data_6QYX # _entry.id 6QYX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.330 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6QYX WWPDB D_1292101158 # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'wt protein' _pdbx_database_related.db_id 2NPQ _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6QYX _pdbx_database_status.recvd_initial_deposition_date 2019-03-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Livnah, O.' 1 ? 'Eitan-Wexler, M.' 2 ? 'Vinograd, N.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 295 _citation.language ? _citation.page_first 9409 _citation.page_last 9420 _citation.title ;The bacterial metalloprotease NleD selectively cleaves mitogen-activated protein kinases that have high flexibility in their activation loop. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.RA120.013590 _citation.pdbx_database_id_PubMed 32404367 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gur-Arie, L.' 1 ? primary 'Eitan-Wexler, M.' 2 ? primary 'Weinberger, N.' 3 ? primary 'Rosenshine, I.' 4 ? primary 'Livnah, O.' 5 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6QYX _cell.details ? _cell.formula_units_Z ? _cell.length_a 68.860 _cell.length_a_esd ? _cell.length_b 74.500 _cell.length_b_esd ? _cell.length_c 75.280 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6QYX _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitogen-activated protein kinase 14,Mitogen-activated protein kinase 1,Mitogen-activated protein kinase 14' 41982.875 1 2.7.11.24,2.7.11.24 ? ? ? 2 non-polymer man 'octyl beta-D-glucopyranoside' 292.369 1 ? ? ? ? 3 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' 238.305 1 ? ? ? ? 4 water nat water 18.015 204 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;MAPK 14,Cytokine suppressive anti-inflammatory drug-binding protein,CSBP,MAP kinase MXI2,MAX-interacting protein 2,Mitogen-activated protein kinase p38 alpha,MAP kinase p38 alpha,Stress-activated protein kinase 2a,SAPK2a,MAPK 14,Cytokine suppressive anti-inflammatory drug-binding protein,CSBP,MAP kinase MXI2,MAX-interacting protein 2,Mitogen-activated protein kinase p38 alpha,MAP kinase p38 alpha,Stress-activated protein kinase 2a,SAPK2a ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKH ENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNE DCELKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKL ILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDP DDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ; _entity_poly.pdbx_seq_one_letter_code_can ;MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKH ENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNE DCELKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKL ILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDP DDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLN n 1 4 GLU n 1 5 ARG n 1 6 PRO n 1 7 THR n 1 8 PHE n 1 9 TYR n 1 10 ARG n 1 11 GLN n 1 12 GLU n 1 13 LEU n 1 14 ASN n 1 15 LYS n 1 16 THR n 1 17 ILE n 1 18 TRP n 1 19 GLU n 1 20 VAL n 1 21 PRO n 1 22 GLU n 1 23 ARG n 1 24 TYR n 1 25 GLN n 1 26 ASN n 1 27 LEU n 1 28 SER n 1 29 PRO n 1 30 VAL n 1 31 GLY n 1 32 SER n 1 33 GLY n 1 34 ALA n 1 35 TYR n 1 36 GLY n 1 37 SER n 1 38 VAL n 1 39 CYS n 1 40 ALA n 1 41 ALA n 1 42 PHE n 1 43 ASP n 1 44 THR n 1 45 LYS n 1 46 THR n 1 47 GLY n 1 48 LEU n 1 49 ARG n 1 50 VAL n 1 51 ALA n 1 52 VAL n 1 53 LYS n 1 54 LYS n 1 55 LEU n 1 56 SER n 1 57 ARG n 1 58 PRO n 1 59 PHE n 1 60 GLN n 1 61 SER n 1 62 ILE n 1 63 ILE n 1 64 HIS n 1 65 ALA n 1 66 LYS n 1 67 ARG n 1 68 THR n 1 69 TYR n 1 70 ARG n 1 71 GLU n 1 72 LEU n 1 73 ARG n 1 74 LEU n 1 75 LEU n 1 76 LYS n 1 77 HIS n 1 78 MET n 1 79 LYS n 1 80 HIS n 1 81 GLU n 1 82 ASN n 1 83 VAL n 1 84 ILE n 1 85 GLY n 1 86 LEU n 1 87 LEU n 1 88 ASP n 1 89 VAL n 1 90 PHE n 1 91 THR n 1 92 PRO n 1 93 ALA n 1 94 ARG n 1 95 SER n 1 96 LEU n 1 97 GLU n 1 98 GLU n 1 99 PHE n 1 100 ASN n 1 101 ASP n 1 102 VAL n 1 103 TYR n 1 104 LEU n 1 105 VAL n 1 106 THR n 1 107 HIS n 1 108 LEU n 1 109 MET n 1 110 GLY n 1 111 ALA n 1 112 ASP n 1 113 LEU n 1 114 ASN n 1 115 ASN n 1 116 ILE n 1 117 VAL n 1 118 LYS n 1 119 CYS n 1 120 GLN n 1 121 LYS n 1 122 LEU n 1 123 THR n 1 124 ASP n 1 125 ASP n 1 126 HIS n 1 127 VAL n 1 128 GLN n 1 129 PHE n 1 130 LEU n 1 131 ILE n 1 132 TYR n 1 133 GLN n 1 134 ILE n 1 135 LEU n 1 136 ARG n 1 137 GLY n 1 138 LEU n 1 139 LYS n 1 140 TYR n 1 141 ILE n 1 142 HIS n 1 143 SER n 1 144 ALA n 1 145 ASP n 1 146 ILE n 1 147 ILE n 1 148 HIS n 1 149 ARG n 1 150 ASP n 1 151 LEU n 1 152 LYS n 1 153 PRO n 1 154 SER n 1 155 ASN n 1 156 LEU n 1 157 ALA n 1 158 VAL n 1 159 ASN n 1 160 GLU n 1 161 ASP n 1 162 CYS n 1 163 GLU n 1 164 LEU n 1 165 LYS n 1 166 ILE n 1 167 CYS n 1 168 ASP n 1 169 PHE n 1 170 GLY n 1 171 LEU n 1 172 ALA n 1 173 ARG n 1 174 VAL n 1 175 ALA n 1 176 ASP n 1 177 PRO n 1 178 ASP n 1 179 HIS n 1 180 ASP n 1 181 HIS n 1 182 THR n 1 183 GLY n 1 184 PHE n 1 185 LEU n 1 186 THR n 1 187 GLU n 1 188 TYR n 1 189 VAL n 1 190 ALA n 1 191 THR n 1 192 ARG n 1 193 TRP n 1 194 TYR n 1 195 ARG n 1 196 ALA n 1 197 PRO n 1 198 GLU n 1 199 ILE n 1 200 MET n 1 201 LEU n 1 202 ASN n 1 203 TRP n 1 204 MET n 1 205 HIS n 1 206 TYR n 1 207 ASN n 1 208 GLN n 1 209 THR n 1 210 VAL n 1 211 ASP n 1 212 ILE n 1 213 TRP n 1 214 SER n 1 215 VAL n 1 216 GLY n 1 217 CYS n 1 218 ILE n 1 219 MET n 1 220 ALA n 1 221 GLU n 1 222 LEU n 1 223 LEU n 1 224 THR n 1 225 GLY n 1 226 ARG n 1 227 THR n 1 228 LEU n 1 229 PHE n 1 230 PRO n 1 231 GLY n 1 232 THR n 1 233 ASP n 1 234 HIS n 1 235 ILE n 1 236 ASP n 1 237 GLN n 1 238 LEU n 1 239 LYS n 1 240 LEU n 1 241 ILE n 1 242 LEU n 1 243 ARG n 1 244 LEU n 1 245 VAL n 1 246 GLY n 1 247 THR n 1 248 PRO n 1 249 GLY n 1 250 ALA n 1 251 GLU n 1 252 LEU n 1 253 LEU n 1 254 LYS n 1 255 LYS n 1 256 ILE n 1 257 SER n 1 258 SER n 1 259 GLU n 1 260 SER n 1 261 ALA n 1 262 ARG n 1 263 ASN n 1 264 TYR n 1 265 ILE n 1 266 GLN n 1 267 SER n 1 268 LEU n 1 269 THR n 1 270 GLN n 1 271 MET n 1 272 PRO n 1 273 LYS n 1 274 MET n 1 275 ASN n 1 276 PHE n 1 277 ALA n 1 278 ASN n 1 279 VAL n 1 280 PHE n 1 281 ILE n 1 282 GLY n 1 283 ALA n 1 284 ASN n 1 285 PRO n 1 286 LEU n 1 287 ALA n 1 288 VAL n 1 289 ASP n 1 290 LEU n 1 291 LEU n 1 292 GLU n 1 293 LYS n 1 294 MET n 1 295 LEU n 1 296 VAL n 1 297 LEU n 1 298 ASP n 1 299 SER n 1 300 ASP n 1 301 LYS n 1 302 ARG n 1 303 ILE n 1 304 THR n 1 305 ALA n 1 306 ALA n 1 307 GLN n 1 308 ALA n 1 309 LEU n 1 310 ALA n 1 311 HIS n 1 312 ALA n 1 313 TYR n 1 314 PHE n 1 315 ALA n 1 316 GLN n 1 317 TYR n 1 318 HIS n 1 319 ASP n 1 320 PRO n 1 321 ASP n 1 322 ASP n 1 323 GLU n 1 324 PRO n 1 325 VAL n 1 326 ALA n 1 327 ASP n 1 328 PRO n 1 329 TYR n 1 330 ASP n 1 331 GLN n 1 332 SER n 1 333 PHE n 1 334 GLU n 1 335 SER n 1 336 ARG n 1 337 ASP n 1 338 LEU n 1 339 LEU n 1 340 ILE n 1 341 ASP n 1 342 GLU n 1 343 TRP n 1 344 LYS n 1 345 SER n 1 346 LEU n 1 347 THR n 1 348 TYR n 1 349 ASP n 1 350 GLU n 1 351 VAL n 1 352 ILE n 1 353 SER n 1 354 PHE n 1 355 VAL n 1 356 PRO n 1 357 PRO n 1 358 PRO n 1 359 LEU n 1 360 ASP n 1 361 GLN n 1 362 GLU n 1 363 GLU n 1 364 MET n 1 365 GLU n 1 366 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 172 Human ? 'MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 173 189 'Suminoe oyster' ? ? ? ? ? ? ? ? 'Crassostrea ariakensis' 94323 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 3 sample 'Biological sequence' 190 366 Human ? 'MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP MK14_HUMAN Q16539 ? 1 ;MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKH ENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNE DCELKILDFGLA ; 1 2 UNP D2CIU1_CRAAR D2CIU1 ? 1 RVADPDHDHTGFLTEYV 18 3 UNP MK14_HUMAN Q16539 ? 1 ;ATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLT QMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYD EVISFVPPPLDQEEMES ; 184 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6QYX A 1 ? 172 ? Q16539 1 ? 172 ? 1 172 2 2 6QYX A 173 ? 189 ? D2CIU1 18 ? 34 ? 173 189 3 3 6QYX A 190 ? 366 ? Q16539 184 ? 360 ? 190 366 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6QYX _struct_ref_seq_dif.mon_id CYS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 167 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q16539 _struct_ref_seq_dif.db_mon_id LEU _struct_ref_seq_dif.pdbx_seq_db_seq_num 167 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 167 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BOG D-saccharide n 'octyl beta-D-glucopyranoside' ? 'C14 H28 O6' 292.369 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EPE non-polymer . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES 'C8 H18 N2 O4 S' 238.305 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6QYX _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.30 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.51 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M HEPES pH 7.5, 0.2 M KF, 13%-17% (w/v) PEG 3350, 25 mM beta-D-octyl glucoside (bOG) ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-09-05 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.873 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.873 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-2 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6QYX _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.66 _reflns.d_resolution_low 52.95 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 46102 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.068 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.66 _reflns_shell.d_res_low 1.72 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value 0.862 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -2.40 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 4.29 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -1.90 _refine.B_iso_max ? _refine.B_iso_mean 37.548 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.968 _refine.correlation_coeff_Fo_to_Fc_free 0.952 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6QYX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.66 _refine.ls_d_res_low 52.95 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 43882 _refine.ls_number_reflns_R_free 2168 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.14 _refine.ls_percent_reflns_R_free 4.7 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.18774 _refine.ls_R_factor_R_free 0.24233 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.18485 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'p38 wild type' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.130 _refine.pdbx_overall_ESU_R_Free 0.107 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 9.451 _refine.overall_SU_ML 0.128 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2731 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 35 _refine_hist.number_atoms_solvent 204 _refine_hist.number_atoms_total 2970 _refine_hist.d_res_high 1.66 _refine_hist.d_res_low 52.95 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.017 0.019 2829 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 2655 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.804 1.975 3838 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.908 3.000 6163 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.785 5.000 337 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.250 23.969 131 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.994 15.000 487 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 21.886 15.000 18 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.114 0.200 435 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.021 3065 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 565 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 6.736 3.514 1354 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 6.726 3.512 1353 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 8.337 5.271 1689 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 8.335 5.273 1690 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 7.851 3.957 1475 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 7.850 3.957 1475 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 9.624 5.742 2150 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 10.335 41.747 3197 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 10.326 41.612 3182 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? 3.064 3.000 5484 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? 39.502 5.000 128 ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? 27.030 5.000 5497 ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.660 _refine_ls_shell.d_res_low 1.703 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 164 _refine_ls_shell.number_reflns_R_work 3179 _refine_ls_shell.percent_reflns_obs 98.85 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.363 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.360 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6QYX _struct.title 'p38(alpha) MAP kinase with the activation loop of ERK2' _struct.pdbx_descriptor ;Mitogen-activated protein kinase 14,Mitogen-activated protein kinase 1,Mitogen-activated protein kinase 14 (E.C.2.7.11.24,2.7.11.24) ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6QYX _struct_keywords.text 'NleD, effector, T3SS, MAP kinase, phosphorylation, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 61 ? MET A 78 ? SER A 61 MET A 78 1 ? 18 HELX_P HELX_P2 AA2 LEU A 113 ? LYS A 118 ? LEU A 113 LYS A 118 1 ? 6 HELX_P HELX_P3 AA3 THR A 123 ? ALA A 144 ? THR A 123 ALA A 144 1 ? 22 HELX_P HELX_P4 AA4 LYS A 152 ? SER A 154 ? LYS A 152 SER A 154 5 ? 3 HELX_P HELX_P5 AA5 ALA A 190 ? ARG A 195 ? ALA A 190 ARG A 195 5 ? 6 HELX_P HELX_P6 AA6 ALA A 196 ? LEU A 201 ? ALA A 196 LEU A 201 1 ? 6 HELX_P HELX_P7 AA7 THR A 209 ? GLY A 225 ? THR A 209 GLY A 225 1 ? 17 HELX_P HELX_P8 AA8 ASP A 233 ? GLY A 246 ? ASP A 233 GLY A 246 1 ? 14 HELX_P HELX_P9 AA9 GLY A 249 ? LYS A 254 ? GLY A 249 LYS A 254 1 ? 6 HELX_P HELX_P10 AB1 SER A 258 ? LEU A 268 ? SER A 258 LEU A 268 1 ? 11 HELX_P HELX_P11 AB2 ASN A 275 ? VAL A 279 ? ASN A 275 VAL A 279 5 ? 5 HELX_P HELX_P12 AB3 ASN A 284 ? LEU A 295 ? ASN A 284 LEU A 295 1 ? 12 HELX_P HELX_P13 AB4 ASP A 298 ? ARG A 302 ? ASP A 298 ARG A 302 5 ? 5 HELX_P HELX_P14 AB5 THR A 304 ? ALA A 310 ? THR A 304 ALA A 310 1 ? 7 HELX_P HELX_P15 AB6 HIS A 311 ? ALA A 315 ? HIS A 311 ALA A 315 5 ? 5 HELX_P HELX_P16 AB7 GLN A 331 ? ARG A 336 ? GLN A 331 ARG A 336 5 ? 6 HELX_P HELX_P17 AB8 LEU A 339 ? SER A 353 ? LEU A 339 SER A 353 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 5 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 8 ? GLU A 12 ? PHE A 8 GLU A 12 AA1 2 ILE A 17 ? PRO A 21 ? ILE A 17 PRO A 21 AA2 1 TYR A 24 ? GLY A 33 ? TYR A 24 GLY A 33 AA2 2 GLY A 36 ? ASP A 43 ? GLY A 36 ASP A 43 AA2 3 ARG A 49 ? LYS A 54 ? ARG A 49 LYS A 54 AA2 4 TYR A 103 ? HIS A 107 ? TYR A 103 HIS A 107 AA2 5 ASP A 88 ? PHE A 90 ? ASP A 88 PHE A 90 AA3 1 ALA A 111 ? ASP A 112 ? ALA A 111 ASP A 112 AA3 2 LEU A 156 ? VAL A 158 ? LEU A 156 VAL A 158 AA3 3 LEU A 164 ? ILE A 166 ? LEU A 164 ILE A 166 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 11 ? N GLN A 11 O TRP A 18 ? O TRP A 18 AA2 1 2 N SER A 28 ? N SER A 28 O ALA A 40 ? O ALA A 40 AA2 2 3 N CYS A 39 ? N CYS A 39 O VAL A 52 ? O VAL A 52 AA2 3 4 N LYS A 53 ? N LYS A 53 O LEU A 104 ? O LEU A 104 AA2 4 5 O VAL A 105 ? O VAL A 105 N ASP A 88 ? N ASP A 88 AA3 1 2 N ALA A 111 ? N ALA A 111 O VAL A 158 ? O VAL A 158 AA3 2 3 N ALA A 157 ? N ALA A 157 O LYS A 165 ? O LYS A 165 # _atom_sites.entry_id 6QYX _atom_sites.fract_transf_matrix[1][1] 0.014522 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013423 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013284 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 TRP 18 18 18 TRP TRP A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 CYS 119 119 119 CYS CYS A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 HIS 148 148 148 HIS HIS A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 CYS 162 162 162 CYS CYS A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 CYS 167 167 167 CYS CYS A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 PHE 169 169 169 PHE PHE A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 ARG 173 173 ? ? ? A . n A 1 174 VAL 174 174 ? ? ? A . n A 1 175 ALA 175 175 ? ? ? A . n A 1 176 ASP 176 176 ? ? ? A . n A 1 177 PRO 177 177 ? ? ? A . n A 1 178 ASP 178 178 ? ? ? A . n A 1 179 HIS 179 179 ? ? ? A . n A 1 180 ASP 180 180 ? ? ? A . n A 1 181 HIS 181 181 ? ? ? A . n A 1 182 THR 182 182 ? ? ? A . n A 1 183 GLY 183 183 ? ? ? A . n A 1 184 PHE 184 184 ? ? ? A . n A 1 185 LEU 185 185 ? ? ? A . n A 1 186 THR 186 186 ? ? ? A . n A 1 187 GLU 187 187 ? ? ? A . n A 1 188 TYR 188 188 ? ? ? A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 THR 191 191 191 THR THR A . n A 1 192 ARG 192 192 192 ARG ARG A . n A 1 193 TRP 193 193 193 TRP TRP A . n A 1 194 TYR 194 194 194 TYR TYR A . n A 1 195 ARG 195 195 195 ARG ARG A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 PRO 197 197 197 PRO PRO A . n A 1 198 GLU 198 198 198 GLU GLU A . n A 1 199 ILE 199 199 199 ILE ILE A . n A 1 200 MET 200 200 200 MET MET A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 ASN 202 202 202 ASN ASN A . n A 1 203 TRP 203 203 203 TRP TRP A . n A 1 204 MET 204 204 204 MET MET A . n A 1 205 HIS 205 205 205 HIS HIS A . n A 1 206 TYR 206 206 206 TYR TYR A . n A 1 207 ASN 207 207 207 ASN ASN A . n A 1 208 GLN 208 208 208 GLN GLN A . n A 1 209 THR 209 209 209 THR THR A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 ASP 211 211 211 ASP ASP A . n A 1 212 ILE 212 212 212 ILE ILE A . n A 1 213 TRP 213 213 213 TRP TRP A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 VAL 215 215 215 VAL VAL A . n A 1 216 GLY 216 216 216 GLY GLY A . n A 1 217 CYS 217 217 217 CYS CYS A . n A 1 218 ILE 218 218 218 ILE ILE A . n A 1 219 MET 219 219 219 MET MET A . n A 1 220 ALA 220 220 220 ALA ALA A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 THR 224 224 224 THR THR A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 ARG 226 226 226 ARG ARG A . n A 1 227 THR 227 227 227 THR THR A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 PHE 229 229 229 PHE PHE A . n A 1 230 PRO 230 230 230 PRO PRO A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 THR 232 232 232 THR THR A . n A 1 233 ASP 233 233 233 ASP ASP A . n A 1 234 HIS 234 234 234 HIS HIS A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 GLN 237 237 237 GLN GLN A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 ILE 241 241 241 ILE ILE A . n A 1 242 LEU 242 242 242 LEU LEU A . n A 1 243 ARG 243 243 243 ARG ARG A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 VAL 245 245 245 VAL VAL A . n A 1 246 GLY 246 246 246 GLY GLY A . n A 1 247 THR 247 247 247 THR THR A . n A 1 248 PRO 248 248 248 PRO PRO A . n A 1 249 GLY 249 249 249 GLY GLY A . n A 1 250 ALA 250 250 250 ALA ALA A . n A 1 251 GLU 251 251 251 GLU GLU A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 LEU 253 253 253 LEU LEU A . n A 1 254 LYS 254 254 254 LYS LYS A . n A 1 255 LYS 255 255 255 LYS LYS A . n A 1 256 ILE 256 256 256 ILE ILE A . n A 1 257 SER 257 257 257 SER SER A . n A 1 258 SER 258 258 258 SER SER A . n A 1 259 GLU 259 259 259 GLU GLU A . n A 1 260 SER 260 260 260 SER SER A . n A 1 261 ALA 261 261 261 ALA ALA A . n A 1 262 ARG 262 262 262 ARG ARG A . n A 1 263 ASN 263 263 263 ASN ASN A . n A 1 264 TYR 264 264 264 TYR TYR A . n A 1 265 ILE 265 265 265 ILE ILE A . n A 1 266 GLN 266 266 266 GLN GLN A . n A 1 267 SER 267 267 267 SER SER A . n A 1 268 LEU 268 268 268 LEU LEU A . n A 1 269 THR 269 269 269 THR THR A . n A 1 270 GLN 270 270 270 GLN GLN A . n A 1 271 MET 271 271 271 MET MET A . n A 1 272 PRO 272 272 272 PRO PRO A . n A 1 273 LYS 273 273 273 LYS LYS A . n A 1 274 MET 274 274 274 MET MET A . n A 1 275 ASN 275 275 275 ASN ASN A . n A 1 276 PHE 276 276 276 PHE PHE A . n A 1 277 ALA 277 277 277 ALA ALA A . n A 1 278 ASN 278 278 278 ASN ASN A . n A 1 279 VAL 279 279 279 VAL VAL A . n A 1 280 PHE 280 280 280 PHE PHE A . n A 1 281 ILE 281 281 281 ILE ILE A . n A 1 282 GLY 282 282 282 GLY GLY A . n A 1 283 ALA 283 283 283 ALA ALA A . n A 1 284 ASN 284 284 284 ASN ASN A . n A 1 285 PRO 285 285 285 PRO PRO A . n A 1 286 LEU 286 286 286 LEU LEU A . n A 1 287 ALA 287 287 287 ALA ALA A . n A 1 288 VAL 288 288 288 VAL VAL A . n A 1 289 ASP 289 289 289 ASP ASP A . n A 1 290 LEU 290 290 290 LEU LEU A . n A 1 291 LEU 291 291 291 LEU LEU A . n A 1 292 GLU 292 292 292 GLU GLU A . n A 1 293 LYS 293 293 293 LYS LYS A . n A 1 294 MET 294 294 294 MET MET A . n A 1 295 LEU 295 295 295 LEU LEU A . n A 1 296 VAL 296 296 296 VAL VAL A . n A 1 297 LEU 297 297 297 LEU LEU A . n A 1 298 ASP 298 298 298 ASP ASP A . n A 1 299 SER 299 299 299 SER SER A . n A 1 300 ASP 300 300 300 ASP ASP A . n A 1 301 LYS 301 301 301 LYS LYS A . n A 1 302 ARG 302 302 302 ARG ARG A . n A 1 303 ILE 303 303 303 ILE ILE A . n A 1 304 THR 304 304 304 THR THR A . n A 1 305 ALA 305 305 305 ALA ALA A . n A 1 306 ALA 306 306 306 ALA ALA A . n A 1 307 GLN 307 307 307 GLN GLN A . n A 1 308 ALA 308 308 308 ALA ALA A . n A 1 309 LEU 309 309 309 LEU LEU A . n A 1 310 ALA 310 310 310 ALA ALA A . n A 1 311 HIS 311 311 311 HIS HIS A . n A 1 312 ALA 312 312 312 ALA ALA A . n A 1 313 TYR 313 313 313 TYR TYR A . n A 1 314 PHE 314 314 314 PHE PHE A . n A 1 315 ALA 315 315 315 ALA ALA A . n A 1 316 GLN 316 316 316 GLN GLN A . n A 1 317 TYR 317 317 317 TYR TYR A . n A 1 318 HIS 318 318 318 HIS HIS A . n A 1 319 ASP 319 319 319 ASP ASP A . n A 1 320 PRO 320 320 320 PRO PRO A . n A 1 321 ASP 321 321 321 ASP ASP A . n A 1 322 ASP 322 322 322 ASP ASP A . n A 1 323 GLU 323 323 323 GLU GLU A . n A 1 324 PRO 324 324 324 PRO PRO A . n A 1 325 VAL 325 325 325 VAL VAL A . n A 1 326 ALA 326 326 326 ALA ALA A . n A 1 327 ASP 327 327 327 ASP ASP A . n A 1 328 PRO 328 328 328 PRO PRO A . n A 1 329 TYR 329 329 329 TYR TYR A . n A 1 330 ASP 330 330 330 ASP ASP A . n A 1 331 GLN 331 331 331 GLN GLN A . n A 1 332 SER 332 332 332 SER SER A . n A 1 333 PHE 333 333 333 PHE PHE A . n A 1 334 GLU 334 334 334 GLU GLU A . n A 1 335 SER 335 335 335 SER SER A . n A 1 336 ARG 336 336 336 ARG ARG A . n A 1 337 ASP 337 337 337 ASP ASP A . n A 1 338 LEU 338 338 338 LEU LEU A . n A 1 339 LEU 339 339 339 LEU LEU A . n A 1 340 ILE 340 340 340 ILE ILE A . n A 1 341 ASP 341 341 341 ASP ASP A . n A 1 342 GLU 342 342 342 GLU GLU A . n A 1 343 TRP 343 343 343 TRP TRP A . n A 1 344 LYS 344 344 344 LYS LYS A . n A 1 345 SER 345 345 345 SER SER A . n A 1 346 LEU 346 346 346 LEU LEU A . n A 1 347 THR 347 347 347 THR THR A . n A 1 348 TYR 348 348 348 TYR TYR A . n A 1 349 ASP 349 349 349 ASP ASP A . n A 1 350 GLU 350 350 350 GLU GLU A . n A 1 351 VAL 351 351 351 VAL VAL A . n A 1 352 ILE 352 352 352 ILE ILE A . n A 1 353 SER 353 353 353 SER SER A . n A 1 354 PHE 354 354 354 PHE PHE A . n A 1 355 VAL 355 355 355 VAL VAL A . n A 1 356 PRO 356 356 356 PRO PRO A . n A 1 357 PRO 357 357 357 PRO PRO A . n A 1 358 PRO 358 358 358 PRO PRO A . n A 1 359 LEU 359 359 ? ? ? A . n A 1 360 ASP 360 360 ? ? ? A . n A 1 361 GLN 361 361 ? ? ? A . n A 1 362 GLU 362 362 ? ? ? A . n A 1 363 GLU 363 363 ? ? ? A . n A 1 364 MET 364 364 ? ? ? A . n A 1 365 GLU 365 365 ? ? ? A . n A 1 366 SER 366 366 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BOG 1 401 1 BOG BOG A . C 3 EPE 1 402 1 EPE EPE A . D 4 HOH 1 501 180 HOH HOH A . D 4 HOH 2 502 99 HOH HOH A . D 4 HOH 3 503 169 HOH HOH A . D 4 HOH 4 504 148 HOH HOH A . D 4 HOH 5 505 42 HOH HOH A . D 4 HOH 6 506 32 HOH HOH A . D 4 HOH 7 507 6 HOH HOH A . D 4 HOH 8 508 60 HOH HOH A . D 4 HOH 9 509 149 HOH HOH A . D 4 HOH 10 510 177 HOH HOH A . D 4 HOH 11 511 200 HOH HOH A . D 4 HOH 12 512 72 HOH HOH A . D 4 HOH 13 513 18 HOH HOH A . D 4 HOH 14 514 116 HOH HOH A . D 4 HOH 15 515 123 HOH HOH A . D 4 HOH 16 516 22 HOH HOH A . D 4 HOH 17 517 36 HOH HOH A . D 4 HOH 18 518 113 HOH HOH A . D 4 HOH 19 519 48 HOH HOH A . D 4 HOH 20 520 167 HOH HOH A . D 4 HOH 21 521 13 HOH HOH A . D 4 HOH 22 522 73 HOH HOH A . D 4 HOH 23 523 34 HOH HOH A . D 4 HOH 24 524 66 HOH HOH A . D 4 HOH 25 525 12 HOH HOH A . D 4 HOH 26 526 164 HOH HOH A . D 4 HOH 27 527 150 HOH HOH A . D 4 HOH 28 528 175 HOH HOH A . D 4 HOH 29 529 90 HOH HOH A . D 4 HOH 30 530 198 HOH HOH A . D 4 HOH 31 531 11 HOH HOH A . D 4 HOH 32 532 186 HOH HOH A . D 4 HOH 33 533 129 HOH HOH A . D 4 HOH 34 534 46 HOH HOH A . D 4 HOH 35 535 184 HOH HOH A . D 4 HOH 36 536 155 HOH HOH A . D 4 HOH 37 537 10 HOH HOH A . D 4 HOH 38 538 101 HOH HOH A . D 4 HOH 39 539 14 HOH HOH A . D 4 HOH 40 540 125 HOH HOH A . D 4 HOH 41 541 54 HOH HOH A . D 4 HOH 42 542 199 HOH HOH A . D 4 HOH 43 543 171 HOH HOH A . D 4 HOH 44 544 44 HOH HOH A . D 4 HOH 45 545 82 HOH HOH A . D 4 HOH 46 546 68 HOH HOH A . D 4 HOH 47 547 7 HOH HOH A . D 4 HOH 48 548 158 HOH HOH A . D 4 HOH 49 549 70 HOH HOH A . D 4 HOH 50 550 139 HOH HOH A . D 4 HOH 51 551 161 HOH HOH A . D 4 HOH 52 552 146 HOH HOH A . D 4 HOH 53 553 31 HOH HOH A . D 4 HOH 54 554 86 HOH HOH A . D 4 HOH 55 555 166 HOH HOH A . D 4 HOH 56 556 153 HOH HOH A . D 4 HOH 57 557 29 HOH HOH A . D 4 HOH 58 558 127 HOH HOH A . D 4 HOH 59 559 181 HOH HOH A . D 4 HOH 60 560 81 HOH HOH A . D 4 HOH 61 561 117 HOH HOH A . D 4 HOH 62 562 8 HOH HOH A . D 4 HOH 63 563 59 HOH HOH A . D 4 HOH 64 564 43 HOH HOH A . D 4 HOH 65 565 120 HOH HOH A . D 4 HOH 66 566 188 HOH HOH A . D 4 HOH 67 567 145 HOH HOH A . D 4 HOH 68 568 19 HOH HOH A . D 4 HOH 69 569 174 HOH HOH A . D 4 HOH 70 570 121 HOH HOH A . D 4 HOH 71 571 62 HOH HOH A . D 4 HOH 72 572 157 HOH HOH A . D 4 HOH 73 573 79 HOH HOH A . D 4 HOH 74 574 168 HOH HOH A . D 4 HOH 75 575 88 HOH HOH A . D 4 HOH 76 576 154 HOH HOH A . D 4 HOH 77 577 23 HOH HOH A . D 4 HOH 78 578 143 HOH HOH A . D 4 HOH 79 579 134 HOH HOH A . D 4 HOH 80 580 131 HOH HOH A . D 4 HOH 81 581 132 HOH HOH A . D 4 HOH 82 582 97 HOH HOH A . D 4 HOH 83 583 5 HOH HOH A . D 4 HOH 84 584 135 HOH HOH A . D 4 HOH 85 585 39 HOH HOH A . D 4 HOH 86 586 172 HOH HOH A . D 4 HOH 87 587 67 HOH HOH A . D 4 HOH 88 588 152 HOH HOH A . D 4 HOH 89 589 65 HOH HOH A . D 4 HOH 90 590 122 HOH HOH A . D 4 HOH 91 591 16 HOH HOH A . D 4 HOH 92 592 64 HOH HOH A . D 4 HOH 93 593 38 HOH HOH A . D 4 HOH 94 594 151 HOH HOH A . D 4 HOH 95 595 55 HOH HOH A . D 4 HOH 96 596 176 HOH HOH A . D 4 HOH 97 597 147 HOH HOH A . D 4 HOH 98 598 58 HOH HOH A . D 4 HOH 99 599 1 HOH HOH A . D 4 HOH 100 600 84 HOH HOH A . D 4 HOH 101 601 128 HOH HOH A . D 4 HOH 102 602 141 HOH HOH A . D 4 HOH 103 603 33 HOH HOH A . D 4 HOH 104 604 4 HOH HOH A . D 4 HOH 105 605 92 HOH HOH A . D 4 HOH 106 606 190 HOH HOH A . D 4 HOH 107 607 24 HOH HOH A . D 4 HOH 108 608 78 HOH HOH A . D 4 HOH 109 609 138 HOH HOH A . D 4 HOH 110 610 126 HOH HOH A . D 4 HOH 111 611 183 HOH HOH A . D 4 HOH 112 612 28 HOH HOH A . D 4 HOH 113 613 9 HOH HOH A . D 4 HOH 114 614 195 HOH HOH A . D 4 HOH 115 615 144 HOH HOH A . D 4 HOH 116 616 114 HOH HOH A . D 4 HOH 117 617 71 HOH HOH A . D 4 HOH 118 618 83 HOH HOH A . D 4 HOH 119 619 162 HOH HOH A . D 4 HOH 120 620 76 HOH HOH A . D 4 HOH 121 621 163 HOH HOH A . D 4 HOH 122 622 47 HOH HOH A . D 4 HOH 123 623 115 HOH HOH A . D 4 HOH 124 624 192 HOH HOH A . D 4 HOH 125 625 179 HOH HOH A . D 4 HOH 126 626 89 HOH HOH A . D 4 HOH 127 627 119 HOH HOH A . D 4 HOH 128 628 156 HOH HOH A . D 4 HOH 129 629 15 HOH HOH A . D 4 HOH 130 630 159 HOH HOH A . D 4 HOH 131 631 40 HOH HOH A . D 4 HOH 132 632 94 HOH HOH A . D 4 HOH 133 633 136 HOH HOH A . D 4 HOH 134 634 170 HOH HOH A . D 4 HOH 135 635 130 HOH HOH A . D 4 HOH 136 636 165 HOH HOH A . D 4 HOH 137 637 87 HOH HOH A . D 4 HOH 138 638 41 HOH HOH A . D 4 HOH 139 639 49 HOH HOH A . D 4 HOH 140 640 74 HOH HOH A . D 4 HOH 141 641 124 HOH HOH A . D 4 HOH 142 642 187 HOH HOH A . D 4 HOH 143 643 77 HOH HOH A . D 4 HOH 144 644 30 HOH HOH A . D 4 HOH 145 645 61 HOH HOH A . D 4 HOH 146 646 91 HOH HOH A . D 4 HOH 147 647 51 HOH HOH A . D 4 HOH 148 648 98 HOH HOH A . D 4 HOH 149 649 196 HOH HOH A . D 4 HOH 150 650 189 HOH HOH A . D 4 HOH 151 651 93 HOH HOH A . D 4 HOH 152 652 133 HOH HOH A . D 4 HOH 153 653 118 HOH HOH A . D 4 HOH 154 654 137 HOH HOH A . D 4 HOH 155 655 160 HOH HOH A . D 4 HOH 156 656 142 HOH HOH A . D 4 HOH 157 657 194 HOH HOH A . D 4 HOH 158 658 26 HOH HOH A . D 4 HOH 159 659 85 HOH HOH A . D 4 HOH 160 660 197 HOH HOH A . D 4 HOH 161 661 102 HOH HOH A . D 4 HOH 162 662 27 HOH HOH A . D 4 HOH 163 663 17 HOH HOH A . D 4 HOH 164 664 37 HOH HOH A . D 4 HOH 165 665 96 HOH HOH A . D 4 HOH 166 666 35 HOH HOH A . D 4 HOH 167 667 3 HOH HOH A . D 4 HOH 168 668 178 HOH HOH A . D 4 HOH 169 669 21 HOH HOH A . D 4 HOH 170 670 45 HOH HOH A . D 4 HOH 171 671 53 HOH HOH A . D 4 HOH 172 672 95 HOH HOH A . D 4 HOH 173 673 2 HOH HOH A . D 4 HOH 174 674 173 HOH HOH A . D 4 HOH 175 675 20 HOH HOH A . D 4 HOH 176 676 52 HOH HOH A . D 4 HOH 177 677 69 HOH HOH A . D 4 HOH 178 678 25 HOH HOH A . D 4 HOH 179 679 56 HOH HOH A . D 4 HOH 180 680 105 HOH HOH A . D 4 HOH 181 681 191 HOH HOH A . D 4 HOH 182 682 104 HOH HOH A . D 4 HOH 183 683 185 HOH HOH A . D 4 HOH 184 684 107 HOH HOH A . D 4 HOH 185 685 140 HOH HOH A . D 4 HOH 186 686 75 HOH HOH A . D 4 HOH 187 687 57 HOH HOH A . D 4 HOH 188 688 203 HOH HOH A . D 4 HOH 189 689 106 HOH HOH A . D 4 HOH 190 690 182 HOH HOH A . D 4 HOH 191 691 110 HOH HOH A . D 4 HOH 192 692 193 HOH HOH A . D 4 HOH 193 693 109 HOH HOH A . D 4 HOH 194 694 111 HOH HOH A . D 4 HOH 195 695 80 HOH HOH A . D 4 HOH 196 696 63 HOH HOH A . D 4 HOH 197 697 103 HOH HOH A . D 4 HOH 198 698 100 HOH HOH A . D 4 HOH 199 699 112 HOH HOH A . D 4 HOH 200 700 108 HOH HOH A . D 4 HOH 201 701 202 HOH HOH A . D 4 HOH 202 702 50 HOH HOH A . D 4 HOH 203 703 204 HOH HOH A . D 4 HOH 204 704 201 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1080 ? 1 MORE 12 ? 1 'SSA (A^2)' 17010 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-01 2 'Structure model' 1 1 2020-05-20 3 'Structure model' 1 2 2020-05-27 4 'Structure model' 1 3 2020-07-22 5 'Structure model' 1 4 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' citation 5 5 'Structure model' chem_comp 6 5 'Structure model' entity 7 5 'Structure model' pdbx_chem_comp_identifier 8 5 'Structure model' pdbx_entity_nonpoly 9 5 'Structure model' struct_site 10 5 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' 8 3 'Structure model' '_citation.pdbx_database_id_DOI' 9 3 'Structure model' '_citation.pdbx_database_id_PubMed' 10 3 'Structure model' '_citation.title' 11 4 'Structure model' '_citation.journal_volume' 12 4 'Structure model' '_citation.page_first' 13 4 'Structure model' '_citation.page_last' 14 5 'Structure model' '_chem_comp.mon_nstd_flag' 15 5 'Structure model' '_chem_comp.name' 16 5 'Structure model' '_chem_comp.type' 17 5 'Structure model' '_entity.pdbx_description' 18 5 'Structure model' '_pdbx_entity_nonpoly.name' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0218 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 515 ? ? O A HOH 549 ? ? 2.05 2 1 O6 A BOG 401 ? ? O A HOH 501 ? ? 2.14 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 160 ? ? OE1 A GLU 160 ? ? 1.157 1.252 -0.095 0.011 N 2 1 CG A TRP 343 ? ? CD1 A TRP 343 ? ? 1.460 1.363 0.097 0.014 N 3 1 C A PRO 358 ? ? O A PRO 358 ? ? 1.527 1.228 0.299 0.020 N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 336 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 336 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 336 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.16 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.14 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 13 ? ? -115.56 -98.31 2 1 LYS A 15 ? ? -150.21 9.86 3 1 ARG A 149 ? ? 75.86 -12.54 4 1 ASP A 150 ? ? -140.81 42.94 5 1 MET A 204 ? ? 70.62 -14.75 6 1 PHE A 280 ? ? -104.29 66.83 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A ARG 173 ? A ARG 173 5 1 Y 1 A VAL 174 ? A VAL 174 6 1 Y 1 A ALA 175 ? A ALA 175 7 1 Y 1 A ASP 176 ? A ASP 176 8 1 Y 1 A PRO 177 ? A PRO 177 9 1 Y 1 A ASP 178 ? A ASP 178 10 1 Y 1 A HIS 179 ? A HIS 179 11 1 Y 1 A ASP 180 ? A ASP 180 12 1 Y 1 A HIS 181 ? A HIS 181 13 1 Y 1 A THR 182 ? A THR 182 14 1 Y 1 A GLY 183 ? A GLY 183 15 1 Y 1 A PHE 184 ? A PHE 184 16 1 Y 1 A LEU 185 ? A LEU 185 17 1 Y 1 A THR 186 ? A THR 186 18 1 Y 1 A GLU 187 ? A GLU 187 19 1 Y 1 A TYR 188 ? A TYR 188 20 1 Y 1 A LEU 359 ? A LEU 359 21 1 Y 1 A ASP 360 ? A ASP 360 22 1 Y 1 A GLN 361 ? A GLN 361 23 1 Y 1 A GLU 362 ? A GLU 362 24 1 Y 1 A GLU 363 ? A GLU 363 25 1 Y 1 A MET 364 ? A MET 364 26 1 Y 1 A GLU 365 ? A GLU 365 27 1 Y 1 A SER 366 ? A SER 366 # _pdbx_audit_support.funding_organization 'Israel Science Foundation' _pdbx_audit_support.country Israel _pdbx_audit_support.grant_number 1422/16 _pdbx_audit_support.ordinal 1 # _pdbx_chem_comp_identifier.comp_id BOG _pdbx_chem_comp_identifier.type 'IUPAC CARBOHYDRATE SYMBOL' _pdbx_chem_comp_identifier.program PDB-CARE _pdbx_chem_comp_identifier.program_version 1.0 _pdbx_chem_comp_identifier.identifier b-octylglucoside # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'octyl beta-D-glucopyranoside' BOG 3 '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' EPE 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #