data_6QUR # _entry.id 6QUR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.315 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6QUR WWPDB D_1292100901 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6QUR _pdbx_database_status.recvd_initial_deposition_date 2019-02-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Semmelmann, F.' 1 ? 'Straub, K.' 2 ? 'Rajendran, C.' 3 ? 'Nazet, J.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 431 _citation.language ? _citation.page_first 2718 _citation.page_last 2728 _citation.title 'Mapping the Allosteric Communication Network of Aminodeoxychorismate Synthase.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2019.05.021 _citation.pdbx_database_id_PubMed 31121180 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Semmelmann, F.' 1 ? primary 'Straub, K.' 2 ? primary 'Nazet, J.' 3 ? primary 'Rajendran, C.' 4 ? primary 'Merkl, R.' 5 ? primary 'Sterner, R.' 6 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6QUR _cell.details ? _cell.formula_units_Z ? _cell.length_a 47.755 _cell.length_a_esd ? _cell.length_b 58.390 _cell.length_b_esd ? _cell.length_c 71.583 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6QUR _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Glutaminase 22321.461 1 ? ? ? ? 2 water nat water 18.015 113 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MILMIDNYDSFTYNLVQYLGELGEEVVVYRNDEITIAEIEKLKPDHLVISPGPCTPNEAGISLEVIKHFAGKIPILGVCL GHQSIGQAFGGKIVRAKQVMHGKTSEIYHNNKGVFKGLNNPFEATRYHSLVVERETLPDCLEITAWTETDEGEIMGIRHK TLPIEGVQFHPESILTEQGHELLKNFLKELEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MILMIDNYDSFTYNLVQYLGELGEEVVVYRNDEITIAEIEKLKPDHLVISPGPCTPNEAGISLEVIKHFAGKIPILGVCL GHQSIGQAFGGKIVRAKQVMHGKTSEIYHNNKGVFKGLNNPFEATRYHSLVVERETLPDCLEITAWTETDEGEIMGIRHK TLPIEGVQFHPESILTEQGHELLKNFLKELEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 LEU n 1 4 MET n 1 5 ILE n 1 6 ASP n 1 7 ASN n 1 8 TYR n 1 9 ASP n 1 10 SER n 1 11 PHE n 1 12 THR n 1 13 TYR n 1 14 ASN n 1 15 LEU n 1 16 VAL n 1 17 GLN n 1 18 TYR n 1 19 LEU n 1 20 GLY n 1 21 GLU n 1 22 LEU n 1 23 GLY n 1 24 GLU n 1 25 GLU n 1 26 VAL n 1 27 VAL n 1 28 VAL n 1 29 TYR n 1 30 ARG n 1 31 ASN n 1 32 ASP n 1 33 GLU n 1 34 ILE n 1 35 THR n 1 36 ILE n 1 37 ALA n 1 38 GLU n 1 39 ILE n 1 40 GLU n 1 41 LYS n 1 42 LEU n 1 43 LYS n 1 44 PRO n 1 45 ASP n 1 46 HIS n 1 47 LEU n 1 48 VAL n 1 49 ILE n 1 50 SER n 1 51 PRO n 1 52 GLY n 1 53 PRO n 1 54 CYS n 1 55 THR n 1 56 PRO n 1 57 ASN n 1 58 GLU n 1 59 ALA n 1 60 GLY n 1 61 ILE n 1 62 SER n 1 63 LEU n 1 64 GLU n 1 65 VAL n 1 66 ILE n 1 67 LYS n 1 68 HIS n 1 69 PHE n 1 70 ALA n 1 71 GLY n 1 72 LYS n 1 73 ILE n 1 74 PRO n 1 75 ILE n 1 76 LEU n 1 77 GLY n 1 78 VAL n 1 79 CYS n 1 80 LEU n 1 81 GLY n 1 82 HIS n 1 83 GLN n 1 84 SER n 1 85 ILE n 1 86 GLY n 1 87 GLN n 1 88 ALA n 1 89 PHE n 1 90 GLY n 1 91 GLY n 1 92 LYS n 1 93 ILE n 1 94 VAL n 1 95 ARG n 1 96 ALA n 1 97 LYS n 1 98 GLN n 1 99 VAL n 1 100 MET n 1 101 HIS n 1 102 GLY n 1 103 LYS n 1 104 THR n 1 105 SER n 1 106 GLU n 1 107 ILE n 1 108 TYR n 1 109 HIS n 1 110 ASN n 1 111 ASN n 1 112 LYS n 1 113 GLY n 1 114 VAL n 1 115 PHE n 1 116 LYS n 1 117 GLY n 1 118 LEU n 1 119 ASN n 1 120 ASN n 1 121 PRO n 1 122 PHE n 1 123 GLU n 1 124 ALA n 1 125 THR n 1 126 ARG n 1 127 TYR n 1 128 HIS n 1 129 SER n 1 130 LEU n 1 131 VAL n 1 132 VAL n 1 133 GLU n 1 134 ARG n 1 135 GLU n 1 136 THR n 1 137 LEU n 1 138 PRO n 1 139 ASP n 1 140 CYS n 1 141 LEU n 1 142 GLU n 1 143 ILE n 1 144 THR n 1 145 ALA n 1 146 TRP n 1 147 THR n 1 148 GLU n 1 149 THR n 1 150 ASP n 1 151 GLU n 1 152 GLY n 1 153 GLU n 1 154 ILE n 1 155 MET n 1 156 GLY n 1 157 ILE n 1 158 ARG n 1 159 HIS n 1 160 LYS n 1 161 THR n 1 162 LEU n 1 163 PRO n 1 164 ILE n 1 165 GLU n 1 166 GLY n 1 167 VAL n 1 168 GLN n 1 169 PHE n 1 170 HIS n 1 171 PRO n 1 172 GLU n 1 173 SER n 1 174 ILE n 1 175 LEU n 1 176 THR n 1 177 GLU n 1 178 GLN n 1 179 GLY n 1 180 HIS n 1 181 GLU n 1 182 LEU n 1 183 LEU n 1 184 LYS n 1 185 ASN n 1 186 PHE n 1 187 LEU n 1 188 LYS n 1 189 GLU n 1 190 LEU n 1 191 GLU n 1 192 HIS n 1 193 HIS n 1 194 HIS n 1 195 HIS n 1 196 HIS n 1 197 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 197 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6QUR _struct_ref.pdbx_db_accession 6QUR _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6QUR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 197 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6QUR _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 197 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 197 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6QUR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.24 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.98 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details PEG _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-07-24 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06DA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06DA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 33.96 _reflns.entry_id 6QUR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.792 _reflns.d_resolution_low 39.73 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19372 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.87 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.0 _reflns.pdbx_Rmerge_I_obs 0.06472 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.52 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.06743 _reflns.pdbx_Rpim_I_all 0.01866 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.00 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.79 _reflns_shell.d_res_low 1.856 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.27 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1880 _reflns_shell.percent_possible_all 99.16 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.935 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 11.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.023 _reflns_shell.pdbx_Rpim_I_all 0.5803 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.866 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6QUR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.792 _refine.ls_d_res_low 39.73 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19366 _refine.ls_number_reflns_R_free 969 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.88 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2173 _refine.ls_R_factor_R_free 0.2671 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2147 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.89 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.25 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1519 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 113 _refine_hist.number_atoms_total 1632 _refine_hist.d_res_high 1.792 _refine_hist.d_res_low 39.73 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1554 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.886 ? 2105 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 3.084 ? 926 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.058 ? 237 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 271 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.7923 1.8868 . . 136 2579 99.00 . . . 0.3533 . 0.3197 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8868 2.0050 . . 135 2567 100.00 . . . 0.3205 . 0.2699 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0050 2.1598 . . 136 2593 100.00 . . . 0.2884 . 0.2411 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1598 2.3771 . . 138 2604 100.00 . . . 0.2719 . 0.2462 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3771 2.7211 . . 138 2611 100.00 . . . 0.2803 . 0.2436 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7211 3.4281 . . 140 2670 100.00 . . . 0.3163 . 0.2239 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4281 45.2608 . . 146 2773 100.00 . . . 0.2237 . 0.1807 . . . . . . . . . . # _struct.entry_id 6QUR _struct.title 'Mapping the allosteric communication network of aminodeoxychorismate synthase' _struct.pdbx_descriptor Glutaminase _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6QUR _struct_keywords.text 'allostery, ancestral sequence reconstruction, catalytic triad, glutamine amidotransferases, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 11 ? LEU A 22 ? PHE A 11 LEU A 22 1 ? 12 HELX_P HELX_P2 AA2 ASP A 32 ? ILE A 34 ? ASP A 32 ILE A 34 5 ? 3 HELX_P HELX_P3 AA3 THR A 35 ? LYS A 43 ? THR A 35 LYS A 43 1 ? 9 HELX_P HELX_P4 AA4 SER A 62 ? ALA A 70 ? SER A 62 ALA A 70 1 ? 9 HELX_P HELX_P5 AA5 LEU A 80 ? PHE A 89 ? LEU A 80 PHE A 89 1 ? 10 HELX_P HELX_P6 AA6 LYS A 112 ? LYS A 116 ? LYS A 112 LYS A 116 5 ? 5 HELX_P HELX_P7 AA7 HIS A 170 ? LEU A 175 ? HIS A 170 LEU A 175 5 ? 6 HELX_P HELX_P8 AA8 THR A 176 ? GLU A 189 ? THR A 176 GLU A 189 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 54 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 79 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 54 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 79 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.050 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 52 A . ? GLY 52 A PRO 53 A ? PRO 53 A 1 2.30 2 ASN 120 A . ? ASN 120 A PRO 121 A ? PRO 121 A 1 5.37 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 9 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 26 ? ARG A 30 ? VAL A 26 ARG A 30 AA1 2 ILE A 2 ? ASP A 6 ? ILE A 2 ASP A 6 AA1 3 HIS A 46 ? ILE A 49 ? HIS A 46 ILE A 49 AA1 4 ILE A 75 ? GLY A 77 ? ILE A 75 GLY A 77 AA1 5 ILE A 164 ? VAL A 167 ? ILE A 164 VAL A 167 AA1 6 ILE A 154 ? HIS A 159 ? ILE A 154 HIS A 159 AA1 7 LEU A 141 ? TRP A 146 ? LEU A 141 TRP A 146 AA1 8 THR A 104 ? HIS A 109 ? THR A 104 HIS A 109 AA1 9 PHE A 122 ? THR A 125 ? PHE A 122 THR A 125 AA2 1 ILE A 93 ? VAL A 94 ? ILE A 93 VAL A 94 AA2 2 VAL A 131 ? VAL A 132 ? VAL A 131 VAL A 132 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 27 ? O VAL A 27 N MET A 4 ? N MET A 4 AA1 2 3 N ILE A 5 ? N ILE A 5 O VAL A 48 ? O VAL A 48 AA1 3 4 N ILE A 49 ? N ILE A 49 O LEU A 76 ? O LEU A 76 AA1 4 5 N GLY A 77 ? N GLY A 77 O GLU A 165 ? O GLU A 165 AA1 5 6 O GLY A 166 ? O GLY A 166 N ILE A 157 ? N ILE A 157 AA1 6 7 O MET A 155 ? O MET A 155 N ALA A 145 ? N ALA A 145 AA1 7 8 O TRP A 146 ? O TRP A 146 N TYR A 108 ? N TYR A 108 AA1 8 9 N ILE A 107 ? N ILE A 107 O PHE A 122 ? O PHE A 122 AA2 1 2 N VAL A 94 ? N VAL A 94 O VAL A 131 ? O VAL A 131 # _atom_sites.entry_id 6QUR _atom_sites.fract_transf_matrix[1][1] 0.020940 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017126 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013970 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 CYS 140 140 140 CYS CYS A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 TRP 146 146 146 TRP TRP A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 MET 155 155 155 MET MET A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 ILE 157 157 157 ILE ILE A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 HIS 159 159 159 HIS HIS A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 GLU 165 165 165 GLU GLU A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 GLN 168 168 168 GLN GLN A . n A 1 169 PHE 169 169 169 PHE PHE A . n A 1 170 HIS 170 170 170 HIS HIS A . n A 1 171 PRO 171 171 171 PRO PRO A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 SER 173 173 173 SER SER A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 GLN 178 178 178 GLN GLN A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 HIS 180 180 180 HIS HIS A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 ASN 185 185 185 ASN ASN A . n A 1 186 PHE 186 186 186 PHE PHE A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 LYS 188 188 188 LYS LYS A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 GLU 191 191 191 GLU GLU A . n A 1 192 HIS 192 192 192 HIS HIS A . n A 1 193 HIS 193 193 193 HIS HIS A . n A 1 194 HIS 194 194 ? ? ? A . n A 1 195 HIS 195 195 ? ? ? A . n A 1 196 HIS 196 196 ? ? ? A . n A 1 197 HIS 197 197 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 70 HOH HOH A . B 2 HOH 2 202 79 HOH HOH A . B 2 HOH 3 203 91 HOH HOH A . B 2 HOH 4 204 55 HOH HOH A . B 2 HOH 5 205 136 HOH HOH A . B 2 HOH 6 206 69 HOH HOH A . B 2 HOH 7 207 26 HOH HOH A . B 2 HOH 8 208 89 HOH HOH A . B 2 HOH 9 209 56 HOH HOH A . B 2 HOH 10 210 5 HOH HOH A . B 2 HOH 11 211 1 HOH HOH A . B 2 HOH 12 212 105 HOH HOH A . B 2 HOH 13 213 48 HOH HOH A . B 2 HOH 14 214 32 HOH HOH A . B 2 HOH 15 215 64 HOH HOH A . B 2 HOH 16 216 74 HOH HOH A . B 2 HOH 17 217 94 HOH HOH A . B 2 HOH 18 218 66 HOH HOH A . B 2 HOH 19 219 12 HOH HOH A . B 2 HOH 20 220 33 HOH HOH A . B 2 HOH 21 221 3 HOH HOH A . B 2 HOH 22 222 61 HOH HOH A . B 2 HOH 23 223 8 HOH HOH A . B 2 HOH 24 224 11 HOH HOH A . B 2 HOH 25 225 36 HOH HOH A . B 2 HOH 26 226 92 HOH HOH A . B 2 HOH 27 227 27 HOH HOH A . B 2 HOH 28 228 20 HOH HOH A . B 2 HOH 29 229 16 HOH HOH A . B 2 HOH 30 230 110 HOH HOH A . B 2 HOH 31 231 24 HOH HOH A . B 2 HOH 32 232 68 HOH HOH A . B 2 HOH 33 233 23 HOH HOH A . B 2 HOH 34 234 108 HOH HOH A . B 2 HOH 35 235 34 HOH HOH A . B 2 HOH 36 236 95 HOH HOH A . B 2 HOH 37 237 19 HOH HOH A . B 2 HOH 38 238 93 HOH HOH A . B 2 HOH 39 239 47 HOH HOH A . B 2 HOH 40 240 4 HOH HOH A . B 2 HOH 41 241 38 HOH HOH A . B 2 HOH 42 242 18 HOH HOH A . B 2 HOH 43 243 62 HOH HOH A . B 2 HOH 44 244 72 HOH HOH A . B 2 HOH 45 245 25 HOH HOH A . B 2 HOH 46 246 31 HOH HOH A . B 2 HOH 47 247 117 HOH HOH A . B 2 HOH 48 248 78 HOH HOH A . B 2 HOH 49 249 63 HOH HOH A . B 2 HOH 50 250 81 HOH HOH A . B 2 HOH 51 251 134 HOH HOH A . B 2 HOH 52 252 15 HOH HOH A . B 2 HOH 53 253 82 HOH HOH A . B 2 HOH 54 254 67 HOH HOH A . B 2 HOH 55 255 2 HOH HOH A . B 2 HOH 56 256 103 HOH HOH A . B 2 HOH 57 257 128 HOH HOH A . B 2 HOH 58 258 123 HOH HOH A . B 2 HOH 59 259 121 HOH HOH A . B 2 HOH 60 260 133 HOH HOH A . B 2 HOH 61 261 41 HOH HOH A . B 2 HOH 62 262 50 HOH HOH A . B 2 HOH 63 263 10 HOH HOH A . B 2 HOH 64 264 130 HOH HOH A . B 2 HOH 65 265 132 HOH HOH A . B 2 HOH 66 266 49 HOH HOH A . B 2 HOH 67 267 101 HOH HOH A . B 2 HOH 68 268 80 HOH HOH A . B 2 HOH 69 269 73 HOH HOH A . B 2 HOH 70 270 75 HOH HOH A . B 2 HOH 71 271 35 HOH HOH A . B 2 HOH 72 272 54 HOH HOH A . B 2 HOH 73 273 90 HOH HOH A . B 2 HOH 74 274 127 HOH HOH A . B 2 HOH 75 275 122 HOH HOH A . B 2 HOH 76 276 28 HOH HOH A . B 2 HOH 77 277 52 HOH HOH A . B 2 HOH 78 278 120 HOH HOH A . B 2 HOH 79 279 111 HOH HOH A . B 2 HOH 80 280 39 HOH HOH A . B 2 HOH 81 281 124 HOH HOH A . B 2 HOH 82 282 114 HOH HOH A . B 2 HOH 83 283 53 HOH HOH A . B 2 HOH 84 284 42 HOH HOH A . B 2 HOH 85 285 113 HOH HOH A . B 2 HOH 86 286 77 HOH HOH A . B 2 HOH 87 287 107 HOH HOH A . B 2 HOH 88 288 21 HOH HOH A . B 2 HOH 89 289 17 HOH HOH A . B 2 HOH 90 290 116 HOH HOH A . B 2 HOH 91 291 57 HOH HOH A . B 2 HOH 92 292 126 HOH HOH A . B 2 HOH 93 293 118 HOH HOH A . B 2 HOH 94 294 60 HOH HOH A . B 2 HOH 95 295 71 HOH HOH A . B 2 HOH 96 296 85 HOH HOH A . B 2 HOH 97 297 43 HOH HOH A . B 2 HOH 98 298 29 HOH HOH A . B 2 HOH 99 299 125 HOH HOH A . B 2 HOH 100 300 135 HOH HOH A . B 2 HOH 101 301 96 HOH HOH A . B 2 HOH 102 302 87 HOH HOH A . B 2 HOH 103 303 97 HOH HOH A . B 2 HOH 104 304 76 HOH HOH A . B 2 HOH 105 305 83 HOH HOH A . B 2 HOH 106 306 129 HOH HOH A . B 2 HOH 107 307 46 HOH HOH A . B 2 HOH 108 308 84 HOH HOH A . B 2 HOH 109 309 115 HOH HOH A . B 2 HOH 110 310 88 HOH HOH A . B 2 HOH 111 311 65 HOH HOH A . B 2 HOH 112 312 131 HOH HOH A . B 2 HOH 113 313 109 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 9110 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-06-05 2 'Structure model' 1 1 2019-07-10 3 'Structure model' 1 2 2019-09-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' pdbx_database_proc 3 3 'Structure model' reflns # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_reflns.pdbx_Rrim_I_all' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 172 ? ? O A HOH 201 ? ? 2.10 2 1 O A HOH 262 ? ? O A HOH 287 ? ? 2.10 3 1 O A HOH 294 ? ? O A HOH 305 ? ? 2.16 4 1 O A HOH 286 ? ? O A HOH 298 ? ? 2.18 5 1 O A HOH 206 ? ? O A HOH 303 ? ? 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 79 ? ? 54.15 -131.96 2 1 ASP A 150 ? ? 64.21 -146.59 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 58 ? CG ? A GLU 58 CG 2 1 Y 1 A GLU 58 ? CD ? A GLU 58 CD 3 1 Y 1 A GLU 58 ? OE1 ? A GLU 58 OE1 4 1 Y 1 A GLU 58 ? OE2 ? A GLU 58 OE2 5 1 Y 1 A ASP 150 ? CG ? A ASP 150 CG 6 1 Y 1 A ASP 150 ? OD1 ? A ASP 150 OD1 7 1 Y 1 A ASP 150 ? OD2 ? A ASP 150 OD2 8 1 Y 1 A GLU 191 ? CG ? A GLU 191 CG 9 1 Y 1 A GLU 191 ? CD ? A GLU 191 CD 10 1 Y 1 A GLU 191 ? OE1 ? A GLU 191 OE1 11 1 Y 1 A GLU 191 ? OE2 ? A GLU 191 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 194 ? A HIS 194 2 1 Y 1 A HIS 195 ? A HIS 195 3 1 Y 1 A HIS 196 ? A HIS 196 4 1 Y 1 A HIS 197 ? A HIS 197 # _pdbx_audit_support.funding_organization ? _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #