data_6RK3 # _entry.id 6RK3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.325 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6RK3 WWPDB D_1292102060 BMRB 27503 # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 27503 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6RK3 _pdbx_database_status.recvd_initial_deposition_date 2019-04-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Usachev, K.' 1 ? 'Fatkhullin, B.' 2 ? 'Gabdulkhakov, A.' 3 ? 'Khusainov, I.' 4 ? 'Golubev, A.' 5 ? 'Validov, S.' 6 ? 'Yusupova, G.' 7 ? 'Yusupov, M.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GW _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Eur.Biophys.J. _citation.journal_id_ASTM EBJOE8 _citation.journal_id_CSD 0997 _citation.journal_id_ISSN 0175-7571 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 49 _citation.language ? _citation.page_first 223 _citation.page_last 230 _citation.title 'NMR and crystallographic structural studies of the Elongation factor P from Staphylococcus aureus.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1007/s00249-020-01428-x _citation.pdbx_database_id_PubMed 32152681 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Golubev, A.' 1 ? primary 'Fatkhullin, B.' 2 ? primary 'Gabdulkhakov, A.' 3 ? primary 'Bikmullin, A.' 4 ? primary 'Nurullina, L.' 5 ? primary 'Garaeva, N.' 6 ? primary 'Islamov, D.' 7 ? primary 'Klochkova, E.' 8 ? primary 'Klochkov, V.' 9 ? primary 'Aganov, A.' 10 ? primary 'Khusainov, I.' 11 ? primary 'Validov, S.' 12 ? primary 'Yusupova, G.' 13 ? primary 'Yusupov, M.' 14 ? primary 'Usachev, K.' 15 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Elongation factor P' _entity.formula_weight 20575.008 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name EF-P # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRMQYLYADGDNH VFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGIKGDTATGATKSATVETGYTL NVPLFVNEGDVLIINTGDGSYISRG ; _entity_poly.pdbx_seq_one_letter_code_can ;MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRMQYLYADGDNH VFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGIKGDTATGATKSATVETGYTL NVPLFVNEGDVLIINTGDGSYISRG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 SER n 1 4 VAL n 1 5 ASN n 1 6 ASP n 1 7 PHE n 1 8 LYS n 1 9 THR n 1 10 GLY n 1 11 LEU n 1 12 THR n 1 13 ILE n 1 14 SER n 1 15 VAL n 1 16 ASP n 1 17 ASN n 1 18 ALA n 1 19 ILE n 1 20 TRP n 1 21 LYS n 1 22 VAL n 1 23 ILE n 1 24 ASP n 1 25 PHE n 1 26 GLN n 1 27 HIS n 1 28 VAL n 1 29 LYS n 1 30 PRO n 1 31 GLY n 1 32 LYS n 1 33 GLY n 1 34 SER n 1 35 ALA n 1 36 PHE n 1 37 VAL n 1 38 ARG n 1 39 SER n 1 40 LYS n 1 41 LEU n 1 42 ARG n 1 43 ASN n 1 44 LEU n 1 45 ARG n 1 46 THR n 1 47 GLY n 1 48 ALA n 1 49 ILE n 1 50 GLN n 1 51 GLU n 1 52 LYS n 1 53 THR n 1 54 PHE n 1 55 ARG n 1 56 ALA n 1 57 GLY n 1 58 GLU n 1 59 LYS n 1 60 VAL n 1 61 GLU n 1 62 PRO n 1 63 ALA n 1 64 MET n 1 65 ILE n 1 66 GLU n 1 67 ASN n 1 68 ARG n 1 69 ARG n 1 70 MET n 1 71 GLN n 1 72 TYR n 1 73 LEU n 1 74 TYR n 1 75 ALA n 1 76 ASP n 1 77 GLY n 1 78 ASP n 1 79 ASN n 1 80 HIS n 1 81 VAL n 1 82 PHE n 1 83 MET n 1 84 ASP n 1 85 ASN n 1 86 GLU n 1 87 SER n 1 88 PHE n 1 89 GLU n 1 90 GLN n 1 91 THR n 1 92 GLU n 1 93 LEU n 1 94 SER n 1 95 SER n 1 96 ASP n 1 97 TYR n 1 98 LEU n 1 99 LYS n 1 100 GLU n 1 101 GLU n 1 102 LEU n 1 103 ASN n 1 104 TYR n 1 105 LEU n 1 106 LYS n 1 107 GLU n 1 108 GLY n 1 109 MET n 1 110 GLU n 1 111 VAL n 1 112 GLN n 1 113 ILE n 1 114 GLN n 1 115 THR n 1 116 TYR n 1 117 GLU n 1 118 GLY n 1 119 GLU n 1 120 THR n 1 121 ILE n 1 122 GLY n 1 123 VAL n 1 124 GLU n 1 125 LEU n 1 126 PRO n 1 127 LYS n 1 128 THR n 1 129 VAL n 1 130 GLU n 1 131 LEU n 1 132 THR n 1 133 VAL n 1 134 THR n 1 135 GLU n 1 136 THR n 1 137 GLU n 1 138 PRO n 1 139 GLY n 1 140 ILE n 1 141 LYS n 1 142 GLY n 1 143 ASP n 1 144 THR n 1 145 ALA n 1 146 THR n 1 147 GLY n 1 148 ALA n 1 149 THR n 1 150 LYS n 1 151 SER n 1 152 ALA n 1 153 THR n 1 154 VAL n 1 155 GLU n 1 156 THR n 1 157 GLY n 1 158 TYR n 1 159 THR n 1 160 LEU n 1 161 ASN n 1 162 VAL n 1 163 PRO n 1 164 LEU n 1 165 PHE n 1 166 VAL n 1 167 ASN n 1 168 GLU n 1 169 GLY n 1 170 ASP n 1 171 VAL n 1 172 LEU n 1 173 ILE n 1 174 ILE n 1 175 ASN n 1 176 THR n 1 177 GLY n 1 178 ASP n 1 179 GLY n 1 180 SER n 1 181 TYR n 1 182 ILE n 1 183 SER n 1 184 ARG n 1 185 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 185 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ;efp, efp_1, BN1321_260166, BTN44_04530, CSC83_09570, CSC87_09360, CV021_16705, EP54_01240, EQ90_12570, ERS072840_00894, HMPREF3211_01680, M1K003_1282, NCTC10654_01594, NCTC13131_01960, NCTC13196_02506, NCTC6133_02039, NCTC7878_01463, RK64_08215, SAMEA1466939_00955, SAMEA1708674_01996 ; _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code W8U5N1_STAAU _struct_ref.pdbx_db_accession W8U5N1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRMQYLYADGDNH VFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGIKGDTATGATKSATVETGYTL NVPLFVNEGDVLIINTGDGSYISRG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6RK3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 185 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession W8U5N1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 185 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 185 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 2 1 1 '3D 1H-15N NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.3 mM [U-13C; U-15N] SaEF-P, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label '13C, 15N' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6RK3 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 6RK3 _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6RK3 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 'structure calculation' CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6RK3 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6RK3 _struct.title 'Solution structure of the ribosome Elongation Factor P (EF-P) from Staphylococcus aureus' _struct.pdbx_descriptor 'Elongation factor P' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6RK3 _struct_keywords.text 'EF-P, Staphylococcus aureus, Ribosome, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 95 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 102 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 95 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 102 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? AA3 ? 3 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 49 ? ARG A 55 ? ILE A 49 ARG A 55 AA1 2 PHE A 36 ? ASN A 43 ? PHE A 36 ASN A 43 AA1 3 ALA A 18 ? VAL A 28 ? ALA A 18 VAL A 28 AA1 4 LEU A 11 ? VAL A 15 ? LEU A 11 VAL A 15 AA1 5 GLU A 61 ? PRO A 62 ? GLU A 61 PRO A 62 AA2 1 GLU A 89 ? SER A 94 ? GLU A 89 SER A 94 AA2 2 ASN A 79 ? ASP A 84 ? ASN A 79 ASP A 84 AA2 3 GLU A 66 ? TYR A 72 ? GLU A 66 TYR A 72 AA2 4 GLU A 110 ? TYR A 116 ? GLU A 110 TYR A 116 AA2 5 GLU A 119 ? GLU A 124 ? GLU A 119 GLU A 124 AA3 1 THR A 128 ? THR A 132 ? THR A 128 THR A 132 AA3 2 VAL A 171 ? ASN A 175 ? VAL A 171 ASN A 175 AA3 3 TYR A 181 ? ILE A 182 ? TYR A 181 ILE A 182 AA4 1 THR A 149 ? THR A 153 ? THR A 149 THR A 153 AA4 2 THR A 159 ? PRO A 163 ? THR A 159 PRO A 163 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 52 ? O LYS A 52 N SER A 39 ? N SER A 39 AA1 2 3 O LYS A 40 ? O LYS A 40 N ILE A 23 ? N ILE A 23 AA1 3 4 O TRP A 20 ? O TRP A 20 N ILE A 13 ? N ILE A 13 AA1 4 5 N SER A 14 ? N SER A 14 O GLU A 61 ? O GLU A 61 AA2 1 2 O THR A 91 ? O THR A 91 N PHE A 82 ? N PHE A 82 AA2 2 3 O MET A 83 ? O MET A 83 N GLN A 71 ? N GLN A 71 AA2 3 4 N GLU A 66 ? N GLU A 66 O THR A 115 ? O THR A 115 AA2 4 5 N GLN A 112 ? N GLN A 112 O GLU A 124 ? O GLU A 124 AA3 1 2 N LEU A 131 ? N LEU A 131 O LEU A 172 ? O LEU A 172 AA3 2 3 N ILE A 173 ? N ILE A 173 O ILE A 182 ? O ILE A 182 AA4 1 2 N ALA A 152 ? N ALA A 152 O LEU A 160 ? O LEU A 160 # _atom_sites.entry_id 6RK3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 TYR 158 158 158 TYR TYR A . n A 1 159 THR 159 159 159 THR THR A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 ASN 167 167 167 ASN ASN A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 ASP 178 178 178 ASP ASP A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 TYR 181 181 181 TYR TYR A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 GLY 185 185 185 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 11170 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-03-11 2 'Structure model' 1 1 2020-03-18 3 'Structure model' 1 2 2020-06-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_citation_author.name' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component SaEF-P _pdbx_nmr_exptl_sample.concentration 1.3 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ2 A LYS 99 ? ? OE2 A GLU 100 ? ? 1.60 2 2 HD1 A HIS 80 ? ? OE1 A GLU 101 ? ? 1.56 3 2 HH22 A ARG 45 ? ? OE1 A GLU 119 ? ? 1.59 4 4 O A GLU 137 ? ? HZ2 A LYS 150 ? ? 1.59 5 4 HZ3 A LYS 150 ? ? O A VAL 166 ? ? 1.59 6 7 HD1 A HIS 80 ? ? OE2 A GLU 101 ? ? 1.56 7 9 HD1 A HIS 80 ? ? OE2 A GLU 101 ? ? 1.60 8 10 HD1 A HIS 80 ? ? OE1 A GLU 101 ? ? 1.55 9 10 OD2 A ASP 178 ? ? HG A SER 180 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 24 ? ? -162.71 113.78 2 1 ALA A 75 ? ? -151.27 -154.23 3 1 SER A 87 ? ? -171.85 93.56 4 1 PHE A 88 ? ? 49.79 29.37 5 1 GLU A 135 ? ? 77.37 87.81 6 2 SER A 87 ? ? -171.43 91.71 7 2 PHE A 88 ? ? 47.41 28.05 8 2 GLU A 135 ? ? 77.52 101.65 9 2 PRO A 138 ? ? -69.11 -179.76 10 2 ASP A 143 ? ? -102.23 -74.51 11 2 ALA A 145 ? ? -129.60 -75.41 12 3 SER A 87 ? ? -169.42 91.30 13 3 PHE A 88 ? ? 47.51 28.19 14 3 GLU A 135 ? ? 75.11 108.27 15 3 ARG A 184 ? ? -39.59 136.18 16 4 ALA A 75 ? ? -150.23 -149.55 17 4 SER A 87 ? ? -170.99 91.65 18 4 PHE A 88 ? ? 48.31 26.62 19 4 LEU A 105 ? ? 179.80 171.41 20 4 GLU A 135 ? ? 79.06 96.67 21 4 ASP A 143 ? ? 62.93 -173.18 22 4 THR A 144 ? ? -153.69 87.66 23 4 THR A 146 ? ? -150.21 36.38 24 4 ARG A 184 ? ? 72.46 30.22 25 5 SER A 87 ? ? -164.75 90.03 26 5 PHE A 88 ? ? 47.33 28.26 27 5 PRO A 126 ? ? -37.74 127.50 28 5 GLU A 135 ? ? 79.40 79.07 29 5 ASP A 143 ? ? 66.24 -41.10 30 6 SER A 87 ? ? -169.09 91.59 31 6 PHE A 88 ? ? 48.42 25.32 32 6 GLU A 135 ? ? 77.36 86.61 33 6 ALA A 145 ? ? -165.78 34.01 34 7 SER A 87 ? ? -167.35 91.87 35 7 PHE A 88 ? ? 48.44 28.50 36 7 GLU A 135 ? ? 76.05 97.30 37 7 ASP A 143 ? ? 67.39 -67.99 38 7 ALA A 148 ? ? 68.06 153.17 39 8 ALA A 75 ? ? -140.21 -149.43 40 8 SER A 87 ? ? -171.15 91.74 41 8 PHE A 88 ? ? 47.99 29.86 42 8 GLU A 135 ? ? 77.77 111.49 43 8 THR A 144 ? ? -67.75 87.00 44 8 ALA A 145 ? ? -117.66 57.62 45 9 SER A 87 ? ? -172.25 92.46 46 9 PHE A 88 ? ? 48.60 27.46 47 9 GLU A 135 ? ? 70.60 88.87 48 10 SER A 87 ? ? -170.94 93.95 49 10 GLU A 135 ? ? 75.94 86.02 50 10 THR A 146 ? ? 71.49 -56.56 # _pdbx_audit_support.funding_organization 'Russian Science Foundation' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 17-74-20009 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #