 0.1564 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3557 1.4042 . . 193 3980 97.00 . . . 0.1623 . 0.1541 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4042 1.4604 . . 195 4041 99.00 . . . 0.1729 . 0.1539 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4604 1.5269 . . 233 3976 99.00 . . . 0.1650 . 0.1487 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5269 1.6074 . . 177 4054 99.00 . . . 0.1693 . 0.1453 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6074 1.7081 . . 183 4004 98.00 . . . 0.1348 . 0.1411 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7081 1.8400 . . 222 3917 96.00 . . . 0.1503 . 0.1463 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8400 2.0251 . . 192 3922 96.00 . . . 0.1351 . 0.1440 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0251 2.3182 . . 175 4027 98.00 . . . 0.1492 . 0.1408 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3182 2.9206 . . 176 3984 97.00 . . . 0.1455 . 0.1487 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9206 48.2213 . . 208 3788 93.00 . . . 0.1768 . 0.1570 . . . . . . . . . . # _struct.entry_id 6Q6T _struct.title 'Crystal structure (orthorombic form) of C36S mutant of thioredoxin h1 from Chlamydomonas reinhardtii' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6Q6T _struct_keywords.text 'alfa/beta protein, thioredoxin fold, disulphide oxidoreductase, cell redox homeostatis, ELECTRON TRANSPORT' _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRXH_CHLRE _struct_ref.pdbx_db_accession P80028 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAM PTFHVYKDGVKADDLVGASQDKLKALVAKHAAA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6Q6T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 113 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P80028 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 113 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 112 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6Q6T _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 37 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P80028 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 37 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 36 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 670 ? 1 MORE 9 ? 1 'SSA (A^2)' 5940 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 10 ? HIS A 25 ? SER A 9 HIS A 24 1 ? 16 HELX_P HELX_P2 AA2 SER A 37 ? TYR A 54 ? SER A 36 TYR A 53 1 ? 18 HELX_P HELX_P3 AA3 VAL A 68 ? ALA A 75 ? VAL A 67 ALA A 74 1 ? 8 HELX_P HELX_P4 AA4 SER A 99 ? ALA A 111 ? SER A 98 ALA A 110 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 80 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 79 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 81 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 80 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.00 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 5 ? ILE A 8 ? VAL A 4 ILE A 7 AA1 2 ILE A 59 ? ASP A 64 ? ILE A 58 ASP A 63 AA1 3 ILE A 28 ? THR A 33 ? ILE A 27 THR A 32 AA1 4 THR A 82 ? LYS A 87 ? THR A 81 LYS A 86 AA1 5 VAL A 90 ? VAL A 96 ? VAL A 89 VAL A 95 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 8 ? N ILE A 7 O LYS A 62 ? O LYS A 61 AA1 2 3 O ILE A 59 ? O ILE A 58 N VAL A 29 ? N VAL A 28 AA1 3 4 N PHE A 32 ? N PHE A 31 O THR A 82 ? O THR A 81 AA1 4 5 N VAL A 85 ? N VAL A 84 O ALA A 92 ? O ALA A 91 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A PEG 201 ? 1 'binding site for residue PEG A 201' AC2 Software A PEG 202 ? 5 'binding site for residue PEG A 202' AC3 Software A PEG 203 ? 5 'binding site for residue PEG A 203' AC4 Software A PEG 204 ? 11 'binding site for residue PEG A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 1 ASP A 53 ? ASP A 52 . ? 1_555 ? 2 AC2 5 ALA A 70 ? ALA A 69 . ? 1_555 ? 3 AC2 5 VAL A 90 ? VAL A 89 . ? 2_555 ? 4 AC2 5 HOH F . ? HOH A 305 . ? 1_555 ? 5 AC2 5 HOH F . ? HOH A 441 . ? 1_555 ? 6 AC2 5 HOH F . ? HOH A 478 . ? 1_555 ? 7 AC3 5 LYS A 11 ? LYS A 10 . ? 2_555 ? 8 AC3 5 LEU A 18 ? LEU A 17 . ? 1_555 ? 9 AC3 5 LYS A 22 ? LYS A 21 . ? 1_555 ? 10 AC3 5 ASP A 88 ? ASP A 87 . ? 1_555 ? 11 AC3 5 GLY A 89 ? GLY A 88 . ? 1_555 ? 12 AC4 11 ILE A 6 ? ILE A 5 . ? 1_555 ? 13 AC4 11 VAL A 7 ? VAL A 6 . ? 1_555 ? 14 AC4 11 ILE A 8 ? ILE A 7 . ? 1_555 ? 15 AC4 11 ASP A 9 ? ASP A 8 . ? 1_555 ? 16 AC4 11 ALA A 13 ? ALA A 12 . ? 1_555 ? 17 AC4 11 GLN A 17 ? GLN A 16 . ? 1_555 ? 18 AC4 11 GLU A 24 ? GLU A 23 . ? 3_546 ? 19 AC4 11 LYS A 26 ? LYS A 25 . ? 3_546 ? 20 AC4 11 GLY A 56 ? GLY A 55 . ? 3_546 ? 21 AC4 11 LYS A 57 ? LYS A 56 . ? 3_546 ? 22 AC4 11 HOH F . ? HOH A 304 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 322 ? ? O A HOH 363 ? ? 1.89 2 1 O A HOH 310 ? ? O A HOH 424 ? ? 1.98 3 1 O A ALA 110 ? ? O A HOH 301 ? ? 2.10 4 1 O A HOH 318 ? ? O A HOH 439 ? ? 2.16 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 HZ1 A LYS 25 ? ? 1_555 O1 A PEG 204 ? ? 3_556 1.34 2 1 NZ A LYS 25 ? ? 1_555 O1 A PEG 204 ? ? 3_556 2.02 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 340 ? F HOH . 2 1 A HOH 366 ? F HOH . 3 1 A HOH 440 ? F HOH . 4 1 A HOH 467 ? F HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A ALA 111 ? A ALA 112 3 1 Y 1 A ALA 112 ? A ALA 113 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 HOH O O N N 131 HOH H1 H N N 132 HOH H2 H N N 133 ILE N N N N 134 ILE CA C N S 135 ILE C C N N 136 ILE O O N N 137 ILE CB C N S 138 ILE CG1 C N N 139 ILE CG2 C N N 140 ILE CD1 C N N 141 ILE OXT O N N 142 ILE H H N N 143 ILE H2 H N N 144 ILE HA H N N 145 ILE HB H N N 146 ILE HG12 H N N 147 ILE HG13 H N N 148 ILE HG21 H N N 149 ILE HG22 H N N 150 ILE HG23 H N N 151 ILE HD11 H N N 152 ILE HD12 H N N 153 ILE HD13 H N N 154 ILE HXT H N N 155 LEU N N N N 156 LEU CA C N S 157 LEU C C N N 158 LEU O O N N 159 LEU CB C N N 160 LEU CG C N N 161 LEU CD1 C N N 162 LEU CD2 C N N 163 LEU OXT O N N 164 LEU H H N N 165 LEU H2 H N N 166 LEU HA H N N 167 LEU HB2 H N N 168 LEU HB3 H N N 169 LEU HG H N N 170 LEU HD11 H N N 171 LEU HD12 H N N 172 LEU HD13 H N N 173 LEU HD21 H N N 174 LEU HD22 H N N 175 LEU HD23 H N N 176 LEU HXT H N N 177 LYS N N N N 178 LYS CA C N S 179 LYS C C N N 180 LYS O O N N 181 LYS CB C N N 182 LYS CG C N N 183 LYS CD C N N 184 LYS CE C N N 185 LYS NZ N N N 186 LYS OXT O N N 187 LYS H H N N 188 LYS H2 H N N 189 LYS HA H N N 190 LYS HB2 H N N 191 LYS HB3 H N N 192 LYS HG2 H N N 193 LYS HG3 H N N 194 LYS HD2 H N N 195 LYS HD3 H N N 196 LYS HE2 H N N 197 LYS HE3 H N N 198 LYS HZ1 H N N 199 LYS HZ2 H N N 200 LYS HZ3 H N N 201 LYS HXT H N N 202 MET N N N N 203 MET CA C N S 204 MET C C N N 205 MET O O N N 206 MET CB C N N 207 MET CG C N N 208 MET SD S N N 209 MET CE C N N 210 MET OXT O N N 211 MET H H N N 212 MET H2 H N N 213 MET HA H N N 214 MET HB2 H N N 215 MET HB3 H N N 216 MET HG2 H N N 217 MET HG3 H N N 218 MET HE1 H N N 219 MET HE2 H N N 220 MET HE3 H N N 221 MET HXT H N N 222 PEG C1 C N N 223 PEG O1 O N N 224 PEG C2 C N N 225 PEG O2 O N N 226 PEG C3 C N N 227 PEG C4 C N N 228 PEG O4 O N N 229 PEG H11 H N N 230 PEG H12 H N N 231 PEG HO1 H N N 232 PEG H21 H N N 233 PEG H22 H N N 234 PEG H31 H N N 235 PEG H32 H N N 236 PEG H41 H N N 237 PEG H42 H N N 238 PEG HO4 H N N 239 PHE N N N N 240 PHE CA C N S 241 PHE C C N N 242 PHE O O N N 243 PHE CB C N N 244 PHE CG C Y N 245 PHE CD1 C Y N 246 PHE CD2 C Y N 247 PHE CE1 C Y N 248 PHE CE2 C Y N 249 PHE CZ C Y N 250 PHE OXT O N N 251 PHE H H N N 252 PHE H2 H N N 253 PHE HA H N N 254 PHE HB2 H N N 255 PHE HB3 H N N 256 PHE HD1 H N N 257 PHE HD2 H N N 258 PHE HE1 H N N 259 PHE HE2 H N N 260 PHE HZ H N N 261 PHE HXT H N N 262 PRO N N N N 263 PRO CA C N S 264 PRO C C N N 265 PRO O O N N 266 PRO CB C N N 267 PRO CG C N N 268 PRO CD C N N 269 PRO OXT O N N 270 PRO H H N N 271 PRO HA H N N 272 PRO HB2 H N N 273 PRO HB3 H N N 274 PRO HG2 H N N 275 PRO HG3 H N N 276 PRO HD2 H N N 277 PRO HD3 H N N 278 PRO HXT H N N 279 SER N N N N 280 SER CA C N S 281 SER C C N N 282 SER O O N N 283 SER CB C N N 284 SER OG O N N 285 SER OXT O N N 286 SER H H N N 287 SER H2 H N N 288 SER HA H N N 289 SER HB2 H N N 290 SER HB3 H N N 291 SER HG H N N 292 SER HXT H N N 293 THR N N N N 294 THR CA C N S 295 THR C C N N 296 THR O O N N 297 THR CB C N R 298 THR OG1 O N N 299 THR CG2 C N N 300 THR OXT O N N 301 THR H H N N 302 THR H2 H N N 303 THR HA H N N 304 THR HB H N N 305 THR HG1 H N N 306 THR HG21 H N N 307 THR HG22 H N N 308 THR HG23 H N N 309 THR HXT H N N 310 TRP N N N N 311 TRP CA C N S 312 TRP C C N N 313 TRP O O N N 314 TRP CB C N N 315 TRP CG C Y N 316 TRP CD1 C Y N 317 TRP CD2 C Y N 318 TRP NE1 N Y N 319 TRP CE2 C Y N 320 TRP CE3 C Y N 321 TRP CZ2 C Y N 322 TRP CZ3 C Y N 323 TRP CH2 C Y N 324 TRP OXT O N N 325 TRP H H N N 326 TRP H2 H N N 327 TRP HA H N N 328 TRP HB2 H N N 329 TRP HB3 H N N 330 TRP HD1 H N N 331 TRP HE1 H N N 332 TRP HE3 H N N 333 TRP HZ2 H N N 334 TRP HZ3 H N N 335 TRP HH2 H N N 336 TRP HXT H N N 337 TYR N N N N 338 TYR CA C N S 339 TYR C C N N 340 TYR O O N N 341 TYR CB C N N 342 TYR CG C Y N 343 TYR CD1 C Y N 344 TYR CD2 C Y N 345 TYR CE1 C Y N 346 TYR CE2 C Y N 347 TYR CZ C Y N 348 TYR OH O N N 349 TYR OXT O N N 350 TYR H H N N 351 TYR H2 H N N 352 TYR HA H N N 353 TYR HB2 H N N 354 TYR HB3 H N N 355 TYR HD1 H N N 356 TYR HD2 H N N 357 TYR HE1 H N N 358 TYR HE2 H N N 359 TYR HH H N N 360 TYR HXT H N N 361 VAL N N N N 362 VAL CA C N S 363 VAL C C N N 364 VAL O O N N 365 VAL CB C N N 366 VAL CG1 C N N 367 VAL CG2 C N N 368 VAL OXT O N N 369 VAL H H N N 370 VAL H2 H N N 371 VAL HA H N N 372 VAL HB H N N 373 VAL HG11 H N N 374 VAL HG12 H N N 375 VAL HG13 H N N 376 VAL HG21 H N N 377 VAL HG22 H N N 378 VAL HG23 H N N 379 VAL HXT H N N 380 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 HOH O H1 sing N N 124 HOH O H2 sing N N 125 ILE N CA sing N N 126 ILE N H sing N N 127 ILE N H2 sing N N 128 ILE CA C sing N N 129 ILE CA CB sing N N 130 ILE CA HA sing N N 131 ILE C O doub N N 132 ILE C OXT sing N N 133 ILE CB CG1 sing N N 134 ILE CB CG2 sing N N 135 ILE CB HB sing N N 136 ILE CG1 CD1 sing N N 137 ILE CG1 HG12 sing N N 138 ILE CG1 HG13 sing N N 139 ILE CG2 HG21 sing N N 140 ILE CG2 HG22 sing N N 141 ILE CG2 HG23 sing N N 142 ILE CD1 HD11 sing N N 143 ILE CD1 HD12 sing N N 144 ILE CD1 HD13 sing N N 145 ILE OXT HXT sing N N 146 LEU N CA sing N N 147 LEU N H sing N N 148 LEU N H2 sing N N 149 LEU CA C sing N N 150 LEU CA CB sing N N 151 LEU CA HA sing N N 152 LEU C O doub N N 153 LEU C OXT sing N N 154 LEU CB CG sing N N 155 LEU CB HB2 sing N N 156 LEU CB HB3 sing N N 157 LEU CG CD1 sing N N 158 LEU CG CD2 sing N N 159 LEU CG HG sing N N 160 LEU CD1 HD11 sing N N 161 LEU CD1 HD12 sing N N 162 LEU CD1 HD13 sing N N 163 LEU CD2 HD21 sing N N 164 LEU CD2 HD22 sing N N 165 LEU CD2 HD23 sing N N 166 LEU OXT HXT sing N N 167 LYS N CA sing N N 168 LYS N H sing N N 169 LYS N H2 sing N N 170 LYS CA C sing N N 171 LYS CA CB sing N N 172 LYS CA HA sing N N 173 LYS C O doub N N 174 LYS C OXT sing N N 175 LYS CB CG sing N N 176 LYS CB HB2 sing N N 177 LYS CB HB3 sing N N 178 LYS CG CD sing N N 179 LYS CG HG2 sing N N 180 LYS CG HG3 sing N N 181 LYS CD CE sing N N 182 LYS CD HD2 sing N N 183 LYS CD HD3 sing N N 184 LYS CE NZ sing N N 185 LYS CE HE2 sing N N 186 LYS CE HE3 sing N N 187 LYS NZ HZ1 sing N N 188 LYS NZ HZ2 sing N N 189 LYS NZ HZ3 sing N N 190 LYS OXT HXT sing N N 191 MET N CA sing N N 192 MET N H sing N N 193 MET N H2 sing N N 194 MET CA C sing N N 195 MET CA CB sing N N 196 MET CA HA sing N N 197 MET C O doub N N 198 MET C OXT sing N N 199 MET CB CG sing N N 200 MET CB HB2 sing N N 201 MET CB HB3 sing N N 202 MET CG SD sing N N 203 MET CG HG2 sing N N 204 MET CG HG3 sing N N 205 MET SD CE sing N N 206 MET CE HE1 sing N N 207 MET CE HE2 sing N N 208 MET CE HE3 sing N N 209 MET OXT HXT sing N N 210 PEG C1 O1 sing N N 211 PEG C1 C2 sing N N 212 PEG C1 H11 sing N N 213 PEG C1 H12 sing N N 214 PEG O1 HO1 sing N N 215 PEG C2 O2 sing N N 216 PEG C2 H21 sing N N 217 PEG C2 H22 sing N N 218 PEG O2 C3 sing N N 219 PEG C3 C4 sing N N 220 PEG C3 H31 sing N N 221 PEG C3 H32 sing N N 222 PEG C4 O4 sing N N 223 PEG C4 H41 sing N N 224 PEG C4 H42 sing N N 225 PEG O4 HO4 sing N N 226 PHE N CA sing N N 227 PHE N H sing N N 228 PHE N H2 sing N N 229 PHE CA C sing N N 230 PHE CA CB sing N N 231 PHE CA HA sing N N 232 PHE C O doub N N 233 PHE C OXT sing N N 234 PHE CB CG sing N N 235 PHE CB HB2 sing N N 236 PHE CB HB3 sing N N 237 PHE CG CD1 doub Y N 238 PHE CG CD2 sing Y N 239 PHE CD1 CE1 sing Y N 240 PHE CD1 HD1 sing N N 241 PHE CD2 CE2 doub Y N 242 PHE CD2 HD2 sing N N 243 PHE CE1 CZ doub Y N 244 PHE CE1 HE1 sing N N 245 PHE CE2 CZ sing Y N 246 PHE CE2 HE2 sing N N 247 PHE CZ HZ sing N N 248 PHE OXT HXT sing N N 249 PRO N CA sing N N 250 PRO N CD sing N N 251 PRO N H sing N N 252 PRO CA C sing N N 253 PRO CA CB sing N N 254 PRO CA HA sing N N 255 PRO C O doub N N 256 PRO C OXT sing N N 257 PRO CB CG sing N N 258 PRO CB HB2 sing N N 259 PRO CB HB3 sing N N 260 PRO CG CD sing N N 261 PRO CG HG2 sing N N 262 PRO CG HG3 sing N N 263 PRO CD HD2 sing N N 264 PRO CD HD3 sing N N 265 PRO OXT HXT sing N N 266 SER N CA sing N N 267 SER N H sing N N 268 SER N H2 sing N N 269 SER CA C sing N N 270 SER CA CB sing N N 271 SER CA HA sing N N 272 SER C O doub N N 273 SER C OXT sing N N 274 SER CB OG sing N N 275 SER CB HB2 sing N N 276 SER CB HB3 sing N N 277 SER OG HG sing N N 278 SER OXT HXT sing N N 279 THR N CA sing N N 280 THR N H sing N N 281 THR N H2 sing N N 282 THR CA C sing N N 283 THR CA CB sing N N 284 THR CA HA sing N N 285 THR C O doub N N 286 THR C OXT sing N N 287 THR CB OG1 sing N N 288 THR CB CG2 sing N N 289 THR CB HB sing N N 290 THR OG1 HG1 sing N N 291 THR CG2 HG21 sing N N 292 THR CG2 HG22 sing N N 293 THR CG2 HG23 sing N N 294 THR OXT HXT sing N N 295 TRP N CA sing N N 296 TRP N H sing N N 297 TRP N H2 sing N N 298 TRP CA C sing N N 299 TRP CA CB sing N N 300 TRP CA HA sing N N 301 TRP C O doub N N 302 TRP C OXT sing N N 303 TRP CB CG sing N N 304 TRP CB HB2 sing N N 305 TRP CB HB3 sing N N 306 TRP CG CD1 doub Y N 307 TRP CG CD2 sing Y N 308 TRP CD1 NE1 sing Y N 309 TRP CD1 HD1 sing N N 310 TRP CD2 CE2 doub Y N 311 TRP CD2 CE3 sing Y N 312 TRP NE1 CE2 sing Y N 313 TRP NE1 HE1 sing N N 314 TRP CE2 CZ2 sing Y N 315 TRP CE3 CZ3 doub Y N 316 TRP CE3 HE3 sing N N 317 TRP CZ2 CH2 doub Y N 318 TRP CZ2 HZ2 sing N N 319 TRP CZ3 CH2 sing Y N 320 TRP CZ3 HZ3 sing N N 321 TRP CH2 HH2 sing N N 322 TRP OXT HXT sing N N 323 TYR N CA sing N N 324 TYR N H sing N N 325 TYR N H2 sing N N 326 TYR CA C sing N N 327 TYR CA CB sing N N 328 TYR CA HA sing N N 329 TYR C O doub N N 330 TYR C OXT sing N N 331 TYR CB CG sing N N 332 TYR CB HB2 sing N N 333 TYR CB HB3 sing N N 334 TYR CG CD1 doub Y N 335 TYR CG CD2 sing Y N 336 TYR CD1 CE1 sing Y N 337 TYR CD1 HD1 sing N N 338 TYR CD2 CE2 doub Y N 339 TYR CD2 HD2 sing N N 340 TYR CE1 CZ doub Y N 341 TYR CE1 HE1 sing N N 342 TYR CE2 CZ sing Y N 343 TYR CE2 HE2 sing N N 344 TYR CZ OH sing N N 345 TYR OH HH sing N N 346 TYR OXT HXT sing N N 347 VAL N CA sing N N 348 VAL N H sing N N 349 VAL N H2 sing N N 350 VAL CA C sing N N 351 VAL CA CB sing N N 352 VAL CA HA sing N N 353 VAL C O doub N N 354 VAL C OXT sing N N 355 VAL CB CG1 sing N N 356 VAL CB CG2 sing N N 357 VAL CB HB sing N N 358 VAL CG1 HG11 sing N N 359 VAL CG1 HG12 sing N N 360 VAL CG1 HG13 sing N N 361 VAL CG2 HG21 sing N N 362 VAL CG2 HG22 sing N N 363 VAL CG2 HG23 sing N N 364 VAL OXT HXT sing N N 365 # _pdbx_audit_support.funding_organization ? _pdbx_audit_support.country Italy _pdbx_audit_support.grant_number 'FARB2012-University of Bologna' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1EP7 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6Q6T _atom_sites.fract_transf_matrix[1][1] 0.016454 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.028723 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020765 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_