data_6QBJ # _entry.id 6QBJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6QBJ pdb_00006qbj 10.2210/pdb6qbj/pdb WWPDB D_1200013586 ? ? BMRB 27730 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 27730 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6QBJ _pdbx_database_status.recvd_initial_deposition_date 2018-12-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Karska, N.' 1 ? 'Rodziewicz-Motowidlo, S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biochim Biophys Acta Biomembr' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1879-2642 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 1861 _citation.language ? _citation.page_first 926 _citation.page_last 938 _citation.title 'Structure determination of UL49.5 transmembrane protein from bovine herpesvirus 1 by NMR spectroscopy and molecular dynamics.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbamem.2019.02.005 _citation.pdbx_database_id_PubMed 30772281 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Karska, N.' 1 ? primary 'Graul, M.' 2 ? primary 'Sikorska, E.' 3 ? primary 'Zhukov, I.' 4 ? primary 'Slusarz, M.J.' 5 ? primary 'Kasprzykowski, F.' 6 ? primary 'Lipinska, A.D.' 7 ? primary 'Rodziewicz-Motowidlo, S.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Envelope glycoprotein N' _entity.formula_weight 4215.985 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'UL49.5,Virion protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'VVFYVALTAV(NLE)VAVALYAYGL(ABA)FRL(NLE)GASGPNKKESRGRG(NH2)' _entity_poly.pdbx_seq_one_letter_code_can VVFYVALTAVLVAVALYAYGLAFRLLGASGPNKKESRGRGX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 VAL n 1 3 PHE n 1 4 TYR n 1 5 VAL n 1 6 ALA n 1 7 LEU n 1 8 THR n 1 9 ALA n 1 10 VAL n 1 11 NLE n 1 12 VAL n 1 13 ALA n 1 14 VAL n 1 15 ALA n 1 16 LEU n 1 17 TYR n 1 18 ALA n 1 19 TYR n 1 20 GLY n 1 21 LEU n 1 22 ABA n 1 23 PHE n 1 24 ARG n 1 25 LEU n 1 26 NLE n 1 27 GLY n 1 28 ALA n 1 29 SER n 1 30 GLY n 1 31 PRO n 1 32 ASN n 1 33 LYS n 1 34 LYS n 1 35 GLU n 1 36 SER n 1 37 ARG n 1 38 GLY n 1 39 ARG n 1 40 GLY n 1 41 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 41 _pdbx_entity_src_syn.organism_scientific 'Bovine alphaherpesvirus 1' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 10320 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q89806_9ALPH _struct_ref.pdbx_db_accession Q89806 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VVFYVALTAVMVAVALYAYGLCFRLMGASGPNKKESRGRG _struct_ref.pdbx_align_begin 57 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6QBJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 40 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q89806 _struct_ref_seq.db_align_beg 57 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 96 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 40 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6QBJ NLE A 11 ? UNP Q89806 MET 67 conflict 11 1 1 6QBJ ABA A 22 ? UNP Q89806 CYS 78 conflict 22 2 1 6QBJ NLE A 26 ? UNP Q89806 MET 82 conflict 26 3 1 6QBJ NH2 A 41 ? UNP Q89806 ? ? amidation 41 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ABA 'L-peptide linking' n 'ALPHA-AMINOBUTYRIC ACID' ? 'C4 H9 N O2' 103.120 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 NLE 'L-peptide linking' n NORLEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 anisotropic 3 1 1 '2D DQF-COSY' 1 isotropic 4 1 1 '2D 1H-1H ROESY' 1 anisotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.05 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2.7 mM TMC.BHV, 100 mM DPC, 0.01 mM acetic acid -d4, 90 % H2O, 10 % D2O, 50% H2O/50% D2O' _pdbx_nmr_sample_details.solvent_system '50% H2O/50% D2O' _pdbx_nmr_sample_details.label 1 _pdbx_nmr_sample_details.type micelle _pdbx_nmr_sample_details.details ;NMR experiments were performed using 100 mM DPC-d38 in water (90%:10% H2O:D2O).The peptide (TMC.BHV) concentration was 2.7 mM. The acetic acid -d4 concentration was 0.01mM. ; # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'Uniform NMR System' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Agilent _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6QBJ _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6QBJ _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6QBJ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' Sparky ? Goddard 4 'peak picking' Sparky ? Goddard # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6QBJ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6QBJ _struct.title ;Structure determination of transmembrane- C-terminal fragment of UL49.5 protein from bovine herpesvirus 1 by NMR spectroscopy and molecular dynamics ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6QBJ _struct_keywords.text 'Bovine herpesvirus 1 (BHV-1), UL49.5 viral protein, transmembrane protein, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id VAL _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 14 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id PHE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 23 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id VAL _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 14 _struct_conf.end_auth_comp_id PHE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 23 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A VAL 10 C ? ? ? 1_555 A NLE 11 N ? ? A VAL 10 A NLE 11 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale2 covale both ? A NLE 11 C ? ? ? 1_555 A VAL 12 N ? ? A NLE 11 A VAL 12 1_555 ? ? ? ? ? ? ? 1.343 ? ? covale3 covale both ? A LEU 21 C ? ? ? 1_555 A ABA 22 N ? ? A LEU 21 A ABA 22 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale4 covale both ? A ABA 22 C ? ? ? 1_555 A PHE 23 N ? ? A ABA 22 A PHE 23 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale5 covale both ? A LEU 25 C ? ? ? 1_555 A NLE 26 N ? ? A LEU 25 A NLE 26 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale6 covale both ? A NLE 26 C ? ? ? 1_555 A GLY 27 N ? ? A NLE 26 A GLY 27 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale7 covale both ? A GLY 40 C ? ? ? 1_555 A NH2 41 N ? ? A GLY 40 A NH2 41 1_555 ? ? ? ? ? ? ? 1.329 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 6QBJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 NLE 11 11 11 NLE NLE A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ABA 22 22 22 ABA ABU A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 NLE 26 26 26 NLE NLE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 NH2 41 41 41 NH2 NHE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 100 ? 1 MORE 0 ? 1 'SSA (A^2)' 4030 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-02-27 2 'Structure model' 1 1 2019-03-06 3 'Structure model' 1 2 2019-05-08 4 'Structure model' 1 3 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' pdbx_database_proc 3 3 'Structure model' pdbx_nmr_software 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' citation 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_citation.country' 6 4 'Structure model' '_database_2.pdbx_DOI' 7 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 TMC.BHV 2.7 ? mM 'natural abundance' 1 DPC 100 ? mM 'natural abundance' 1 'acetic acid -d4' 0.01 ? mM 'natural abundance' 1 H2O 90 ? % 'natural abundance' 1 D2O 10 ? % 'natural abundance' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 3 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.64 120.30 3.34 0.50 N 2 10 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.43 120.30 3.13 0.50 N 3 11 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.34 120.30 3.04 0.50 N 4 12 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.44 120.30 3.14 0.50 N 5 15 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.32 120.30 3.02 0.50 N 6 16 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.39 120.30 3.09 0.50 N 7 17 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.45 120.30 3.15 0.50 N 8 18 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.41 120.30 3.11 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 9 ? ? -120.16 -68.91 2 1 PHE A 23 ? ? -136.45 -48.75 3 1 SER A 29 ? ? -145.74 19.15 4 1 ASN A 32 ? ? -155.88 11.25 5 2 PHE A 3 ? ? 48.81 28.71 6 2 VAL A 12 ? ? 39.26 39.82 7 2 LEU A 21 ? ? -139.49 -31.87 8 2 PHE A 23 ? ? -127.72 -51.22 9 2 SER A 29 ? ? -145.47 19.34 10 2 ASN A 32 ? ? -155.59 14.44 11 3 TYR A 4 ? ? 56.46 15.71 12 3 ALA A 9 ? ? -123.15 -64.66 13 3 SER A 29 ? ? -146.49 13.47 14 3 ASN A 32 ? ? -156.61 17.70 15 4 ALA A 9 ? ? -124.58 -62.52 16 4 PHE A 23 ? ? -135.30 -52.03 17 4 SER A 29 ? ? -146.18 17.92 18 4 ASN A 32 ? ? -154.47 12.86 19 5 ALA A 9 ? ? -120.81 -68.81 20 5 PHE A 23 ? ? -137.51 -53.12 21 5 SER A 29 ? ? -142.94 20.15 22 5 ASN A 32 ? ? -154.49 15.05 23 6 ALA A 9 ? ? -132.53 -68.15 24 6 LEU A 21 ? ? -139.36 -31.72 25 6 PHE A 23 ? ? -134.52 -46.86 26 6 SER A 29 ? ? -142.37 16.37 27 6 ASN A 32 ? ? -155.94 11.62 28 7 ALA A 9 ? ? -131.08 -70.89 29 7 LEU A 21 ? ? -140.86 -26.34 30 7 PHE A 23 ? ? -137.60 -44.63 31 7 SER A 29 ? ? -142.01 16.14 32 7 ASN A 32 ? ? -156.71 15.91 33 8 ALA A 9 ? ? -126.29 -73.56 34 8 LEU A 21 ? ? -140.93 -25.60 35 8 PHE A 23 ? ? -132.19 -44.12 36 8 SER A 29 ? ? -145.96 20.97 37 8 ASN A 32 ? ? -156.59 8.97 38 9 ALA A 9 ? ? -119.53 -72.04 39 9 LEU A 21 ? ? -140.70 -26.28 40 9 PHE A 23 ? ? -133.74 -44.07 41 9 SER A 29 ? ? -142.72 25.46 42 9 ASN A 32 ? ? -154.25 9.10 43 10 ALA A 9 ? ? -126.27 -68.09 44 10 LEU A 21 ? ? -145.80 -14.75 45 10 PHE A 23 ? ? -134.20 -45.81 46 10 SER A 29 ? ? -140.65 15.49 47 10 ASN A 32 ? ? -157.35 6.23 48 11 ALA A 9 ? ? -121.42 -62.45 49 11 LEU A 21 ? ? -143.64 -20.79 50 11 PHE A 23 ? ? -134.69 -48.03 51 11 ASN A 32 ? ? -155.36 -1.58 52 12 TYR A 4 ? ? 58.17 16.68 53 12 ALA A 9 ? ? -125.14 -68.87 54 12 LEU A 21 ? ? -141.79 -29.26 55 12 PHE A 23 ? ? -134.27 -45.84 56 12 SER A 29 ? ? -140.59 10.75 57 12 ASN A 32 ? ? -157.04 7.09 58 13 TYR A 4 ? ? 56.89 18.72 59 13 ALA A 9 ? ? -128.45 -71.32 60 13 LEU A 21 ? ? -140.59 -29.54 61 13 PHE A 23 ? ? -125.15 -54.33 62 13 ARG A 24 ? ? 41.46 28.81 63 13 SER A 29 ? ? -140.44 12.71 64 13 ASN A 32 ? ? -157.35 14.74 65 14 ALA A 9 ? ? -123.42 -65.23 66 14 LEU A 21 ? ? -142.76 -18.79 67 14 PHE A 23 ? ? -135.45 -51.14 68 14 SER A 29 ? ? -144.35 14.99 69 14 ASN A 32 ? ? -155.44 11.09 70 15 ALA A 9 ? ? -118.93 -72.62 71 15 LEU A 21 ? ? -140.32 -30.19 72 15 PHE A 23 ? ? -132.46 -46.08 73 15 SER A 29 ? ? -145.17 14.05 74 15 ASN A 32 ? ? -156.87 13.98 75 16 TYR A 4 ? ? 58.19 19.63 76 16 ALA A 9 ? ? -122.31 -63.93 77 16 VAL A 12 ? ? 39.76 39.87 78 16 LEU A 21 ? ? -140.26 -27.46 79 16 PHE A 23 ? ? -133.69 -44.48 80 16 SER A 29 ? ? -145.10 16.69 81 16 ASN A 32 ? ? -154.33 4.56 82 17 PHE A 3 ? ? 38.87 37.13 83 17 TYR A 4 ? ? 57.72 18.28 84 17 LEU A 21 ? ? -141.35 -27.92 85 17 PHE A 23 ? ? -133.70 -50.22 86 17 SER A 29 ? ? -143.01 16.13 87 17 ASN A 32 ? ? -157.57 12.43 88 18 TYR A 4 ? ? 59.21 19.55 89 18 ALA A 9 ? ? -125.61 -57.28 90 18 VAL A 12 ? ? 37.73 41.59 91 18 LEU A 21 ? ? -140.93 -27.10 92 18 PHE A 23 ? ? -135.37 -45.35 93 18 ASN A 32 ? ? -156.41 6.73 94 19 ALA A 9 ? ? -124.30 -74.40 95 19 LEU A 21 ? ? -141.44 -29.07 96 19 PHE A 23 ? ? -131.83 -51.48 97 19 SER A 29 ? ? -145.23 13.22 98 19 ASN A 32 ? ? -156.87 11.36 99 20 VAL A 5 ? ? -58.33 -5.20 100 20 ALA A 9 ? ? -104.71 -69.88 101 20 LEU A 21 ? ? -141.35 -24.84 102 20 PHE A 23 ? ? -135.33 -50.07 103 20 SER A 29 ? ? -147.27 22.96 104 20 ASN A 32 ? ? -157.20 11.69 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ABA N N N N 1 ABA CA C N S 2 ABA C C N N 3 ABA O O N N 4 ABA CB C N N 5 ABA CG C N N 6 ABA OXT O N N 7 ABA H H N N 8 ABA H2 H N N 9 ABA HA H N N 10 ABA HB3 H N N 11 ABA HB2 H N N 12 ABA HG1 H N N 13 ABA HG3 H N N 14 ABA HG2 H N N 15 ABA HXT H N N 16 ALA N N N N 17 ALA CA C N S 18 ALA C C N N 19 ALA O O N N 20 ALA CB C N N 21 ALA OXT O N N 22 ALA H H N N 23 ALA H2 H N N 24 ALA HA H N N 25 ALA HB1 H N N 26 ALA HB2 H N N 27 ALA HB3 H N N 28 ALA HXT H N N 29 ARG N N N N 30 ARG CA C N S 31 ARG C C N N 32 ARG O O N N 33 ARG CB C N N 34 ARG CG C N N 35 ARG CD C N N 36 ARG NE N N N 37 ARG CZ C N N 38 ARG NH1 N N N 39 ARG NH2 N N N 40 ARG OXT O N N 41 ARG H H N N 42 ARG H2 H N N 43 ARG HA H N N 44 ARG HB2 H N N 45 ARG HB3 H N N 46 ARG HG2 H N N 47 ARG HG3 H N N 48 ARG HD2 H N N 49 ARG HD3 H N N 50 ARG HE H N N 51 ARG HH11 H N N 52 ARG HH12 H N N 53 ARG HH21 H N N 54 ARG HH22 H N N 55 ARG HXT H N N 56 ASN N N N N 57 ASN CA C N S 58 ASN C C N N 59 ASN O O N N 60 ASN CB C N N 61 ASN CG C N N 62 ASN OD1 O N N 63 ASN ND2 N N N 64 ASN OXT O N N 65 ASN H H N N 66 ASN H2 H N N 67 ASN HA H N N 68 ASN HB2 H N N 69 ASN HB3 H N N 70 ASN HD21 H N N 71 ASN HD22 H N N 72 ASN HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLU N N N N 88 GLU CA C N S 89 GLU C C N N 90 GLU O O N N 91 GLU CB C N N 92 GLU CG C N N 93 GLU CD C N N 94 GLU OE1 O N N 95 GLU OE2 O N N 96 GLU OXT O N N 97 GLU H H N N 98 GLU H2 H N N 99 GLU HA H N N 100 GLU HB2 H N N 101 GLU HB3 H N N 102 GLU HG2 H N N 103 GLU HG3 H N N 104 GLU HE2 H N N 105 GLU HXT H N N 106 GLY N N N N 107 GLY CA C N N 108 GLY C C N N 109 GLY O O N N 110 GLY OXT O N N 111 GLY H H N N 112 GLY H2 H N N 113 GLY HA2 H N N 114 GLY HA3 H N N 115 GLY HXT H N N 116 LEU N N N N 117 LEU CA C N S 118 LEU C C N N 119 LEU O O N N 120 LEU CB C N N 121 LEU CG C N N 122 LEU CD1 C N N 123 LEU CD2 C N N 124 LEU OXT O N N 125 LEU H H N N 126 LEU H2 H N N 127 LEU HA H N N 128 LEU HB2 H N N 129 LEU HB3 H N N 130 LEU HG H N N 131 LEU HD11 H N N 132 LEU HD12 H N N 133 LEU HD13 H N N 134 LEU HD21 H N N 135 LEU HD22 H N N 136 LEU HD23 H N N 137 LEU HXT H N N 138 LYS N N N N 139 LYS CA C N S 140 LYS C C N N 141 LYS O O N N 142 LYS CB C N N 143 LYS CG C N N 144 LYS CD C N N 145 LYS CE C N N 146 LYS NZ N N N 147 LYS OXT O N N 148 LYS H H N N 149 LYS H2 H N N 150 LYS HA H N N 151 LYS HB2 H N N 152 LYS HB3 H N N 153 LYS HG2 H N N 154 LYS HG3 H N N 155 LYS HD2 H N N 156 LYS HD3 H N N 157 LYS HE2 H N N 158 LYS HE3 H N N 159 LYS HZ1 H N N 160 LYS HZ2 H N N 161 LYS HZ3 H N N 162 LYS HXT H N N 163 MET N N N N 164 MET CA C N S 165 MET C C N N 166 MET O O N N 167 MET CB C N N 168 MET CG C N N 169 MET SD S N N 170 MET CE C N N 171 MET OXT O N N 172 MET H H N N 173 MET H2 H N N 174 MET HA H N N 175 MET HB2 H N N 176 MET HB3 H N N 177 MET HG2 H N N 178 MET HG3 H N N 179 MET HE1 H N N 180 MET HE2 H N N 181 MET HE3 H N N 182 MET HXT H N N 183 NH2 N N N N 184 NH2 HN1 H N N 185 NH2 HN2 H N N 186 NLE N N N N 187 NLE CA C N S 188 NLE C C N N 189 NLE O O N N 190 NLE OXT O N N 191 NLE CB C N N 192 NLE CG C N N 193 NLE CD C N N 194 NLE CE C N N 195 NLE H H N N 196 NLE H2 H N N 197 NLE HA H N N 198 NLE HXT H N N 199 NLE HB2 H N N 200 NLE HB3 H N N 201 NLE HG2 H N N 202 NLE HG3 H N N 203 NLE HD2 H N N 204 NLE HD3 H N N 205 NLE HE1 H N N 206 NLE HE2 H N N 207 NLE HE3 H N N 208 PHE N N N N 209 PHE CA C N S 210 PHE C C N N 211 PHE O O N N 212 PHE CB C N N 213 PHE CG C Y N 214 PHE CD1 C Y N 215 PHE CD2 C Y N 216 PHE CE1 C Y N 217 PHE CE2 C Y N 218 PHE CZ C Y N 219 PHE OXT O N N 220 PHE H H N N 221 PHE H2 H N N 222 PHE HA H N N 223 PHE HB2 H N N 224 PHE HB3 H N N 225 PHE HD1 H N N 226 PHE HD2 H N N 227 PHE HE1 H N N 228 PHE HE2 H N N 229 PHE HZ H N N 230 PHE HXT H N N 231 PRO N N N N 232 PRO CA C N S 233 PRO C C N N 234 PRO O O N N 235 PRO CB C N N 236 PRO CG C N N 237 PRO CD C N N 238 PRO OXT O N N 239 PRO H H N N 240 PRO HA H N N 241 PRO HB2 H N N 242 PRO HB3 H N N 243 PRO HG2 H N N 244 PRO HG3 H N N 245 PRO HD2 H N N 246 PRO HD3 H N N 247 PRO HXT H N N 248 SER N N N N 249 SER CA C N S 250 SER C C N N 251 SER O O N N 252 SER CB C N N 253 SER OG O N N 254 SER OXT O N N 255 SER H H N N 256 SER H2 H N N 257 SER HA H N N 258 SER HB2 H N N 259 SER HB3 H N N 260 SER HG H N N 261 SER HXT H N N 262 THR N N N N 263 THR CA C N S 264 THR C C N N 265 THR O O N N 266 THR CB C N R 267 THR OG1 O N N 268 THR CG2 C N N 269 THR OXT O N N 270 THR H H N N 271 THR H2 H N N 272 THR HA H N N 273 THR HB H N N 274 THR HG1 H N N 275 THR HG21 H N N 276 THR HG22 H N N 277 THR HG23 H N N 278 THR HXT H N N 279 TYR N N N N 280 TYR CA C N S 281 TYR C C N N 282 TYR O O N N 283 TYR CB C N N 284 TYR CG C Y N 285 TYR CD1 C Y N 286 TYR CD2 C Y N 287 TYR CE1 C Y N 288 TYR CE2 C Y N 289 TYR CZ C Y N 290 TYR OH O N N 291 TYR OXT O N N 292 TYR H H N N 293 TYR H2 H N N 294 TYR HA H N N 295 TYR HB2 H N N 296 TYR HB3 H N N 297 TYR HD1 H N N 298 TYR HD2 H N N 299 TYR HE1 H N N 300 TYR HE2 H N N 301 TYR HH H N N 302 TYR HXT H N N 303 VAL N N N N 304 VAL CA C N S 305 VAL C C N N 306 VAL O O N N 307 VAL CB C N N 308 VAL CG1 C N N 309 VAL CG2 C N N 310 VAL OXT O N N 311 VAL H H N N 312 VAL H2 H N N 313 VAL HA H N N 314 VAL HB H N N 315 VAL HG11 H N N 316 VAL HG12 H N N 317 VAL HG13 H N N 318 VAL HG21 H N N 319 VAL HG22 H N N 320 VAL HG23 H N N 321 VAL HXT H N N 322 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ABA N CA sing N N 1 ABA N H sing N N 2 ABA N H2 sing N N 3 ABA CA C sing N N 4 ABA CA CB sing N N 5 ABA CA HA sing N N 6 ABA C O doub N N 7 ABA C OXT sing N N 8 ABA CB CG sing N N 9 ABA CB HB3 sing N N 10 ABA CB HB2 sing N N 11 ABA CG HG1 sing N N 12 ABA CG HG3 sing N N 13 ABA CG HG2 sing N N 14 ABA OXT HXT sing N N 15 ALA N CA sing N N 16 ALA N H sing N N 17 ALA N H2 sing N N 18 ALA CA C sing N N 19 ALA CA CB sing N N 20 ALA CA HA sing N N 21 ALA C O doub N N 22 ALA C OXT sing N N 23 ALA CB HB1 sing N N 24 ALA CB HB2 sing N N 25 ALA CB HB3 sing N N 26 ALA OXT HXT sing N N 27 ARG N CA sing N N 28 ARG N H sing N N 29 ARG N H2 sing N N 30 ARG CA C sing N N 31 ARG CA CB sing N N 32 ARG CA HA sing N N 33 ARG C O doub N N 34 ARG C OXT sing N N 35 ARG CB CG sing N N 36 ARG CB HB2 sing N N 37 ARG CB HB3 sing N N 38 ARG CG CD sing N N 39 ARG CG HG2 sing N N 40 ARG CG HG3 sing N N 41 ARG CD NE sing N N 42 ARG CD HD2 sing N N 43 ARG CD HD3 sing N N 44 ARG NE CZ sing N N 45 ARG NE HE sing N N 46 ARG CZ NH1 sing N N 47 ARG CZ NH2 doub N N 48 ARG NH1 HH11 sing N N 49 ARG NH1 HH12 sing N N 50 ARG NH2 HH21 sing N N 51 ARG NH2 HH22 sing N N 52 ARG OXT HXT sing N N 53 ASN N CA sing N N 54 ASN N H sing N N 55 ASN N H2 sing N N 56 ASN CA C sing N N 57 ASN CA CB sing N N 58 ASN CA HA sing N N 59 ASN C O doub N N 60 ASN C OXT sing N N 61 ASN CB CG sing N N 62 ASN CB HB2 sing N N 63 ASN CB HB3 sing N N 64 ASN CG OD1 doub N N 65 ASN CG ND2 sing N N 66 ASN ND2 HD21 sing N N 67 ASN ND2 HD22 sing N N 68 ASN OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 LEU N CA sing N N 110 LEU N H sing N N 111 LEU N H2 sing N N 112 LEU CA C sing N N 113 LEU CA CB sing N N 114 LEU CA HA sing N N 115 LEU C O doub N N 116 LEU C OXT sing N N 117 LEU CB CG sing N N 118 LEU CB HB2 sing N N 119 LEU CB HB3 sing N N 120 LEU CG CD1 sing N N 121 LEU CG CD2 sing N N 122 LEU CG HG sing N N 123 LEU CD1 HD11 sing N N 124 LEU CD1 HD12 sing N N 125 LEU CD1 HD13 sing N N 126 LEU CD2 HD21 sing N N 127 LEU CD2 HD22 sing N N 128 LEU CD2 HD23 sing N N 129 LEU OXT HXT sing N N 130 LYS N CA sing N N 131 LYS N H sing N N 132 LYS N H2 sing N N 133 LYS CA C sing N N 134 LYS CA CB sing N N 135 LYS CA HA sing N N 136 LYS C O doub N N 137 LYS C OXT sing N N 138 LYS CB CG sing N N 139 LYS CB HB2 sing N N 140 LYS CB HB3 sing N N 141 LYS CG CD sing N N 142 LYS CG HG2 sing N N 143 LYS CG HG3 sing N N 144 LYS CD CE sing N N 145 LYS CD HD2 sing N N 146 LYS CD HD3 sing N N 147 LYS CE NZ sing N N 148 LYS CE HE2 sing N N 149 LYS CE HE3 sing N N 150 LYS NZ HZ1 sing N N 151 LYS NZ HZ2 sing N N 152 LYS NZ HZ3 sing N N 153 LYS OXT HXT sing N N 154 MET N CA sing N N 155 MET N H sing N N 156 MET N H2 sing N N 157 MET CA C sing N N 158 MET CA CB sing N N 159 MET CA HA sing N N 160 MET C O doub N N 161 MET C OXT sing N N 162 MET CB CG sing N N 163 MET CB HB2 sing N N 164 MET CB HB3 sing N N 165 MET CG SD sing N N 166 MET CG HG2 sing N N 167 MET CG HG3 sing N N 168 MET SD CE sing N N 169 MET CE HE1 sing N N 170 MET CE HE2 sing N N 171 MET CE HE3 sing N N 172 MET OXT HXT sing N N 173 NH2 N HN1 sing N N 174 NH2 N HN2 sing N N 175 NLE N CA sing N N 176 NLE N H sing N N 177 NLE N H2 sing N N 178 NLE CA C sing N N 179 NLE CA CB sing N N 180 NLE CA HA sing N N 181 NLE C O doub N N 182 NLE C OXT sing N N 183 NLE OXT HXT sing N N 184 NLE CB CG sing N N 185 NLE CB HB2 sing N N 186 NLE CB HB3 sing N N 187 NLE CG CD sing N N 188 NLE CG HG2 sing N N 189 NLE CG HG3 sing N N 190 NLE CD CE sing N N 191 NLE CD HD2 sing N N 192 NLE CD HD3 sing N N 193 NLE CE HE1 sing N N 194 NLE CE HE2 sing N N 195 NLE CE HE3 sing N N 196 PHE N CA sing N N 197 PHE N H sing N N 198 PHE N H2 sing N N 199 PHE CA C sing N N 200 PHE CA CB sing N N 201 PHE CA HA sing N N 202 PHE C O doub N N 203 PHE C OXT sing N N 204 PHE CB CG sing N N 205 PHE CB HB2 sing N N 206 PHE CB HB3 sing N N 207 PHE CG CD1 doub Y N 208 PHE CG CD2 sing Y N 209 PHE CD1 CE1 sing Y N 210 PHE CD1 HD1 sing N N 211 PHE CD2 CE2 doub Y N 212 PHE CD2 HD2 sing N N 213 PHE CE1 CZ doub Y N 214 PHE CE1 HE1 sing N N 215 PHE CE2 CZ sing Y N 216 PHE CE2 HE2 sing N N 217 PHE CZ HZ sing N N 218 PHE OXT HXT sing N N 219 PRO N CA sing N N 220 PRO N CD sing N N 221 PRO N H sing N N 222 PRO CA C sing N N 223 PRO CA CB sing N N 224 PRO CA HA sing N N 225 PRO C O doub N N 226 PRO C OXT sing N N 227 PRO CB CG sing N N 228 PRO CB HB2 sing N N 229 PRO CB HB3 sing N N 230 PRO CG CD sing N N 231 PRO CG HG2 sing N N 232 PRO CG HG3 sing N N 233 PRO CD HD2 sing N N 234 PRO CD HD3 sing N N 235 PRO OXT HXT sing N N 236 SER N CA sing N N 237 SER N H sing N N 238 SER N H2 sing N N 239 SER CA C sing N N 240 SER CA CB sing N N 241 SER CA HA sing N N 242 SER C O doub N N 243 SER C OXT sing N N 244 SER CB OG sing N N 245 SER CB HB2 sing N N 246 SER CB HB3 sing N N 247 SER OG HG sing N N 248 SER OXT HXT sing N N 249 THR N CA sing N N 250 THR N H sing N N 251 THR N H2 sing N N 252 THR CA C sing N N 253 THR CA CB sing N N 254 THR CA HA sing N N 255 THR C O doub N N 256 THR C OXT sing N N 257 THR CB OG1 sing N N 258 THR CB CG2 sing N N 259 THR CB HB sing N N 260 THR OG1 HG1 sing N N 261 THR CG2 HG21 sing N N 262 THR CG2 HG22 sing N N 263 THR CG2 HG23 sing N N 264 THR OXT HXT sing N N 265 TYR N CA sing N N 266 TYR N H sing N N 267 TYR N H2 sing N N 268 TYR CA C sing N N 269 TYR CA CB sing N N 270 TYR CA HA sing N N 271 TYR C O doub N N 272 TYR C OXT sing N N 273 TYR CB CG sing N N 274 TYR CB HB2 sing N N 275 TYR CB HB3 sing N N 276 TYR CG CD1 doub Y N 277 TYR CG CD2 sing Y N 278 TYR CD1 CE1 sing Y N 279 TYR CD1 HD1 sing N N 280 TYR CD2 CE2 doub Y N 281 TYR CD2 HD2 sing N N 282 TYR CE1 CZ doub Y N 283 TYR CE1 HE1 sing N N 284 TYR CE2 CZ sing Y N 285 TYR CE2 HE2 sing N N 286 TYR CZ OH sing N N 287 TYR OH HH sing N N 288 TYR OXT HXT sing N N 289 VAL N CA sing N N 290 VAL N H sing N N 291 VAL N H2 sing N N 292 VAL CA C sing N N 293 VAL CA CB sing N N 294 VAL CA HA sing N N 295 VAL C O doub N N 296 VAL C OXT sing N N 297 VAL CB CG1 sing N N 298 VAL CB CG2 sing N N 299 VAL CB HB sing N N 300 VAL CG1 HG11 sing N N 301 VAL CG1 HG12 sing N N 302 VAL CG1 HG13 sing N N 303 VAL CG2 HG21 sing N N 304 VAL CG2 HG22 sing N N 305 VAL CG2 HG23 sing N N 306 VAL OXT HXT sing N N 307 # _pdbx_audit_support.funding_organization 'Polish National Science Centre' _pdbx_audit_support.country Poland _pdbx_audit_support.grant_number UMO-2014/14/E/NZ6/00164 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #