data_6RPP # _entry.id 6RPP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6RPP pdb_00006rpp 10.2210/pdb6rpp/pdb WWPDB D_1292102351 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-08-14 2 'Structure model' 1 1 2019-10-30 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6RPP _pdbx_database_status.recvd_initial_deposition_date 2019-05-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mikula, K.M.' 1 0000-0002-7824-9477 'Beyer, H.M.' 2 0000-0002-6882-006X 'Iwai, H.' 3 0000-0001-7376-5264 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? DE ? ? primary Extremophiles ? ? 1433-4909 ? ? 23 ? 669 679 ;Crystal structures of CDC21-1 inteins from hyperthermophilic archaea reveal the selection mechanism for the highly conserved homing endonuclease insertion site. ; 2019 ? 10.1007/s00792-019-01117-4 31363851 ? ? ? ? ? ? ? ? US ? ? 1 'Acta Crystallogr. D Biol. Crystallogr.' ABCRE6 ? 1399-0047 ? ? 68 ? 352 367 'Towards automated crystallographic structure refinement with phenix.refine.' 2012 ? 10.1107/S0907444912001308 22505256 ? ? ? ? ? ? ? ? US ? ? 2 'Acta Crystallogr. D Biol. Crystallogr.' ABCRE6 ? 1399-0047 ? ? 66 ? 213 221 'PHENIX: a comprehensive Python-based system for macromolecular structure solution.' 2010 ? 10.1107/S0907444909052925 20124702 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Beyer, H.M.' 1 ? primary 'Mikula, K.M.' 2 ? primary 'Kudling, T.V.' 3 ? primary 'Iwai, H.' 4 ? 1 'Afonine, P.V.' 5 ? 1 'Grosse-Kunstleve, R.W.' 6 ? 1 'Echols, N.' 7 ? 1 'Headd, J.J.' 8 ? 1 'Moriarty, N.W.' 9 ? 1 'Mustyakimov, M.' 10 ? 1 'Terwilliger, T.C.' 11 ? 1 'Urzhumtsev, A.' 12 ? 1 'Zwart, P.H.' 13 ? 1 'Adams, P.D.' 14 ? 2 'Adams, P.D.' 15 ? 2 'Afonine, P.V.' 16 ? 2 'Bunkoczi, G.' 17 ? 2 'Chen, V.B.' 18 ? 2 'Davis, I.W.' 19 ? 2 'Echols, N.' 20 ? 2 'Headd, J.J.' 21 ? 2 'Hung, L.W.' 22 ? 2 'Kapral, G.J.' 23 ? 2 'Grosse-Kunstleve, R.W.' 24 ? 2 'McCoy, A.J.' 25 ? 2 'Moriarty, N.W.' 26 ? 2 'Oeffner, R.' 27 ? 2 'Read, R.J.' 28 ? 2 'Richardson, D.C.' 29 ? 2 'Richardson, J.S.' 30 ? 2 'Terwilliger, T.C.' 31 ? 2 'Zwart, P.H.' 32 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cell division control protein' 19000.789 1 ? 'C1A, N164A' ? ;Including three residues of N-terminal "Ser-Ala-Lys", and one residue C-terminal "Ala" extein sequences. ; 2 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 3 non-polymer nat 'DI(HYDROXYETHYL)ETHER' 106.120 1 ? ? ? ? 4 water nat water 18.015 132 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MCM inteins containing helicase,minichromosome maintenance protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SAKAVDYETEVVLGNGERKKIGEIVERAIEEAEKNGKLGRVDDGFYAPIDIEVYSLDLETLKVRKARANIAWKRTAPKKM MLVKTRGGKRIRVTPTHPFFVLEEGKVAMRKARDLEEGNKIATIEGLSVSWDEVAEILEYEPKDPWVYDLQVPGYHNFLA NGIFVHAA ; _entity_poly.pdbx_seq_one_letter_code_can ;SAKAVDYETEVVLGNGERKKIGEIVERAIEEAEKNGKLGRVDDGFYAPIDIEVYSLDLETLKVRKARANIAWKRTAPKKM MLVKTRGGKRIRVTPTHPFFVLEEGKVAMRKARDLEEGNKIATIEGLSVSWDEVAEILEYEPKDPWVYDLQVPGYHNFLA NGIFVHAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ACETATE ION' ACT 3 'DI(HYDROXYETHYL)ETHER' PEG 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ALA n 1 3 LYS n 1 4 ALA n 1 5 VAL n 1 6 ASP n 1 7 TYR n 1 8 GLU n 1 9 THR n 1 10 GLU n 1 11 VAL n 1 12 VAL n 1 13 LEU n 1 14 GLY n 1 15 ASN n 1 16 GLY n 1 17 GLU n 1 18 ARG n 1 19 LYS n 1 20 LYS n 1 21 ILE n 1 22 GLY n 1 23 GLU n 1 24 ILE n 1 25 VAL n 1 26 GLU n 1 27 ARG n 1 28 ALA n 1 29 ILE n 1 30 GLU n 1 31 GLU n 1 32 ALA n 1 33 GLU n 1 34 LYS n 1 35 ASN n 1 36 GLY n 1 37 LYS n 1 38 LEU n 1 39 GLY n 1 40 ARG n 1 41 VAL n 1 42 ASP n 1 43 ASP n 1 44 GLY n 1 45 PHE n 1 46 TYR n 1 47 ALA n 1 48 PRO n 1 49 ILE n 1 50 ASP n 1 51 ILE n 1 52 GLU n 1 53 VAL n 1 54 TYR n 1 55 SER n 1 56 LEU n 1 57 ASP n 1 58 LEU n 1 59 GLU n 1 60 THR n 1 61 LEU n 1 62 LYS n 1 63 VAL n 1 64 ARG n 1 65 LYS n 1 66 ALA n 1 67 ARG n 1 68 ALA n 1 69 ASN n 1 70 ILE n 1 71 ALA n 1 72 TRP n 1 73 LYS n 1 74 ARG n 1 75 THR n 1 76 ALA n 1 77 PRO n 1 78 LYS n 1 79 LYS n 1 80 MET n 1 81 MET n 1 82 LEU n 1 83 VAL n 1 84 LYS n 1 85 THR n 1 86 ARG n 1 87 GLY n 1 88 GLY n 1 89 LYS n 1 90 ARG n 1 91 ILE n 1 92 ARG n 1 93 VAL n 1 94 THR n 1 95 PRO n 1 96 THR n 1 97 HIS n 1 98 PRO n 1 99 PHE n 1 100 PHE n 1 101 VAL n 1 102 LEU n 1 103 GLU n 1 104 GLU n 1 105 GLY n 1 106 LYS n 1 107 VAL n 1 108 ALA n 1 109 MET n 1 110 ARG n 1 111 LYS n 1 112 ALA n 1 113 ARG n 1 114 ASP n 1 115 LEU n 1 116 GLU n 1 117 GLU n 1 118 GLY n 1 119 ASN n 1 120 LYS n 1 121 ILE n 1 122 ALA n 1 123 THR n 1 124 ILE n 1 125 GLU n 1 126 GLY n 1 127 LEU n 1 128 SER n 1 129 VAL n 1 130 SER n 1 131 TRP n 1 132 ASP n 1 133 GLU n 1 134 VAL n 1 135 ALA n 1 136 GLU n 1 137 ILE n 1 138 LEU n 1 139 GLU n 1 140 TYR n 1 141 GLU n 1 142 PRO n 1 143 LYS n 1 144 ASP n 1 145 PRO n 1 146 TRP n 1 147 VAL n 1 148 TYR n 1 149 ASP n 1 150 LEU n 1 151 GLN n 1 152 VAL n 1 153 PRO n 1 154 GLY n 1 155 TYR n 1 156 HIS n 1 157 ASN n 1 158 PHE n 1 159 LEU n 1 160 ALA n 1 161 ASN n 1 162 GLY n 1 163 ILE n 1 164 PHE n 1 165 VAL n 1 166 HIS n 1 167 ALA n 1 168 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 168 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'cdc21, PAB2373' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus abyssi (strain GE5 / Orsay)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272844 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant 'T7 Express' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pBHRSF399 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 -2 SER SER A . n A 1 2 ALA 2 -1 -1 ALA ALA A . n A 1 3 LYS 3 0 0 LYS LYS A . n A 1 4 ALA 4 1 1 ALA ALA A . n A 1 5 VAL 5 2 2 VAL VAL A . n A 1 6 ASP 6 3 3 ASP ASP A . n A 1 7 TYR 7 4 4 TYR TYR A . n A 1 8 GLU 8 5 5 GLU GLU A . n A 1 9 THR 9 6 6 THR THR A . n A 1 10 GLU 10 7 7 GLU GLU A . n A 1 11 VAL 11 8 8 VAL VAL A . n A 1 12 VAL 12 9 9 VAL VAL A . n A 1 13 LEU 13 10 10 LEU LEU A . n A 1 14 GLY 14 11 11 GLY GLY A . n A 1 15 ASN 15 12 12 ASN ASN A . n A 1 16 GLY 16 13 13 GLY GLY A . n A 1 17 GLU 17 14 14 GLU GLU A . n A 1 18 ARG 18 15 15 ARG ARG A . n A 1 19 LYS 19 16 16 LYS LYS A . n A 1 20 LYS 20 17 17 LYS LYS A . n A 1 21 ILE 21 18 18 ILE ILE A . n A 1 22 GLY 22 19 19 GLY GLY A . n A 1 23 GLU 23 20 20 GLU GLU A . n A 1 24 ILE 24 21 21 ILE ILE A . n A 1 25 VAL 25 22 22 VAL VAL A . n A 1 26 GLU 26 23 23 GLU GLU A . n A 1 27 ARG 27 24 24 ARG ARG A . n A 1 28 ALA 28 25 25 ALA ALA A . n A 1 29 ILE 29 26 26 ILE ILE A . n A 1 30 GLU 30 27 27 GLU GLU A . n A 1 31 GLU 31 28 28 GLU GLU A . n A 1 32 ALA 32 29 29 ALA ALA A . n A 1 33 GLU 33 30 30 GLU GLU A . n A 1 34 LYS 34 31 31 LYS LYS A . n A 1 35 ASN 35 32 32 ASN ASN A . n A 1 36 GLY 36 33 33 GLY GLY A . n A 1 37 LYS 37 34 34 LYS LYS A . n A 1 38 LEU 38 35 35 LEU LEU A . n A 1 39 GLY 39 36 36 GLY GLY A . n A 1 40 ARG 40 37 37 ARG ARG A . n A 1 41 VAL 41 38 38 VAL VAL A . n A 1 42 ASP 42 39 39 ASP ASP A . n A 1 43 ASP 43 40 40 ASP ASP A . n A 1 44 GLY 44 41 41 GLY GLY A . n A 1 45 PHE 45 42 42 PHE PHE A . n A 1 46 TYR 46 43 43 TYR TYR A . n A 1 47 ALA 47 44 44 ALA ALA A . n A 1 48 PRO 48 45 45 PRO PRO A . n A 1 49 ILE 49 46 46 ILE ILE A . n A 1 50 ASP 50 47 47 ASP ASP A . n A 1 51 ILE 51 48 48 ILE ILE A . n A 1 52 GLU 52 49 49 GLU GLU A . n A 1 53 VAL 53 50 50 VAL VAL A . n A 1 54 TYR 54 51 51 TYR TYR A . n A 1 55 SER 55 52 52 SER SER A . n A 1 56 LEU 56 53 53 LEU LEU A . n A 1 57 ASP 57 54 54 ASP ASP A . n A 1 58 LEU 58 55 55 LEU LEU A . n A 1 59 GLU 59 56 56 GLU GLU A . n A 1 60 THR 60 57 57 THR THR A . n A 1 61 LEU 61 58 58 LEU LEU A . n A 1 62 LYS 62 59 59 LYS LYS A . n A 1 63 VAL 63 60 60 VAL VAL A . n A 1 64 ARG 64 61 61 ARG ARG A . n A 1 65 LYS 65 62 62 LYS LYS A . n A 1 66 ALA 66 63 63 ALA ALA A . n A 1 67 ARG 67 64 64 ARG ARG A . n A 1 68 ALA 68 65 65 ALA ALA A . n A 1 69 ASN 69 66 66 ASN ASN A . n A 1 70 ILE 70 67 67 ILE ILE A . n A 1 71 ALA 71 68 68 ALA ALA A . n A 1 72 TRP 72 69 69 TRP TRP A . n A 1 73 LYS 73 70 70 LYS LYS A . n A 1 74 ARG 74 71 71 ARG ARG A . n A 1 75 THR 75 72 72 THR THR A . n A 1 76 ALA 76 73 73 ALA ALA A . n A 1 77 PRO 77 74 74 PRO PRO A . n A 1 78 LYS 78 75 75 LYS LYS A . n A 1 79 LYS 79 76 76 LYS LYS A . n A 1 80 MET 80 77 77 MET MET A . n A 1 81 MET 81 78 78 MET MET A . n A 1 82 LEU 82 79 79 LEU LEU A . n A 1 83 VAL 83 80 80 VAL VAL A . n A 1 84 LYS 84 81 81 LYS LYS A . n A 1 85 THR 85 82 82 THR THR A . n A 1 86 ARG 86 83 83 ARG ARG A . n A 1 87 GLY 87 84 84 GLY GLY A . n A 1 88 GLY 88 85 85 GLY GLY A . n A 1 89 LYS 89 86 86 LYS LYS A . n A 1 90 ARG 90 87 87 ARG ARG A . n A 1 91 ILE 91 88 88 ILE ILE A . n A 1 92 ARG 92 89 89 ARG ARG A . n A 1 93 VAL 93 90 90 VAL VAL A . n A 1 94 THR 94 91 91 THR THR A . n A 1 95 PRO 95 92 92 PRO PRO A . n A 1 96 THR 96 93 93 THR THR A . n A 1 97 HIS 97 94 94 HIS HIS A . n A 1 98 PRO 98 95 95 PRO PRO A . n A 1 99 PHE 99 96 96 PHE PHE A . n A 1 100 PHE 100 97 97 PHE PHE A . n A 1 101 VAL 101 98 98 VAL VAL A . n A 1 102 LEU 102 99 99 LEU LEU A . n A 1 103 GLU 103 100 100 GLU GLU A . n A 1 104 GLU 104 101 101 GLU GLU A . n A 1 105 GLY 105 102 102 GLY GLY A . n A 1 106 LYS 106 103 103 LYS LYS A . n A 1 107 VAL 107 104 104 VAL VAL A . n A 1 108 ALA 108 105 105 ALA ALA A . n A 1 109 MET 109 106 106 MET MET A . n A 1 110 ARG 110 107 107 ARG ARG A . n A 1 111 LYS 111 108 108 LYS LYS A . n A 1 112 ALA 112 109 109 ALA ALA A . n A 1 113 ARG 113 110 110 ARG ARG A . n A 1 114 ASP 114 111 111 ASP ASP A . n A 1 115 LEU 115 112 112 LEU LEU A . n A 1 116 GLU 116 113 113 GLU GLU A . n A 1 117 GLU 117 114 114 GLU GLU A . n A 1 118 GLY 118 115 115 GLY GLY A . n A 1 119 ASN 119 116 116 ASN ASN A . n A 1 120 LYS 120 117 117 LYS LYS A . n A 1 121 ILE 121 118 118 ILE ILE A . n A 1 122 ALA 122 119 119 ALA ALA A . n A 1 123 THR 123 120 120 THR THR A . n A 1 124 ILE 124 121 121 ILE ILE A . n A 1 125 GLU 125 122 122 GLU GLU A . n A 1 126 GLY 126 123 123 GLY GLY A . n A 1 127 LEU 127 124 124 LEU LEU A . n A 1 128 SER 128 125 125 SER SER A . n A 1 129 VAL 129 126 126 VAL VAL A . n A 1 130 SER 130 127 127 SER SER A . n A 1 131 TRP 131 128 128 TRP TRP A . n A 1 132 ASP 132 129 129 ASP ASP A . n A 1 133 GLU 133 130 130 GLU GLU A . n A 1 134 VAL 134 131 131 VAL VAL A . n A 1 135 ALA 135 132 132 ALA ALA A . n A 1 136 GLU 136 133 133 GLU GLU A . n A 1 137 ILE 137 134 134 ILE ILE A . n A 1 138 LEU 138 135 135 LEU LEU A . n A 1 139 GLU 139 136 136 GLU GLU A . n A 1 140 TYR 140 137 137 TYR TYR A . n A 1 141 GLU 141 138 138 GLU GLU A . n A 1 142 PRO 142 139 139 PRO PRO A . n A 1 143 LYS 143 140 140 LYS LYS A . n A 1 144 ASP 144 141 141 ASP ASP A . n A 1 145 PRO 145 142 142 PRO PRO A . n A 1 146 TRP 146 143 143 TRP TRP A . n A 1 147 VAL 147 144 144 VAL VAL A . n A 1 148 TYR 148 145 145 TYR TYR A . n A 1 149 ASP 149 146 146 ASP ASP A . n A 1 150 LEU 150 147 147 LEU LEU A . n A 1 151 GLN 151 148 148 GLN GLN A . n A 1 152 VAL 152 149 149 VAL VAL A . n A 1 153 PRO 153 150 150 PRO PRO A . n A 1 154 GLY 154 151 151 GLY GLY A . n A 1 155 TYR 155 152 152 TYR TYR A . n A 1 156 HIS 156 153 153 HIS HIS A . n A 1 157 ASN 157 154 154 ASN ASN A . n A 1 158 PHE 158 155 155 PHE PHE A . n A 1 159 LEU 159 156 156 LEU LEU A . n A 1 160 ALA 160 157 157 ALA ALA A . n A 1 161 ASN 161 158 158 ASN ASN A . n A 1 162 GLY 162 159 159 GLY GLY A . n A 1 163 ILE 163 160 160 ILE ILE A . n A 1 164 PHE 164 161 161 PHE PHE A . n A 1 165 VAL 165 162 162 VAL VAL A . n A 1 166 HIS 166 163 163 HIS HIS A . n A 1 167 ALA 167 164 164 ALA ALA A . n A 1 168 ALA 168 165 165 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ACT 1 201 1 ACT ACT A . C 3 PEG 1 202 1 PEG PEG A . D 4 HOH 1 301 120 HOH HOH A . D 4 HOH 2 302 63 HOH HOH A . D 4 HOH 3 303 132 HOH HOH A . D 4 HOH 4 304 71 HOH HOH A . D 4 HOH 5 305 30 HOH HOH A . D 4 HOH 6 306 72 HOH HOH A . D 4 HOH 7 307 12 HOH HOH A . D 4 HOH 8 308 8 HOH HOH A . D 4 HOH 9 309 15 HOH HOH A . D 4 HOH 10 310 50 HOH HOH A . D 4 HOH 11 311 48 HOH HOH A . D 4 HOH 12 312 51 HOH HOH A . D 4 HOH 13 313 103 HOH HOH A . D 4 HOH 14 314 54 HOH HOH A . D 4 HOH 15 315 6 HOH HOH A . D 4 HOH 16 316 36 HOH HOH A . D 4 HOH 17 317 106 HOH HOH A . D 4 HOH 18 318 35 HOH HOH A . D 4 HOH 19 319 27 HOH HOH A . D 4 HOH 20 320 88 HOH HOH A . D 4 HOH 21 321 100 HOH HOH A . D 4 HOH 22 322 1 HOH HOH A . D 4 HOH 23 323 53 HOH HOH A . D 4 HOH 24 324 125 HOH HOH A . D 4 HOH 25 325 80 HOH HOH A . D 4 HOH 26 326 58 HOH HOH A . D 4 HOH 27 327 19 HOH HOH A . D 4 HOH 28 328 75 HOH HOH A . D 4 HOH 29 329 42 HOH HOH A . D 4 HOH 30 330 49 HOH HOH A . D 4 HOH 31 331 82 HOH HOH A . D 4 HOH 32 332 131 HOH HOH A . D 4 HOH 33 333 45 HOH HOH A . D 4 HOH 34 334 4 HOH HOH A . D 4 HOH 35 335 14 HOH HOH A . D 4 HOH 36 336 21 HOH HOH A . D 4 HOH 37 337 66 HOH HOH A . D 4 HOH 38 338 2 HOH HOH A . D 4 HOH 39 339 67 HOH HOH A . D 4 HOH 40 340 90 HOH HOH A . D 4 HOH 41 341 98 HOH HOH A . D 4 HOH 42 342 9 HOH HOH A . D 4 HOH 43 343 13 HOH HOH A . D 4 HOH 44 344 40 HOH HOH A . D 4 HOH 45 345 18 HOH HOH A . D 4 HOH 46 346 68 HOH HOH A . D 4 HOH 47 347 73 HOH HOH A . D 4 HOH 48 348 31 HOH HOH A . D 4 HOH 49 349 123 HOH HOH A . D 4 HOH 50 350 26 HOH HOH A . D 4 HOH 51 351 69 HOH HOH A . D 4 HOH 52 352 3 HOH HOH A . D 4 HOH 53 353 118 HOH HOH A . D 4 HOH 54 354 10 HOH HOH A . D 4 HOH 55 355 113 HOH HOH A . D 4 HOH 56 356 43 HOH HOH A . D 4 HOH 57 357 64 HOH HOH A . D 4 HOH 58 358 97 HOH HOH A . D 4 HOH 59 359 11 HOH HOH A . D 4 HOH 60 360 96 HOH HOH A . D 4 HOH 61 361 44 HOH HOH A . D 4 HOH 62 362 22 HOH HOH A . D 4 HOH 63 363 87 HOH HOH A . D 4 HOH 64 364 57 HOH HOH A . D 4 HOH 65 365 92 HOH HOH A . D 4 HOH 66 366 39 HOH HOH A . D 4 HOH 67 367 129 HOH HOH A . D 4 HOH 68 368 25 HOH HOH A . D 4 HOH 69 369 122 HOH HOH A . D 4 HOH 70 370 83 HOH HOH A . D 4 HOH 71 371 52 HOH HOH A . D 4 HOH 72 372 77 HOH HOH A . D 4 HOH 73 373 5 HOH HOH A . D 4 HOH 74 374 41 HOH HOH A . D 4 HOH 75 375 17 HOH HOH A . D 4 HOH 76 376 29 HOH HOH A . D 4 HOH 77 377 56 HOH HOH A . D 4 HOH 78 378 91 HOH HOH A . D 4 HOH 79 379 37 HOH HOH A . D 4 HOH 80 380 32 HOH HOH A . D 4 HOH 81 381 102 HOH HOH A . D 4 HOH 82 382 107 HOH HOH A . D 4 HOH 83 383 23 HOH HOH A . D 4 HOH 84 384 112 HOH HOH A . D 4 HOH 85 385 7 HOH HOH A . D 4 HOH 86 386 95 HOH HOH A . D 4 HOH 87 387 109 HOH HOH A . D 4 HOH 88 388 34 HOH HOH A . D 4 HOH 89 389 62 HOH HOH A . D 4 HOH 90 390 65 HOH HOH A . D 4 HOH 91 391 28 HOH HOH A . D 4 HOH 92 392 61 HOH HOH A . D 4 HOH 93 393 121 HOH HOH A . D 4 HOH 94 394 116 HOH HOH A . D 4 HOH 95 395 38 HOH HOH A . D 4 HOH 96 396 16 HOH HOH A . D 4 HOH 97 397 20 HOH HOH A . D 4 HOH 98 398 105 HOH HOH A . D 4 HOH 99 399 104 HOH HOH A . D 4 HOH 100 400 101 HOH HOH A . D 4 HOH 101 401 33 HOH HOH A . D 4 HOH 102 402 110 HOH HOH A . D 4 HOH 103 403 115 HOH HOH A . D 4 HOH 104 404 126 HOH HOH A . D 4 HOH 105 405 59 HOH HOH A . D 4 HOH 106 406 127 HOH HOH A . D 4 HOH 107 407 128 HOH HOH A . D 4 HOH 108 408 93 HOH HOH A . D 4 HOH 109 409 130 HOH HOH A . D 4 HOH 110 410 119 HOH HOH A . D 4 HOH 111 411 70 HOH HOH A . D 4 HOH 112 412 99 HOH HOH A . D 4 HOH 113 413 124 HOH HOH A . D 4 HOH 114 414 86 HOH HOH A . D 4 HOH 115 415 84 HOH HOH A . D 4 HOH 116 416 24 HOH HOH A . D 4 HOH 117 417 108 HOH HOH A . D 4 HOH 118 418 94 HOH HOH A . D 4 HOH 119 419 55 HOH HOH A . D 4 HOH 120 420 79 HOH HOH A . D 4 HOH 121 421 85 HOH HOH A . D 4 HOH 122 422 76 HOH HOH A . D 4 HOH 123 423 89 HOH HOH A . D 4 HOH 124 424 74 HOH HOH A . D 4 HOH 125 425 114 HOH HOH A . D 4 HOH 126 426 111 HOH HOH A . D 4 HOH 127 427 47 HOH HOH A . D 4 HOH 128 428 46 HOH HOH A . D 4 HOH 129 429 60 HOH HOH A . D 4 HOH 130 430 81 HOH HOH A . D 4 HOH 131 431 117 HOH HOH A . D 4 HOH 132 432 78 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? ARP/wARP ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15.1_3469 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6RPP _cell.details ? _cell.formula_units_Z ? _cell.length_a 75.481 _cell.length_a_esd ? _cell.length_b 93.588 _cell.length_b_esd ? _cell.length_c 49.746 _cell.length_c_esd ? _cell.volume 351411.506 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6RPP _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6RPP _exptl.crystals_number 2 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.31 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.80 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'sodium acetate, polyethylene glycol 4000, ammonium acetate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-05-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9763 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9763 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 22.45 _reflns.entry_id 6RPP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.60 _reflns.d_resolution_low 29.38 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23504 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.37 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.059 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.70 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.58 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3723 _reflns_shell.percent_possible_all 99.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 12.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.595 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.929 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 29.90 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6RPP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.60 _refine.ls_d_res_low 29.38 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23498 _refine.ls_number_reflns_R_free 1178 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.91 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1802 _refine.ls_R_factor_R_free 0.2178 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1782 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4O1S _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.2505 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1864 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.60 _refine_hist.d_res_low 29.38 _refine_hist.number_atoms_solvent 132 _refine_hist.number_atoms_total 1482 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1339 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0139 ? 1397 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.3840 ? 1885 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0848 ? 204 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0094 ? 245 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 6.3305 ? 1181 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.60 1.68 . . 160 2735 99.45 . . . 0.2455 . 0.2219 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.68 1.76 . . 121 2770 99.93 . . . 0.2573 . 0.2050 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.76 1.88 . . 154 2740 100.00 . . . 0.2323 . 0.1983 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.88 2.02 . . 135 2770 100.00 . . . 0.2301 . 0.1854 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.02 2.22 . . 136 2793 100.00 . . . 0.2330 . 0.1814 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.22 2.54 . . 145 2782 100.00 . . . 0.2258 . 0.1824 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.54 3.21 . . 160 2807 99.97 . . . 0.1949 . 0.1872 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.21 29.38 . . 167 2923 99.97 . . . 0.2147 . 0.1611 . . . . . . . . . . # _struct.entry_id 6RPP _struct.title 'Crystal structure of PabCDC21-1 intein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6RPP _struct_keywords.text 'intein, protein-splicing, HINT, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9UYR7_PYRAB _struct_ref.pdbx_db_accession Q9UYR7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AKCVDYETEVVLGNGERKKIGEIVERAIEEAEKNGKLGRVDDGFYAPIDIEVYSLDLETLKVRKARANIAWKRTAPKKMM LVKTRGGKRIRVTPTHPFFVLEEGKVAMRKARDLEEGNKIATIEGLSVSWDEVAEILEYEPKDPWVYDLQVPGYHNFLAN GIFVHN ; _struct_ref.pdbx_align_begin 333 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6RPP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 167 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UYR7 _struct_ref_seq.db_align_beg 333 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 498 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -1 _struct_ref_seq.pdbx_auth_seq_align_end 164 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6RPP SER A 1 ? UNP Q9UYR7 ? ? 'expression tag' -2 1 1 6RPP ALA A 4 ? UNP Q9UYR7 CYS 335 'engineered mutation' 1 2 1 6RPP ALA A 167 ? UNP Q9UYR7 ASN 498 'engineered mutation' 164 3 1 6RPP ALA A 168 ? UNP Q9UYR7 ? ? 'expression tag' 165 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 270 ? 1 MORE 2 ? 1 'SSA (A^2)' 8970 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 21 ? GLY A 36 ? ILE A 18 GLY A 33 1 ? 16 HELX_P HELX_P2 AA2 ARG A 113 ? LEU A 115 ? ARG A 110 LEU A 112 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 4 ? AA3 ? 6 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 10 ? VAL A 11 ? GLU A 7 VAL A 8 AA1 2 LYS A 19 ? LYS A 20 ? LYS A 16 LYS A 17 AA2 1 GLY A 39 ? VAL A 41 ? GLY A 36 VAL A 38 AA2 2 GLY A 44 ? LEU A 56 ? GLY A 41 LEU A 53 AA2 3 VAL A 63 ? THR A 75 ? VAL A 60 THR A 72 AA2 4 TRP A 146 ? GLN A 151 ? TRP A 143 GLN A 148 AA3 1 ARG A 90 ? VAL A 93 ? ARG A 87 VAL A 90 AA3 2 MET A 80 ? THR A 85 ? MET A 77 THR A 82 AA3 3 SER A 128 ? TYR A 140 ? SER A 125 TYR A 137 AA3 4 LYS A 120 ? GLU A 125 ? LYS A 117 GLU A 122 AA3 5 PRO A 98 ? GLU A 103 ? PRO A 95 GLU A 100 AA3 6 LYS A 106 ? LYS A 111 ? LYS A 103 LYS A 108 AA4 1 ASN A 157 ? ALA A 160 ? ASN A 154 ALA A 157 AA4 2 ILE A 163 ? HIS A 166 ? ILE A 160 HIS A 163 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 11 ? N VAL A 8 O LYS A 19 ? O LYS A 16 AA2 1 2 N GLY A 39 ? N GLY A 36 O TYR A 46 ? O TYR A 43 AA2 2 3 N VAL A 53 ? N VAL A 50 O ALA A 66 ? O ALA A 63 AA2 3 4 N ARG A 74 ? N ARG A 71 O VAL A 147 ? O VAL A 144 AA3 1 2 O ILE A 91 ? O ILE A 88 N VAL A 83 ? N VAL A 80 AA3 2 3 N LEU A 82 ? N LEU A 79 O LEU A 138 ? O LEU A 135 AA3 3 4 O SER A 128 ? O SER A 125 N GLU A 125 ? N GLU A 122 AA3 4 5 O LYS A 120 ? O LYS A 117 N LEU A 102 ? N LEU A 99 AA3 5 6 N VAL A 101 ? N VAL A 98 O ALA A 108 ? O ALA A 105 AA4 1 2 N PHE A 158 ? N PHE A 155 O VAL A 165 ? O VAL A 162 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ACT 201 ? 2 'binding site for residue ACT A 201' AC2 Software A PEG 202 ? 4 'binding site for residue PEG A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 VAL A 107 ? VAL A 104 . ? 4_556 ? 2 AC1 2 VAL A 107 ? VAL A 104 . ? 1_555 ? 3 AC2 4 GLY A 14 ? GLY A 11 . ? 1_555 ? 4 AC2 4 ASN A 15 ? ASN A 12 . ? 1_555 ? 5 AC2 4 LYS A 65 ? LYS A 62 . ? 1_555 ? 6 AC2 4 GLU A 141 ? GLU A 138 . ? 6_555 ? # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 55 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 55 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 55 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 100.23 _pdbx_validate_rmsd_angle.angle_target_value 115.30 _pdbx_validate_rmsd_angle.angle_deviation -15.07 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 12 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -143.98 _pdbx_validate_torsion.psi 26.94 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A ACT 201 ? B ACT . 2 1 A ACT 201 ? B ACT . 3 1 A HOH 411 ? D HOH . 4 1 A HOH 429 ? D HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 23.2010631399 18.8635885389 18.8748596234 0.174860517046 ? 0.00148718089161 ? 0.00493890739088 ? 0.138046247906 ? 0.00762548420686 ? 0.18902248504 ? 3.26365502092 ? -0.829336452975 ? -0.718130145307 ? 2.76443631025 ? -0.554504455118 ? 4.5072115125 ? -0.0933691493048 ? 0.0259697420315 ? 0.101431640483 ? -0.0210467203426 ? 0.094633929088 ? -0.20603131621 ? -0.210682282381 ? 0.242067880756 ? -0.0523200066158 ? 2 'X-RAY DIFFRACTION' ? refined 29.1607332134 12.2003698764 6.96367898641 0.221208732185 ? 0.0362317459659 ? 0.0205644537812 ? 0.234645443058 ? 0.0110957479747 ? 0.222762895293 ? 4.04717899937 ? -0.985283350621 ? -1.86801130313 ? 3.73540991538 ? -0.0795033427904 ? 4.33352397827 ? 0.0321726075749 ? 0.417753327709 ? -0.160637284003 ? -0.420931200602 ? -0.283785978078 ? -0.172010532065 ? 0.196174642046 ? 0.106602642664 ? 0.0730435233897 ? 3 'X-RAY DIFFRACTION' ? refined 20.6217054002 6.81066213511 29.5733237482 0.283465956181 ? 0.0241300788594 ? -0.0385213665253 ? 0.190890617196 ? 0.0373902825273 ? 0.222612235459 ? 5.17219139691 ? 1.92379020295 ? -3.12856099016 ? 3.24898034323 ? -1.77402807766 ? 4.29529199753 ? -0.0878563669029 ? -0.399720059957 ? -0.354156786788 ? 0.479914538926 ? -0.135768187289 ? -0.3164086498 ? 0.182873122038 ? 0.421046927689 ? 0.231381987816 ? 4 'X-RAY DIFFRACTION' ? refined 24.1007156046 8.90059767316 17.1251047921 0.138566562412 ? -0.037891590374 ? -0.0021504210122 ? 0.129113406814 ? 0.00605135948916 ? 0.223140236657 ? 2.884420059 ? -1.51693862424 ? 0.21113535512 ? 3.75969721518 ? -1.33066602737 ? 6.3905170871 ? -0.0558100726216 ? 0.0535448125006 ? -0.0693104669565 ? -0.0846075129498 ? -0.278451567249 ? -0.286843245928 ? 0.585727152586 ? 0.621372081734 ? 0.0705025548021 ? 5 'X-RAY DIFFRACTION' ? refined 9.5357478096 20.8740120208 17.2585739821 0.141149338204 ? 0.0170258995862 ? -0.0304272961982 ? 0.149768193412 ? 0.0100350868827 ? 0.173030987435 ? 2.36660271499 ? -0.0140890213948 ? -0.388470252883 ? 2.03753366891 ? 0.516870261971 ? 7.57500635703 ? 0.0625637885402 ? -0.0682487971921 ? 0.141738382133 ? -0.0333317474385 ? 0.0035408854804 ? 0.208551023024 ? -0.392574170924 ? -0.354243459857 ? 0.0646284336512 ? 6 'X-RAY DIFFRACTION' ? refined 4.66060285797 9.14639925622 23.2009298371 0.270003806681 ? -0.0921514833588 ? 0.0361303321838 ? 0.317405770391 ? 0.0367381733262 ? 0.33646256115 ? 3.88537094725 ? 0.392050930456 ? -1.22708807512 ? 5.77815036784 ? -2.55147902116 ? 4.87493788076 ? 0.0976862232614 ? -0.398205120781 ? -0.36479428469 ? 0.177629564407 ? -0.187788533133 ? 0.740280712283 ? 0.766735042736 ? -0.712821740399 ? 0.0274798417755 ? 7 'X-RAY DIFFRACTION' ? refined 12.9103526593 16.0703722795 21.8678800704 0.15833789379 ? -0.0215341405739 ? -0.0131984188333 ? 0.148437305591 ? -0.00784654888298 ? 0.181587789074 ? 1.44956875142 ? -0.0939491715589 ? -0.436697414454 ? 1.35616007995 ? -0.708392986472 ? 2.48370575546 ? -0.0275936307661 ? -0.0466036011208 ? -0.109371712646 ? 0.0492839949053 ? 0.00699320430551 ? 0.160342109365 ? 0.0167759883406 ? -0.216650945942 ? 0.015368773257 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid -2 through 17 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 18 through 47 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 48 through 59 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 60 through 72 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 73 through 94 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 95 through 111 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 112 through 165 ) ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACT C C N N 1 ACT O O N N 2 ACT OXT O N N 3 ACT CH3 C N N 4 ACT H1 H N N 5 ACT H2 H N N 6 ACT H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 CYS N N N N 81 CYS CA C N R 82 CYS C C N N 83 CYS O O N N 84 CYS CB C N N 85 CYS SG S N N 86 CYS OXT O N N 87 CYS H H N N 88 CYS H2 H N N 89 CYS HA H N N 90 CYS HB2 H N N 91 CYS HB3 H N N 92 CYS HG H N N 93 CYS HXT H N N 94 GLN N N N N 95 GLN CA C N S 96 GLN C C N N 97 GLN O O N N 98 GLN CB C N N 99 GLN CG C N N 100 GLN CD C N N 101 GLN OE1 O N N 102 GLN NE2 N N N 103 GLN OXT O N N 104 GLN H H N N 105 GLN H2 H N N 106 GLN HA H N N 107 GLN HB2 H N N 108 GLN HB3 H N N 109 GLN HG2 H N N 110 GLN HG3 H N N 111 GLN HE21 H N N 112 GLN HE22 H N N 113 GLN HXT H N N 114 GLU N N N N 115 GLU CA C N S 116 GLU C C N N 117 GLU O O N N 118 GLU CB C N N 119 GLU CG C N N 120 GLU CD C N N 121 GLU OE1 O N N 122 GLU OE2 O N N 123 GLU OXT O N N 124 GLU H H N N 125 GLU H2 H N N 126 GLU HA H N N 127 GLU HB2 H N N 128 GLU HB3 H N N 129 GLU HG2 H N N 130 GLU HG3 H N N 131 GLU HE2 H N N 132 GLU HXT H N N 133 GLY N N N N 134 GLY CA C N N 135 GLY C C N N 136 GLY O O N N 137 GLY OXT O N N 138 GLY H H N N 139 GLY H2 H N N 140 GLY HA2 H N N 141 GLY HA3 H N N 142 GLY HXT H N N 143 HIS N N N N 144 HIS CA C N S 145 HIS C C N N 146 HIS O O N N 147 HIS CB C N N 148 HIS CG C Y N 149 HIS ND1 N Y N 150 HIS CD2 C Y N 151 HIS CE1 C Y N 152 HIS NE2 N Y N 153 HIS OXT O N N 154 HIS H H N N 155 HIS H2 H N N 156 HIS HA H N N 157 HIS HB2 H N N 158 HIS HB3 H N N 159 HIS HD1 H N N 160 HIS HD2 H N N 161 HIS HE1 H N N 162 HIS HE2 H N N 163 HIS HXT H N N 164 HOH O O N N 165 HOH H1 H N N 166 HOH H2 H N N 167 ILE N N N N 168 ILE CA C N S 169 ILE C C N N 170 ILE O O N N 171 ILE CB C N S 172 ILE CG1 C N N 173 ILE CG2 C N N 174 ILE CD1 C N N 175 ILE OXT O N N 176 ILE H H N N 177 ILE H2 H N N 178 ILE HA H N N 179 ILE HB H N N 180 ILE HG12 H N N 181 ILE HG13 H N N 182 ILE HG21 H N N 183 ILE HG22 H N N 184 ILE HG23 H N N 185 ILE HD11 H N N 186 ILE HD12 H N N 187 ILE HD13 H N N 188 ILE HXT H N N 189 LEU N N N N 190 LEU CA C N S 191 LEU C C N N 192 LEU O O N N 193 LEU CB C N N 194 LEU CG C N N 195 LEU CD1 C N N 196 LEU CD2 C N N 197 LEU OXT O N N 198 LEU H H N N 199 LEU H2 H N N 200 LEU HA H N N 201 LEU HB2 H N N 202 LEU HB3 H N N 203 LEU HG H N N 204 LEU HD11 H N N 205 LEU HD12 H N N 206 LEU HD13 H N N 207 LEU HD21 H N N 208 LEU HD22 H N N 209 LEU HD23 H N N 210 LEU HXT H N N 211 LYS N N N N 212 LYS CA C N S 213 LYS C C N N 214 LYS O O N N 215 LYS CB C N N 216 LYS CG C N N 217 LYS CD C N N 218 LYS CE C N N 219 LYS NZ N N N 220 LYS OXT O N N 221 LYS H H N N 222 LYS H2 H N N 223 LYS HA H N N 224 LYS HB2 H N N 225 LYS HB3 H N N 226 LYS HG2 H N N 227 LYS HG3 H N N 228 LYS HD2 H N N 229 LYS HD3 H N N 230 LYS HE2 H N N 231 LYS HE3 H N N 232 LYS HZ1 H N N 233 LYS HZ2 H N N 234 LYS HZ3 H N N 235 LYS HXT H N N 236 MET N N N N 237 MET CA C N S 238 MET C C N N 239 MET O O N N 240 MET CB C N N 241 MET CG C N N 242 MET SD S N N 243 MET CE C N N 244 MET OXT O N N 245 MET H H N N 246 MET H2 H N N 247 MET HA H N N 248 MET HB2 H N N 249 MET HB3 H N N 250 MET HG2 H N N 251 MET HG3 H N N 252 MET HE1 H N N 253 MET HE2 H N N 254 MET HE3 H N N 255 MET HXT H N N 256 PEG C1 C N N 257 PEG O1 O N N 258 PEG C2 C N N 259 PEG O2 O N N 260 PEG C3 C N N 261 PEG C4 C N N 262 PEG O4 O N N 263 PEG H11 H N N 264 PEG H12 H N N 265 PEG HO1 H N N 266 PEG H21 H N N 267 PEG H22 H N N 268 PEG H31 H N N 269 PEG H32 H N N 270 PEG H41 H N N 271 PEG H42 H N N 272 PEG HO4 H N N 273 PHE N N N N 274 PHE CA C N S 275 PHE C C N N 276 PHE O O N N 277 PHE CB C N N 278 PHE CG C Y N 279 PHE CD1 C Y N 280 PHE CD2 C Y N 281 PHE CE1 C Y N 282 PHE CE2 C Y N 283 PHE CZ C Y N 284 PHE OXT O N N 285 PHE H H N N 286 PHE H2 H N N 287 PHE HA H N N 288 PHE HB2 H N N 289 PHE HB3 H N N 290 PHE HD1 H N N 291 PHE HD2 H N N 292 PHE HE1 H N N 293 PHE HE2 H N N 294 PHE HZ H N N 295 PHE HXT H N N 296 PRO N N N N 297 PRO CA C N S 298 PRO C C N N 299 PRO O O N N 300 PRO CB C N N 301 PRO CG C N N 302 PRO CD C N N 303 PRO OXT O N N 304 PRO H H N N 305 PRO HA H N N 306 PRO HB2 H N N 307 PRO HB3 H N N 308 PRO HG2 H N N 309 PRO HG3 H N N 310 PRO HD2 H N N 311 PRO HD3 H N N 312 PRO HXT H N N 313 SER N N N N 314 SER CA C N S 315 SER C C N N 316 SER O O N N 317 SER CB C N N 318 SER OG O N N 319 SER OXT O N N 320 SER H H N N 321 SER H2 H N N 322 SER HA H N N 323 SER HB2 H N N 324 SER HB3 H N N 325 SER HG H N N 326 SER HXT H N N 327 THR N N N N 328 THR CA C N S 329 THR C C N N 330 THR O O N N 331 THR CB C N R 332 THR OG1 O N N 333 THR CG2 C N N 334 THR OXT O N N 335 THR H H N N 336 THR H2 H N N 337 THR HA H N N 338 THR HB H N N 339 THR HG1 H N N 340 THR HG21 H N N 341 THR HG22 H N N 342 THR HG23 H N N 343 THR HXT H N N 344 TRP N N N N 345 TRP CA C N S 346 TRP C C N N 347 TRP O O N N 348 TRP CB C N N 349 TRP CG C Y N 350 TRP CD1 C Y N 351 TRP CD2 C Y N 352 TRP NE1 N Y N 353 TRP CE2 C Y N 354 TRP CE3 C Y N 355 TRP CZ2 C Y N 356 TRP CZ3 C Y N 357 TRP CH2 C Y N 358 TRP OXT O N N 359 TRP H H N N 360 TRP H2 H N N 361 TRP HA H N N 362 TRP HB2 H N N 363 TRP HB3 H N N 364 TRP HD1 H N N 365 TRP HE1 H N N 366 TRP HE3 H N N 367 TRP HZ2 H N N 368 TRP HZ3 H N N 369 TRP HH2 H N N 370 TRP HXT H N N 371 TYR N N N N 372 TYR CA C N S 373 TYR C C N N 374 TYR O O N N 375 TYR CB C N N 376 TYR CG C Y N 377 TYR CD1 C Y N 378 TYR CD2 C Y N 379 TYR CE1 C Y N 380 TYR CE2 C Y N 381 TYR CZ C Y N 382 TYR OH O N N 383 TYR OXT O N N 384 TYR H H N N 385 TYR H2 H N N 386 TYR HA H N N 387 TYR HB2 H N N 388 TYR HB3 H N N 389 TYR HD1 H N N 390 TYR HD2 H N N 391 TYR HE1 H N N 392 TYR HE2 H N N 393 TYR HH H N N 394 TYR HXT H N N 395 VAL N N N N 396 VAL CA C N S 397 VAL C C N N 398 VAL O O N N 399 VAL CB C N N 400 VAL CG1 C N N 401 VAL CG2 C N N 402 VAL OXT O N N 403 VAL H H N N 404 VAL H2 H N N 405 VAL HA H N N 406 VAL HB H N N 407 VAL HG11 H N N 408 VAL HG12 H N N 409 VAL HG13 H N N 410 VAL HG21 H N N 411 VAL HG22 H N N 412 VAL HG23 H N N 413 VAL HXT H N N 414 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACT C O doub N N 1 ACT C OXT sing N N 2 ACT C CH3 sing N N 3 ACT CH3 H1 sing N N 4 ACT CH3 H2 sing N N 5 ACT CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 CYS N CA sing N N 76 CYS N H sing N N 77 CYS N H2 sing N N 78 CYS CA C sing N N 79 CYS CA CB sing N N 80 CYS CA HA sing N N 81 CYS C O doub N N 82 CYS C OXT sing N N 83 CYS CB SG sing N N 84 CYS CB HB2 sing N N 85 CYS CB HB3 sing N N 86 CYS SG HG sing N N 87 CYS OXT HXT sing N N 88 GLN N CA sing N N 89 GLN N H sing N N 90 GLN N H2 sing N N 91 GLN CA C sing N N 92 GLN CA CB sing N N 93 GLN CA HA sing N N 94 GLN C O doub N N 95 GLN C OXT sing N N 96 GLN CB CG sing N N 97 GLN CB HB2 sing N N 98 GLN CB HB3 sing N N 99 GLN CG CD sing N N 100 GLN CG HG2 sing N N 101 GLN CG HG3 sing N N 102 GLN CD OE1 doub N N 103 GLN CD NE2 sing N N 104 GLN NE2 HE21 sing N N 105 GLN NE2 HE22 sing N N 106 GLN OXT HXT sing N N 107 GLU N CA sing N N 108 GLU N H sing N N 109 GLU N H2 sing N N 110 GLU CA C sing N N 111 GLU CA CB sing N N 112 GLU CA HA sing N N 113 GLU C O doub N N 114 GLU C OXT sing N N 115 GLU CB CG sing N N 116 GLU CB HB2 sing N N 117 GLU CB HB3 sing N N 118 GLU CG CD sing N N 119 GLU CG HG2 sing N N 120 GLU CG HG3 sing N N 121 GLU CD OE1 doub N N 122 GLU CD OE2 sing N N 123 GLU OE2 HE2 sing N N 124 GLU OXT HXT sing N N 125 GLY N CA sing N N 126 GLY N H sing N N 127 GLY N H2 sing N N 128 GLY CA C sing N N 129 GLY CA HA2 sing N N 130 GLY CA HA3 sing N N 131 GLY C O doub N N 132 GLY C OXT sing N N 133 GLY OXT HXT sing N N 134 HIS N CA sing N N 135 HIS N H sing N N 136 HIS N H2 sing N N 137 HIS CA C sing N N 138 HIS CA CB sing N N 139 HIS CA HA sing N N 140 HIS C O doub N N 141 HIS C OXT sing N N 142 HIS CB CG sing N N 143 HIS CB HB2 sing N N 144 HIS CB HB3 sing N N 145 HIS CG ND1 sing Y N 146 HIS CG CD2 doub Y N 147 HIS ND1 CE1 doub Y N 148 HIS ND1 HD1 sing N N 149 HIS CD2 NE2 sing Y N 150 HIS CD2 HD2 sing N N 151 HIS CE1 NE2 sing Y N 152 HIS CE1 HE1 sing N N 153 HIS NE2 HE2 sing N N 154 HIS OXT HXT sing N N 155 HOH O H1 sing N N 156 HOH O H2 sing N N 157 ILE N CA sing N N 158 ILE N H sing N N 159 ILE N H2 sing N N 160 ILE CA C sing N N 161 ILE CA CB sing N N 162 ILE CA HA sing N N 163 ILE C O doub N N 164 ILE C OXT sing N N 165 ILE CB CG1 sing N N 166 ILE CB CG2 sing N N 167 ILE CB HB sing N N 168 ILE CG1 CD1 sing N N 169 ILE CG1 HG12 sing N N 170 ILE CG1 HG13 sing N N 171 ILE CG2 HG21 sing N N 172 ILE CG2 HG22 sing N N 173 ILE CG2 HG23 sing N N 174 ILE CD1 HD11 sing N N 175 ILE CD1 HD12 sing N N 176 ILE CD1 HD13 sing N N 177 ILE OXT HXT sing N N 178 LEU N CA sing N N 179 LEU N H sing N N 180 LEU N H2 sing N N 181 LEU CA C sing N N 182 LEU CA CB sing N N 183 LEU CA HA sing N N 184 LEU C O doub N N 185 LEU C OXT sing N N 186 LEU CB CG sing N N 187 LEU CB HB2 sing N N 188 LEU CB HB3 sing N N 189 LEU CG CD1 sing N N 190 LEU CG CD2 sing N N 191 LEU CG HG sing N N 192 LEU CD1 HD11 sing N N 193 LEU CD1 HD12 sing N N 194 LEU CD1 HD13 sing N N 195 LEU CD2 HD21 sing N N 196 LEU CD2 HD22 sing N N 197 LEU CD2 HD23 sing N N 198 LEU OXT HXT sing N N 199 LYS N CA sing N N 200 LYS N H sing N N 201 LYS N H2 sing N N 202 LYS CA C sing N N 203 LYS CA CB sing N N 204 LYS CA HA sing N N 205 LYS C O doub N N 206 LYS C OXT sing N N 207 LYS CB CG sing N N 208 LYS CB HB2 sing N N 209 LYS CB HB3 sing N N 210 LYS CG CD sing N N 211 LYS CG HG2 sing N N 212 LYS CG HG3 sing N N 213 LYS CD CE sing N N 214 LYS CD HD2 sing N N 215 LYS CD HD3 sing N N 216 LYS CE NZ sing N N 217 LYS CE HE2 sing N N 218 LYS CE HE3 sing N N 219 LYS NZ HZ1 sing N N 220 LYS NZ HZ2 sing N N 221 LYS NZ HZ3 sing N N 222 LYS OXT HXT sing N N 223 MET N CA sing N N 224 MET N H sing N N 225 MET N H2 sing N N 226 MET CA C sing N N 227 MET CA CB sing N N 228 MET CA HA sing N N 229 MET C O doub N N 230 MET C OXT sing N N 231 MET CB CG sing N N 232 MET CB HB2 sing N N 233 MET CB HB3 sing N N 234 MET CG SD sing N N 235 MET CG HG2 sing N N 236 MET CG HG3 sing N N 237 MET SD CE sing N N 238 MET CE HE1 sing N N 239 MET CE HE2 sing N N 240 MET CE HE3 sing N N 241 MET OXT HXT sing N N 242 PEG C1 O1 sing N N 243 PEG C1 C2 sing N N 244 PEG C1 H11 sing N N 245 PEG C1 H12 sing N N 246 PEG O1 HO1 sing N N 247 PEG C2 O2 sing N N 248 PEG C2 H21 sing N N 249 PEG C2 H22 sing N N 250 PEG O2 C3 sing N N 251 PEG C3 C4 sing N N 252 PEG C3 H31 sing N N 253 PEG C3 H32 sing N N 254 PEG C4 O4 sing N N 255 PEG C4 H41 sing N N 256 PEG C4 H42 sing N N 257 PEG O4 HO4 sing N N 258 PHE N CA sing N N 259 PHE N H sing N N 260 PHE N H2 sing N N 261 PHE CA C sing N N 262 PHE CA CB sing N N 263 PHE CA HA sing N N 264 PHE C O doub N N 265 PHE C OXT sing N N 266 PHE CB CG sing N N 267 PHE CB HB2 sing N N 268 PHE CB HB3 sing N N 269 PHE CG CD1 doub Y N 270 PHE CG CD2 sing Y N 271 PHE CD1 CE1 sing Y N 272 PHE CD1 HD1 sing N N 273 PHE CD2 CE2 doub Y N 274 PHE CD2 HD2 sing N N 275 PHE CE1 CZ doub Y N 276 PHE CE1 HE1 sing N N 277 PHE CE2 CZ sing Y N 278 PHE CE2 HE2 sing N N 279 PHE CZ HZ sing N N 280 PHE OXT HXT sing N N 281 PRO N CA sing N N 282 PRO N CD sing N N 283 PRO N H sing N N 284 PRO CA C sing N N 285 PRO CA CB sing N N 286 PRO CA HA sing N N 287 PRO C O doub N N 288 PRO C OXT sing N N 289 PRO CB CG sing N N 290 PRO CB HB2 sing N N 291 PRO CB HB3 sing N N 292 PRO CG CD sing N N 293 PRO CG HG2 sing N N 294 PRO CG HG3 sing N N 295 PRO CD HD2 sing N N 296 PRO CD HD3 sing N N 297 PRO OXT HXT sing N N 298 SER N CA sing N N 299 SER N H sing N N 300 SER N H2 sing N N 301 SER CA C sing N N 302 SER CA CB sing N N 303 SER CA HA sing N N 304 SER C O doub N N 305 SER C OXT sing N N 306 SER CB OG sing N N 307 SER CB HB2 sing N N 308 SER CB HB3 sing N N 309 SER OG HG sing N N 310 SER OXT HXT sing N N 311 THR N CA sing N N 312 THR N H sing N N 313 THR N H2 sing N N 314 THR CA C sing N N 315 THR CA CB sing N N 316 THR CA HA sing N N 317 THR C O doub N N 318 THR C OXT sing N N 319 THR CB OG1 sing N N 320 THR CB CG2 sing N N 321 THR CB HB sing N N 322 THR OG1 HG1 sing N N 323 THR CG2 HG21 sing N N 324 THR CG2 HG22 sing N N 325 THR CG2 HG23 sing N N 326 THR OXT HXT sing N N 327 TRP N CA sing N N 328 TRP N H sing N N 329 TRP N H2 sing N N 330 TRP CA C sing N N 331 TRP CA CB sing N N 332 TRP CA HA sing N N 333 TRP C O doub N N 334 TRP C OXT sing N N 335 TRP CB CG sing N N 336 TRP CB HB2 sing N N 337 TRP CB HB3 sing N N 338 TRP CG CD1 doub Y N 339 TRP CG CD2 sing Y N 340 TRP CD1 NE1 sing Y N 341 TRP CD1 HD1 sing N N 342 TRP CD2 CE2 doub Y N 343 TRP CD2 CE3 sing Y N 344 TRP NE1 CE2 sing Y N 345 TRP NE1 HE1 sing N N 346 TRP CE2 CZ2 sing Y N 347 TRP CE3 CZ3 doub Y N 348 TRP CE3 HE3 sing N N 349 TRP CZ2 CH2 doub Y N 350 TRP CZ2 HZ2 sing N N 351 TRP CZ3 CH2 sing Y N 352 TRP CZ3 HZ3 sing N N 353 TRP CH2 HH2 sing N N 354 TRP OXT HXT sing N N 355 TYR N CA sing N N 356 TYR N H sing N N 357 TYR N H2 sing N N 358 TYR CA C sing N N 359 TYR CA CB sing N N 360 TYR CA HA sing N N 361 TYR C O doub N N 362 TYR C OXT sing N N 363 TYR CB CG sing N N 364 TYR CB HB2 sing N N 365 TYR CB HB3 sing N N 366 TYR CG CD1 doub Y N 367 TYR CG CD2 sing Y N 368 TYR CD1 CE1 sing Y N 369 TYR CD1 HD1 sing N N 370 TYR CD2 CE2 doub Y N 371 TYR CD2 HD2 sing N N 372 TYR CE1 CZ doub Y N 373 TYR CE1 HE1 sing N N 374 TYR CE2 CZ sing Y N 375 TYR CE2 HE2 sing N N 376 TYR CZ OH sing N N 377 TYR OH HH sing N N 378 TYR OXT HXT sing N N 379 VAL N CA sing N N 380 VAL N H sing N N 381 VAL N H2 sing N N 382 VAL CA C sing N N 383 VAL CA CB sing N N 384 VAL CA HA sing N N 385 VAL C O doub N N 386 VAL C OXT sing N N 387 VAL CB CG1 sing N N 388 VAL CB CG2 sing N N 389 VAL CB HB sing N N 390 VAL CG1 HG11 sing N N 391 VAL CG1 HG12 sing N N 392 VAL CG1 HG13 sing N N 393 VAL CG2 HG21 sing N N 394 VAL CG2 HG22 sing N N 395 VAL CG2 HG23 sing N N 396 VAL OXT HXT sing N N 397 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Academy of Finland' Finland '137995, 277335' 1 'Novo Nordisk Foundation' Finland NNF17OC0025402 2 'Sigrid Juselius Foundation' Finland ? 3 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4O1S _pdbx_initial_refinement_model.details ? # _space_group.id 1 _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic # _atom_sites.entry_id 6RPP _atom_sites.fract_transf_matrix[1][1] 0.013248 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010685 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020102 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_