data_6QS0 # _entry.id 6QS0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6QS0 pdb_00006qs0 10.2210/pdb6qs0/pdb WWPDB D_1292100450 ? ? BMRB 34361 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of BB_A03, Borrelia burgdorferi outer surface lipoprotein' _pdbx_database_related.db_id 34361 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6QS0 _pdbx_database_status.recvd_initial_deposition_date 2019-02-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fridmanis, J.' 1 0000-0002-0116-5208 'Brangulis, K.' 2 0000-0003-0757-7462 'Jaudzems, K.' 3 0000-0003-3922-2447 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Pathogens _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2076-0817 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural and Functional Analysis of BBA03, Borrelia burgdorferi Competitive Advantage Promoting Outer Surface Lipoprotein.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/pathogens9100826 _citation.pdbx_database_id_PubMed 33050189 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fridmanis, J.' 1 ? primary 'Bobrovs, R.' 2 0000-0002-0221-8658 primary 'Brangulis, K.' 3 ? primary 'Tars, K.' 4 ? primary 'Jaudzems, K.' 5 0000-0003-3922-2447 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6QS0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6QS0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Putative outer membrane protein BBA03' _entity.formula_weight 13746.589 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMGTPLEKLVSRLNLNNTEKETLTFLTNLLKEKLVDPNIGLHFKNSGGDESKIEESVQKFLSELKEDEIKDLLAKIKEN KDKKEKDPEELNTYKSILASGFDGIFNQADSKTTLNKLKDTI ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMGTPLEKLVSRLNLNNTEKETLTFLTNLLKEKLVDPNIGLHFKNSGGDESKIEESVQKFLSELKEDEIKDLLAKIKEN KDKKEKDPEELNTYKSILASGFDGIFNQADSKTTLNKLKDTI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 THR n 1 6 PRO n 1 7 LEU n 1 8 GLU n 1 9 LYS n 1 10 LEU n 1 11 VAL n 1 12 SER n 1 13 ARG n 1 14 LEU n 1 15 ASN n 1 16 LEU n 1 17 ASN n 1 18 ASN n 1 19 THR n 1 20 GLU n 1 21 LYS n 1 22 GLU n 1 23 THR n 1 24 LEU n 1 25 THR n 1 26 PHE n 1 27 LEU n 1 28 THR n 1 29 ASN n 1 30 LEU n 1 31 LEU n 1 32 LYS n 1 33 GLU n 1 34 LYS n 1 35 LEU n 1 36 VAL n 1 37 ASP n 1 38 PRO n 1 39 ASN n 1 40 ILE n 1 41 GLY n 1 42 LEU n 1 43 HIS n 1 44 PHE n 1 45 LYS n 1 46 ASN n 1 47 SER n 1 48 GLY n 1 49 GLY n 1 50 ASP n 1 51 GLU n 1 52 SER n 1 53 LYS n 1 54 ILE n 1 55 GLU n 1 56 GLU n 1 57 SER n 1 58 VAL n 1 59 GLN n 1 60 LYS n 1 61 PHE n 1 62 LEU n 1 63 SER n 1 64 GLU n 1 65 LEU n 1 66 LYS n 1 67 GLU n 1 68 ASP n 1 69 GLU n 1 70 ILE n 1 71 LYS n 1 72 ASP n 1 73 LEU n 1 74 LEU n 1 75 ALA n 1 76 LYS n 1 77 ILE n 1 78 LYS n 1 79 GLU n 1 80 ASN n 1 81 LYS n 1 82 ASP n 1 83 LYS n 1 84 LYS n 1 85 GLU n 1 86 LYS n 1 87 ASP n 1 88 PRO n 1 89 GLU n 1 90 GLU n 1 91 LEU n 1 92 ASN n 1 93 THR n 1 94 TYR n 1 95 LYS n 1 96 SER n 1 97 ILE n 1 98 LEU n 1 99 ALA n 1 100 SER n 1 101 GLY n 1 102 PHE n 1 103 ASP n 1 104 GLY n 1 105 ILE n 1 106 PHE n 1 107 ASN n 1 108 GLN n 1 109 ALA n 1 110 ASP n 1 111 SER n 1 112 LYS n 1 113 THR n 1 114 THR n 1 115 LEU n 1 116 ASN n 1 117 LYS n 1 118 LEU n 1 119 LYS n 1 120 ASP n 1 121 THR n 1 122 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 122 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BB_A03 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Borreliella burgdorferi B31' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224326 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y2503_BORBU _struct_ref.pdbx_db_accession Q44849 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TPLEKLVSRLNLNNTEKETLTFLTNLLKEKLVDPNIGLHFKNSGGDESKIEESVQKFLSELKEDEIKDLLAKIKENKDKK EKDPEELNTYKSILASGFDGIFNQADSKTTLNKLKDTI ; _struct_ref.pdbx_align_begin 52 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6QS0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 122 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q44849 _struct_ref_seq.db_align_beg 52 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 169 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 122 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6QS0 GLY A 1 ? UNP Q44849 ? ? 'expression tag' 1 1 1 6QS0 ALA A 2 ? UNP Q44849 ? ? 'expression tag' 2 2 1 6QS0 MET A 3 ? UNP Q44849 ? ? 'expression tag' 3 3 1 6QS0 GLY A 4 ? UNP Q44849 ? ? 'expression tag' 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-15N NOESY' 1 isotropic 2 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 3 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HNCA' 1 isotropic 6 1 1 '3D CBCA(CO)NH' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.08 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 0.01 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label Standard _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err 0.1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20 mM sodium phosphate, 50 mM sodium chloride, 0.03 % w/v sodium azide, 1 mM EDTA, 2 mM [U-13C; U-15N] BB_A03, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label BB_A03_C13_N15 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model UNITY _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6QS0 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6QS0 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6QS0 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 2 refinement CNS 1.2 'Brunger, Adams, Clore, Gros, Nilges and Read' 3 'structure calculation' CANDID 2.02 'Herrmann, Guntert and Wuthrich' 4 'chemical shift assignment' CARA 1.8.4 'Keller and Wuthrich' 5 'peak picking' CARA 1.8.4 'Keller and Wuthrich' 6 collection TopSpin 3.5 'Bruker Biospin' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6QS0 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6QS0 _struct.title 'NMR structure of BB_A03, Borrelia burgdorferi outer surface lipoprotein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6QS0 _struct_keywords.text 'Lipoprotein, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 6 ? ASN A 15 ? PRO A 6 ASN A 15 1 ? 10 HELX_P HELX_P2 AA2 ASN A 17 ? LEU A 35 ? ASN A 17 LEU A 35 1 ? 19 HELX_P HELX_P3 AA3 GLY A 41 ? GLY A 48 ? GLY A 41 GLY A 48 1 ? 8 HELX_P HELX_P4 AA4 ASP A 50 ? GLU A 64 ? ASP A 50 GLU A 64 1 ? 15 HELX_P HELX_P5 AA5 LYS A 66 ? GLU A 85 ? LYS A 66 GLU A 85 1 ? 20 HELX_P HELX_P6 AA6 ASP A 87 ? ASP A 103 ? ASP A 87 ASP A 103 1 ? 17 HELX_P HELX_P7 AA7 GLY A 104 ? GLN A 108 ? GLY A 104 GLN A 108 5 ? 5 HELX_P HELX_P8 AA8 ASP A 110 ? ASP A 120 ? ASP A 110 ASP A 120 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 6QS0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 6QS0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ASP 120 120 120 ASP ASP A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 ILE 122 122 122 ILE ILE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6690 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-03-18 2 'Structure model' 1 1 2021-02-17 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_database_2.pdbx_DOI' 10 3 'Structure model' '_database_2.pdbx_database_accession' 11 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'sodium chloride' 50 ? mM 'natural abundance' 1 'sodium azide' 0.03 ? '% w/v' 'natural abundance' 1 EDTA 1 ? mM 'natural abundance' 1 BB_A03 2 ? mM '[U-13C; U-15N]' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ2 A LYS 78 ? ? OD1 A ASP 82 ? ? 1.57 2 1 HZ2 A LYS 81 ? ? OE2 A GLU 85 ? ? 1.59 3 1 OD1 A ASP 72 ? ? HZ1 A LYS 119 ? ? 1.60 4 2 OE1 A GLU 64 ? ? HG A SER 111 ? ? 1.58 5 2 OD2 A ASP 72 ? ? HZ2 A LYS 119 ? ? 1.59 6 2 HZ2 A LYS 32 ? ? OE2 A GLU 55 ? ? 1.59 7 3 HZ1 A LYS 60 ? ? OE1 A GLU 64 ? ? 1.58 8 3 OD2 A ASP 50 ? ? HG A SER 52 ? ? 1.58 9 7 HG1 A THR 5 ? ? OE1 A GLU 8 ? ? 1.59 10 7 HZ1 A LYS 81 ? ? OE1 A GLU 85 ? ? 1.59 11 8 HZ2 A LYS 32 ? ? OE1 A GLU 55 ? ? 1.59 12 9 OE1 A GLU 69 ? ? HZ2 A LYS 112 ? ? 1.59 13 10 HZ3 A LYS 81 ? ? OE2 A GLU 85 ? ? 1.57 14 10 OE2 A GLU 33 ? ? HZ1 A LYS 34 ? ? 1.59 15 10 HZ2 A LYS 60 ? ? OE1 A GLU 64 ? ? 1.59 16 10 HZ3 A LYS 32 ? ? OE2 A GLU 55 ? ? 1.60 17 11 HZ2 A LYS 81 ? ? OE2 A GLU 85 ? ? 1.58 18 11 OE1 A GLU 33 ? ? HZ3 A LYS 34 ? ? 1.58 19 13 HZ1 A LYS 32 ? ? OE1 A GLU 55 ? ? 1.57 20 14 HZ3 A LYS 60 ? ? OE1 A GLU 64 ? ? 1.57 21 14 OD2 A ASP 50 ? ? HG A SER 52 ? ? 1.59 22 15 OE1 A GLU 67 ? ? HZ2 A LYS 71 ? ? 1.53 23 15 HZ3 A LYS 78 ? ? OD2 A ASP 82 ? ? 1.58 24 16 OD1 A ASP 72 ? ? HZ1 A LYS 119 ? ? 1.57 25 17 OD1 A ASP 50 ? ? HG A SER 52 ? ? 1.57 26 17 HZ3 A LYS 81 ? ? OE1 A GLU 85 ? ? 1.57 27 17 OE1 A GLU 33 ? ? HZ2 A LYS 34 ? ? 1.60 28 18 HZ1 A LYS 60 ? ? OE1 A GLU 64 ? ? 1.59 29 19 OE2 A GLU 69 ? ? HZ1 A LYS 112 ? ? 1.55 30 19 OD2 A ASP 72 ? ? HZ1 A LYS 119 ? ? 1.58 31 19 OE1 A GLU 64 ? ? HG A SER 111 ? ? 1.59 32 19 HZ2 A LYS 81 ? ? OE2 A GLU 85 ? ? 1.59 33 20 HZ1 A LYS 81 ? ? OE1 A GLU 85 ? ? 1.55 34 20 HZ2 A LYS 32 ? ? OE2 A GLU 55 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 3 ? ? -174.15 140.88 2 1 THR A 5 ? ? 43.25 78.72 3 1 ASN A 15 ? ? 56.23 75.47 4 2 ALA A 2 ? ? -64.64 99.76 5 2 MET A 3 ? ? 175.54 -32.54 6 2 THR A 5 ? ? 51.68 80.65 7 2 GLN A 108 ? ? 73.87 31.64 8 3 ASN A 15 ? ? 64.59 71.43 9 4 THR A 5 ? ? 43.75 75.31 10 5 THR A 5 ? ? -39.37 108.15 11 5 ASN A 15 ? ? 41.29 79.87 12 6 THR A 5 ? ? -43.18 103.73 13 6 ASN A 15 ? ? 63.26 94.76 14 7 THR A 5 ? ? -49.23 107.31 15 7 ASN A 15 ? ? 62.32 79.44 16 7 ASN A 107 ? ? -117.89 51.34 17 8 MET A 3 ? ? -169.76 -58.39 18 8 ASN A 15 ? ? 62.17 78.06 19 8 ASP A 120 ? ? -99.70 52.60 20 9 ASN A 15 ? ? 64.91 65.60 21 9 THR A 121 ? ? -76.51 -82.66 22 10 THR A 5 ? ? -41.00 100.46 23 10 ASN A 15 ? ? 55.68 75.33 24 11 ASN A 15 ? ? 67.52 82.73 25 12 THR A 5 ? ? 40.40 77.32 26 12 ASN A 15 ? ? 64.12 80.25 27 13 MET A 3 ? ? 64.97 -76.76 28 13 ASN A 15 ? ? 55.94 75.81 29 14 ASN A 15 ? ? 62.51 86.86 30 14 THR A 121 ? ? -62.03 -79.15 31 15 THR A 5 ? ? 46.65 76.38 32 15 ASN A 15 ? ? 57.57 84.51 33 15 ASN A 107 ? ? -102.70 44.98 34 16 THR A 5 ? ? -44.55 102.78 35 17 THR A 5 ? ? -52.77 109.00 36 17 ASN A 15 ? ? 60.41 74.85 37 18 THR A 5 ? ? 41.12 88.76 38 18 ASN A 15 ? ? 64.34 103.77 39 18 THR A 121 ? ? -77.64 -77.30 40 19 THR A 5 ? ? 46.73 78.53 41 19 SER A 47 ? ? -152.43 19.31 42 19 GLN A 108 ? ? 70.01 33.46 43 19 THR A 121 ? ? -76.61 -81.41 44 20 ASP A 120 ? ? -89.35 36.83 45 20 THR A 121 ? ? -89.87 -75.16 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #