data_6QBI # _entry.id 6QBI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6QBI pdb_00006qbi 10.2210/pdb6qbi/pdb WWPDB D_1200013556 ? ? BMRB 34344 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of BB_P28, Borrelia Burgdorferi lipoprotein' _pdbx_database_related.db_id 34344 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6QBI _pdbx_database_status.recvd_initial_deposition_date 2018-12-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fridmanis, J.' 1 0000-0002-0116-5208 'Otikovs, M.' 2 ? 'Brangulis, K.' 3 ? 'Jaudzems, K.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proteins _citation.journal_id_ASTM PSFGEY _citation.journal_id_CSD 0867 _citation.journal_id_ISSN 1097-0134 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Solution NMR structure of Borrelia burgdorferi outer surface lipoprotein BBP28, a member of the mlp protein family.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/prot.26011 _citation.pdbx_database_id_PubMed 32949018 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fridmanis, J.' 1 ? primary 'Otikovs, M.' 2 ? primary 'Brangulis, K.' 3 ? primary 'Tars, K.' 4 ? primary 'Jaudzems, K.' 5 0000-0003-3922-2447 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6QBI _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6QBI _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Surface protein, mlp lipoprotein family' _entity.formula_weight 11038.109 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMGPKSKEELLREKLSEDQKTHLDWLKEALGNDGEFDKFLGYDESKIKTALDHIKSELDKCNGNDADQQKTTFKQTVQG ALSGGIDGFGSNNAVTTCGNGS ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMGPKSKEELLREKLSEDQKTHLDWLKEALGNDGEFDKFLGYDESKIKTALDHIKSELDKCNGNDADQQKTTFKQTVQG ALSGGIDGFGSNNAVTTCGNGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 PRO n 1 6 LYS n 1 7 SER n 1 8 LYS n 1 9 GLU n 1 10 GLU n 1 11 LEU n 1 12 LEU n 1 13 ARG n 1 14 GLU n 1 15 LYS n 1 16 LEU n 1 17 SER n 1 18 GLU n 1 19 ASP n 1 20 GLN n 1 21 LYS n 1 22 THR n 1 23 HIS n 1 24 LEU n 1 25 ASP n 1 26 TRP n 1 27 LEU n 1 28 LYS n 1 29 GLU n 1 30 ALA n 1 31 LEU n 1 32 GLY n 1 33 ASN n 1 34 ASP n 1 35 GLY n 1 36 GLU n 1 37 PHE n 1 38 ASP n 1 39 LYS n 1 40 PHE n 1 41 LEU n 1 42 GLY n 1 43 TYR n 1 44 ASP n 1 45 GLU n 1 46 SER n 1 47 LYS n 1 48 ILE n 1 49 LYS n 1 50 THR n 1 51 ALA n 1 52 LEU n 1 53 ASP n 1 54 HIS n 1 55 ILE n 1 56 LYS n 1 57 SER n 1 58 GLU n 1 59 LEU n 1 60 ASP n 1 61 LYS n 1 62 CYS n 1 63 ASN n 1 64 GLY n 1 65 ASN n 1 66 ASP n 1 67 ALA n 1 68 ASP n 1 69 GLN n 1 70 GLN n 1 71 LYS n 1 72 THR n 1 73 THR n 1 74 PHE n 1 75 LYS n 1 76 GLN n 1 77 THR n 1 78 VAL n 1 79 GLN n 1 80 GLY n 1 81 ALA n 1 82 LEU n 1 83 SER n 1 84 GLY n 1 85 GLY n 1 86 ILE n 1 87 ASP n 1 88 GLY n 1 89 PHE n 1 90 GLY n 1 91 SER n 1 92 ASN n 1 93 ASN n 1 94 ALA n 1 95 VAL n 1 96 THR n 1 97 THR n 1 98 CYS n 1 99 GLY n 1 100 ASN n 1 101 GLY n 1 102 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 102 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'mlpA, BB_P28' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 35210 / B31 / CIP 102532 / DSM 4680' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224326 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code H7C7P1_BORBU _struct_ref.pdbx_db_accession H7C7P1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PKSKEELLREKLSEDQKTHLDWLKEALGNDGEFDKFLGYDESKIKTALDHIKSELDKCNGNDADQQKTTFKQTVQGALSG GIDGFGSNNAVTTCGNGS ; _struct_ref.pdbx_align_begin 51 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6QBI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 102 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession H7C7P1 _struct_ref_seq.db_align_beg 51 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 148 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 102 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6QBI GLY A 1 ? UNP H7C7P1 ? ? 'expression tag' 1 1 1 6QBI ALA A 2 ? UNP H7C7P1 ? ? 'expression tag' 2 2 1 6QBI MET A 3 ? UNP H7C7P1 ? ? 'expression tag' 3 3 1 6QBI GLY A 4 ? UNP H7C7P1 ? ? 'expression tag' 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 2 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic 3 1 1 '3D 1H-15N NOESY' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HNCA' 1 isotropic 10 1 1 '3D CBCA(CO)NH' 1 isotropic 9 1 1 '3D HNCACB' 1 isotropic 8 1 1 '3D HN(CO)CA' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.08 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 0.01 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label Standart _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err 0.1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20 mM sodium phosphate, 50 mM sodium chloride, 0.03 % w/v sodium azide, 1 mM EDTA, 2 mM U-C13, N15 BB_P28, 93% H2O/7% D2O' _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' _pdbx_nmr_sample_details.label BBP28_C13_N15 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model UNITY _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6QBI _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6QBI _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6QBI _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 2 refinement CNS 1.2 'Brunger, Adams, Clore, Gros, Nilges and Read' 3 'structure calculation' CANDID 2.02 'Herrmann, Guntert and Wuthrich' 4 'chemical shift assignment' CARA 1.8.4 'Keller and Wuthrich' 5 'peak picking' CARA 1.8.4 'Keller and Wuthrich' 7 collection TopSpin 3.5 'Bruker Biospin' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6QBI _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6QBI _struct.title 'NMR structure of BB_P28, Borrelia burgdorferi outer surface lipoprotein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6QBI _struct_keywords.text 'Lipoprotein, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 7 ? LEU A 16 ? SER A 7 LEU A 16 1 ? 10 HELX_P HELX_P2 AA2 SER A 17 ? GLY A 32 ? SER A 17 GLY A 32 1 ? 16 HELX_P HELX_P3 AA3 ASN A 33 ? GLY A 42 ? ASN A 33 GLY A 42 1 ? 10 HELX_P HELX_P4 AA4 ASP A 44 ? LYS A 61 ? ASP A 44 LYS A 61 1 ? 18 HELX_P HELX_P5 AA5 ASP A 66 ? GLY A 80 ? ASP A 66 GLY A 80 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 62 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 98 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 62 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 98 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.028 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 6QBI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 6QBI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 SER 102 102 102 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6160 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-01-29 2 'Structure model' 1 1 2021-02-17 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_database_2.pdbx_DOI' 11 3 'Structure model' '_database_2.pdbx_database_accession' 12 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'sodium chloride' 50 ? mM 'natural abundance' 1 'sodium azide' 0.03 ? '% w/v' 'natural abundance' 1 EDTA 1 ? mM 'natural abundance' 1 BB_P28 2 ? mM 'U-C13, N15' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 OE2 A GLU 9 ? ? HZ3 A LYS 28 ? ? 1.56 2 2 OD1 A ASP 19 ? ? HZ1 A LYS 56 ? ? 1.59 3 3 OE2 A GLU 10 ? ? HH21 A ARG 13 ? ? 1.59 4 5 OE2 A GLU 9 ? ? HZ2 A LYS 28 ? ? 1.58 5 7 HZ2 A LYS 6 ? ? OE1 A GLU 10 ? ? 1.59 6 7 OE1 A GLU 18 ? ? HZ2 A LYS 21 ? ? 1.59 7 8 OD2 A ASP 19 ? ? HZ1 A LYS 56 ? ? 1.58 8 9 OE2 A GLU 9 ? ? HZ1 A LYS 28 ? ? 1.57 9 10 HZ2 A LYS 8 ? ? OD1 A ASP 38 ? ? 1.57 10 10 OE1 A GLU 9 ? ? HZ2 A LYS 28 ? ? 1.58 11 12 HZ3 A LYS 47 ? ? OD2 A ASP 87 ? ? 1.59 12 13 HZ2 A LYS 6 ? ? OE1 A GLU 10 ? ? 1.58 13 14 OE2 A GLU 18 ? ? HZ1 A LYS 21 ? ? 1.57 14 14 OE1 A GLU 9 ? ? HE A ARG 13 ? ? 1.60 15 16 OD1 A ASP 19 ? ? HZ1 A LYS 56 ? ? 1.55 16 16 OE2 A GLU 58 ? ? HZ1 A LYS 61 ? ? 1.60 17 18 OD1 A ASP 19 ? ? HZ1 A LYS 56 ? ? 1.55 18 19 HZ1 A LYS 8 ? ? OD2 A ASP 38 ? ? 1.53 19 19 HZ1 A LYS 15 ? ? OE2 A GLU 45 ? ? 1.58 20 20 OE1 A GLU 9 ? ? HZ2 A LYS 28 ? ? 1.57 21 20 HZ2 A LYS 8 ? ? OD1 A ASP 38 ? ? 1.58 22 20 OE2 A GLU 58 ? ? HZ3 A LYS 61 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 7 ? ? -107.87 -168.16 2 1 ASN A 93 ? ? -147.52 -33.96 3 1 THR A 97 ? ? -73.22 26.69 4 3 SER A 7 ? ? -115.89 -163.14 5 3 SER A 91 ? ? -69.93 3.61 6 4 ALA A 2 ? ? -170.17 145.52 7 4 ASP A 66 ? ? -92.86 41.37 8 4 SER A 91 ? ? -69.11 1.61 9 5 SER A 7 ? ? -110.23 -168.51 10 5 ASN A 65 ? ? -61.56 -84.77 11 5 ASN A 93 ? ? -109.13 -61.74 12 5 THR A 97 ? ? -72.09 49.30 13 6 SER A 7 ? ? -125.35 -162.67 14 6 ASP A 66 ? ? -93.35 35.54 15 6 SER A 83 ? ? -87.78 41.29 16 6 THR A 97 ? ? -72.17 21.11 17 7 THR A 97 ? ? -78.86 31.05 18 8 ALA A 2 ? ? 48.67 72.08 19 8 THR A 97 ? ? -78.58 26.17 20 9 ASP A 66 ? ? -101.42 42.47 21 9 ILE A 86 ? ? -170.86 -29.42 22 9 ASN A 93 ? ? -143.85 -27.58 23 10 SER A 7 ? ? -103.03 -165.13 24 10 THR A 97 ? ? -71.60 47.24 25 10 CYS A 98 ? ? -93.99 32.82 26 11 ASN A 93 ? ? -146.17 -48.45 27 11 THR A 97 ? ? -78.72 24.85 28 12 ASN A 93 ? ? -137.83 -37.66 29 13 PRO A 5 ? ? -78.59 -168.83 30 14 LEU A 82 ? ? -91.60 36.21 31 14 SER A 83 ? ? -77.37 38.08 32 14 ASN A 93 ? ? -146.30 -21.33 33 14 THR A 97 ? ? -78.62 35.44 34 15 ALA A 2 ? ? -123.57 -69.09 35 15 SER A 7 ? ? -115.43 -169.43 36 15 ASN A 93 ? ? -148.33 -32.11 37 15 THR A 97 ? ? -74.03 30.74 38 16 ASN A 93 ? ? -134.00 -33.60 39 16 CYS A 98 ? ? -109.51 50.13 40 16 ASN A 100 ? ? -174.69 124.35 41 17 ALA A 2 ? ? -92.04 -78.61 42 17 PRO A 5 ? ? -79.59 -160.61 43 17 ASN A 63 ? ? -142.24 29.47 44 18 ALA A 2 ? ? -162.60 -169.60 45 18 SER A 7 ? ? -118.14 -163.08 46 18 ALA A 81 ? ? -94.69 -65.65 47 18 CYS A 98 ? ? -81.52 48.88 48 19 THR A 97 ? ? -61.95 0.25 49 19 ASN A 100 ? ? -107.03 -164.62 50 20 PRO A 5 ? ? -64.25 -177.98 51 20 ALA A 81 ? ? -100.73 -62.50 52 20 ASN A 93 ? ? -151.28 -31.62 53 20 THR A 97 ? ? -83.32 43.11 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #