data_6QJY # _entry.id 6QJY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6QJY pdb_00006qjy 10.2210/pdb6qjy/pdb WWPDB D_1200012782 ? ? BMRB 27683 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 27683 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6QJY _pdbx_database_status.recvd_initial_deposition_date 2019-01-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Goretzki, B.' 1 0000-0002-7721-6657 'Heiby, J.' 2 0000-0001-8191-8945 'Neuweiler, H.' 3 0000-0002-6657-001X 'Hellmich, U.A.' 4 0000-0001-7162-285X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Solution NMR structure of a mutant major ampullate spidroin 1 N-terminal domain' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-019-12365 _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Heiby, J.H.' 1 0000-0001-8191-8945 primary 'Goretzki, B.' 2 0000-0002-7721-6657 primary 'Johnson, C.M.' 3 ? primary 'Hellmich, U.A.' 4 0000-0001-7162-285X primary 'Neuweiler, H.' 5 0000-0002-6657-001X # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Major ampullate spidroin 1' _entity.formula_weight 14075.485 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'M20L, M24L, M41L, M48L, M77L, M101L' _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSGNSHTTPWTNPGLAENFLNSFLQGLSSMPGFTASQLDDLSTIAQSLVQSIQSLAAQGRTSPNKLQALNMAFASSLAEI AASEEGGGSLSTKTSSIASALSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSGNSHTTPWTNPGLAENFLNSFLQGLSSMPGFTASQLDDLSTIAQSLVQSIQSLAAQGRTSPNKLQALNMAFASSLAEI AASEEGGGSLSTKTSSIASALSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 ASN n 1 5 SER n 1 6 HIS n 1 7 THR n 1 8 THR n 1 9 PRO n 1 10 TRP n 1 11 THR n 1 12 ASN n 1 13 PRO n 1 14 GLY n 1 15 LEU n 1 16 ALA n 1 17 GLU n 1 18 ASN n 1 19 PHE n 1 20 LEU n 1 21 ASN n 1 22 SER n 1 23 PHE n 1 24 LEU n 1 25 GLN n 1 26 GLY n 1 27 LEU n 1 28 SER n 1 29 SER n 1 30 MET n 1 31 PRO n 1 32 GLY n 1 33 PHE n 1 34 THR n 1 35 ALA n 1 36 SER n 1 37 GLN n 1 38 LEU n 1 39 ASP n 1 40 ASP n 1 41 LEU n 1 42 SER n 1 43 THR n 1 44 ILE n 1 45 ALA n 1 46 GLN n 1 47 SER n 1 48 LEU n 1 49 VAL n 1 50 GLN n 1 51 SER n 1 52 ILE n 1 53 GLN n 1 54 SER n 1 55 LEU n 1 56 ALA n 1 57 ALA n 1 58 GLN n 1 59 GLY n 1 60 ARG n 1 61 THR n 1 62 SER n 1 63 PRO n 1 64 ASN n 1 65 LYS n 1 66 LEU n 1 67 GLN n 1 68 ALA n 1 69 LEU n 1 70 ASN n 1 71 MET n 1 72 ALA n 1 73 PHE n 1 74 ALA n 1 75 SER n 1 76 SER n 1 77 LEU n 1 78 ALA n 1 79 GLU n 1 80 ILE n 1 81 ALA n 1 82 ALA n 1 83 SER n 1 84 GLU n 1 85 GLU n 1 86 GLY n 1 87 GLY n 1 88 GLY n 1 89 SER n 1 90 LEU n 1 91 SER n 1 92 THR n 1 93 LYS n 1 94 THR n 1 95 SER n 1 96 SER n 1 97 ILE n 1 98 ALA n 1 99 SER n 1 100 ALA n 1 101 LEU n 1 102 SER n 1 103 ASN n 1 104 ALA n 1 105 PHE n 1 106 LEU n 1 107 GLN n 1 108 THR n 1 109 THR n 1 110 GLY n 1 111 VAL n 1 112 VAL n 1 113 ASN n 1 114 GLN n 1 115 PRO n 1 116 PHE n 1 117 ILE n 1 118 ASN n 1 119 GLU n 1 120 ILE n 1 121 THR n 1 122 GLN n 1 123 LEU n 1 124 VAL n 1 125 SER n 1 126 MET n 1 127 PHE n 1 128 ALA n 1 129 GLN n 1 130 ALA n 1 131 GLY n 1 132 MET n 1 133 ASN n 1 134 ASP n 1 135 VAL n 1 136 SER n 1 137 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 137 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MaSp1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Euprosthenops australis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 332052 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'C41 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pRSET A' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q05H60_9ARAC _struct_ref.pdbx_db_accession Q05H60 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASE EGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDV ; _struct_ref.pdbx_align_begin 24 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6QJY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 135 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q05H60 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 154 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 135 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6QJY GLY A 1 ? UNP Q05H60 ? ? 'expression tag' 1 1 1 6QJY SER A 2 ? UNP Q05H60 ? ? 'expression tag' 2 2 1 6QJY GLY A 3 ? UNP Q05H60 ? ? 'expression tag' 3 3 1 6QJY ASN A 4 ? UNP Q05H60 ? ? 'expression tag' 4 4 1 6QJY LEU A 20 ? UNP Q05H60 MET 39 'engineered mutation' 20 5 1 6QJY LEU A 24 ? UNP Q05H60 MET 43 'engineered mutation' 24 6 1 6QJY LEU A 41 ? UNP Q05H60 MET 60 'engineered mutation' 41 7 1 6QJY LEU A 48 ? UNP Q05H60 MET 67 'engineered mutation' 48 8 1 6QJY LEU A 77 ? UNP Q05H60 MET 96 'engineered mutation' 77 9 1 6QJY LEU A 101 ? UNP Q05H60 MET 120 'engineered mutation' 101 10 1 6QJY SER A 136 ? UNP Q05H60 ? ? 'expression tag' 136 11 1 6QJY ALA A 137 ? UNP Q05H60 ? ? 'expression tag' 137 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 13C(ali)-NOESY-HSQC' 1 isotropic 10 1 1 '2D 13C HSQC' 1 isotropic 2 1 1 '3D 15N-NOESY-HSQC' 2 isotropic 11 1 1 '2D 15N HSQC' 2 isotropic 3 1 1 '3D HNCAO' 2 isotropic 4 1 1 '3D HNCO' 2 isotropic 5 1 1 '3D HNCA' 2 isotropic 9 1 1 '3D HNCACB' 2 isotropic 8 1 1 '3D CBCA(CO)NH' 2 isotropic 7 1 1 '3D HBHA(CO)NH' 2 isotropic 6 1 1 '3D H(CCO)NH' 2 isotropic 13 1 1 '3D H(CCO)NH' 2 isotropic 12 1 1 '3D HCCH-TOCSY' 2 isotropic 14 1 1 '3D HCCH-TOCSY' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '300 uM [U-13C; U-15N] MaSp1 L6-NTD, 50 mM potassium phosphate, 200 mM sodium chloride, 100 uM DSS, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 13C,15N_L6-NTD _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 800 ? 2 AVANCE ? Bruker 600 ? # _pdbx_nmr_refine.entry_id 6QJY _pdbx_nmr_refine.method 'TORSION ANGLE DYNAMICS ONFORMERS, NUMBER CALCULATED : NULL' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 6QJY _pdbx_nmr_details.text NULL # _pdbx_nmr_ensemble.entry_id 6QJY _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria '20 structures for lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6QJY _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement OPAL 2.4.2 'Luginbuhl, Guntert, Billeter and Wuthrich' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'peak picking' CARA ? 'Keller and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6QJY _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6QJY _struct.title 'Solution NMR structure of a mutant major ampullate spidroin 1 N-terminal domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6QJY _struct_keywords.text 'spider silk hydrophobic core methionine, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 12 ? SER A 29 ? ASN A 12 SER A 29 1 ? 18 HELX_P HELX_P2 AA2 THR A 34 ? ALA A 57 ? THR A 34 ALA A 57 1 ? 24 HELX_P HELX_P3 AA3 SER A 62 ? SER A 83 ? SER A 62 SER A 83 1 ? 22 HELX_P HELX_P4 AA4 SER A 89 ? THR A 109 ? SER A 89 THR A 109 1 ? 21 HELX_P HELX_P5 AA5 ASN A 113 ? ALA A 130 ? ASN A 113 ALA A 130 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 6QJY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 TRP 10 10 10 TRP TRP A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 MET 126 126 126 MET MET A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 MET 132 132 132 MET MET A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ALA 137 137 137 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8310 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-09-11 2 'Structure model' 1 1 2019-10-09 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' database_2 3 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.year' 7 3 'Structure model' '_database_2.pdbx_DOI' 8 3 'Structure model' '_database_2.pdbx_database_accession' 9 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'MaSp1 L6-NTD' 300 ? uM '[U-13C; U-15N]' 1 'potassium phosphate' 50 ? mM 'natural abundance' 1 'sodium chloride' 200 ? mM 'natural abundance' 1 DSS 100 ? uM 'natural abundance' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 14 _pdbx_validate_close_contact.auth_atom_id_1 OE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 85 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HG _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 89 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.58 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 11 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 60 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 60 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 60 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 116.84 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.46 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 4 ? ? 59.93 2.46 2 2 ASN A 4 ? ? -67.96 29.98 3 2 HIS A 6 ? ? 39.71 63.44 4 2 ALA A 130 ? ? -167.94 102.44 5 3 ASN A 4 ? ? 55.04 0.71 6 5 SER A 2 ? ? 59.85 -10.00 7 5 ASN A 4 ? ? -152.80 -54.89 8 5 GLU A 85 ? ? 74.15 -40.08 9 5 ALA A 130 ? ? 65.68 -21.48 10 5 MET A 132 ? ? -99.24 -90.45 11 6 ALA A 130 ? ? 54.34 16.36 12 8 MET A 132 ? ? 39.53 18.91 13 9 GLU A 85 ? ? -52.97 108.82 14 9 ALA A 130 ? ? 49.68 -0.79 15 10 ASN A 4 ? ? 56.73 9.47 16 10 MET A 132 ? ? 24.66 57.11 17 11 SER A 83 ? ? -80.43 -150.10 18 11 GLU A 84 ? ? -76.05 -161.95 19 11 ALA A 130 ? ? 66.65 -3.71 20 11 ASP A 134 ? ? -52.71 100.03 21 12 HIS A 6 ? ? -58.70 92.18 22 12 GLU A 84 ? ? 28.90 60.63 23 13 HIS A 6 ? ? 42.99 12.01 24 14 ASN A 4 ? ? -129.80 -63.00 25 14 GLU A 85 ? ? -54.01 105.77 26 14 ALA A 130 ? ? 59.77 7.18 27 15 ASN A 4 ? ? -142.90 -47.25 28 15 ALA A 130 ? ? 45.43 70.53 29 15 MET A 132 ? ? 35.32 51.53 30 17 SER A 2 ? ? 50.88 18.91 31 17 ASN A 133 ? ? -127.02 -167.22 32 18 ALA A 130 ? ? 56.40 13.94 33 19 THR A 108 ? ? -99.66 -60.59 34 19 ALA A 130 ? ? 65.92 -0.39 35 20 ASN A 4 ? ? -135.95 -45.58 36 20 HIS A 6 ? ? 24.00 81.91 37 20 ARG A 60 ? ? -77.35 24.44 38 20 THR A 61 ? ? -65.29 86.17 39 20 ASN A 133 ? ? 58.45 14.43 40 20 SER A 136 ? ? -125.03 -72.29 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal ? 'United States' ? 1 ? Germany ? 2 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details 'Size exclusion chromatography and multi-angle light scattering (SEC-MALS)' #