data_6RQO # _entry.id 6RQO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6RQO pdb_00006rqo 10.2210/pdb6rqo/pdb WWPDB D_1292101056 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-07-17 2 'Structure model' 1 1 2019-08-21 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' reflns 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model 6 3 'Structure model' pdbx_unobs_or_zero_occ_residues # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_reflns.pdbx_R_split' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6RQO _pdbx_database_status.recvd_initial_deposition_date 2019-05-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'same publication, TR-SMX 0-5 ms' 6RNJ unspecified PDB 'same publication, TR-SMX 10-15 ms' 6RPH unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Weinert, T.' 1 0000-0002-0339-3722 'Skopintsev, P.' 2 ? 'James, D.' 3 ? 'Kekilli, D.' 4 ? 'Furrer, A.' 5 ? 'Bruenle, S.' 6 ? 'Mous, S.' 7 ? 'Nogly, P.' 8 ? 'Standfuss, J.' 9 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 365 _citation.language ? _citation.page_first 61 _citation.page_last 65 _citation.title 'Proton uptake mechanism in bacteriorhodopsin captured by serial synchrotron crystallography.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.aaw8634 _citation.pdbx_database_id_PubMed 31273117 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Weinert, T.' 1 0000-0002-0339-3722 primary 'Skopintsev, P.' 2 ? primary 'James, D.' 3 0000-0002-8348-6661 primary 'Dworkowski, F.' 4 0000-0001-5004-8684 primary 'Panepucci, E.' 5 0000-0003-3388-997X primary 'Kekilli, D.' 6 0000-0003-4422-923X primary 'Furrer, A.' 7 0000-0001-9894-6985 primary 'Brunle, S.' 8 0000-0002-8057-245X primary 'Mous, S.' 9 0000-0002-3532-5978 primary 'Ozerov, D.' 10 ? primary 'Nogly, P.' 11 0000-0002-8040-7753 primary 'Wang, M.' 12 0000-0002-5340-3036 primary 'Standfuss, J.' 13 0000-0001-8825-386X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat Bacteriorhodopsin 24472.959 1 ? ? ? ? 2 non-polymer syn RETINAL 284.436 1 ? ? ? ? 3 water nat water 18.015 8 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name BR,Bacterioopsin,BO # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYWARYA DWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKAESMR PEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSR ; _entity_poly.pdbx_seq_one_letter_code_can ;TGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYWARYA DWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKAESMR PEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 RETINAL RET 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 GLY n 1 3 ARG n 1 4 PRO n 1 5 GLU n 1 6 TRP n 1 7 ILE n 1 8 TRP n 1 9 LEU n 1 10 ALA n 1 11 LEU n 1 12 GLY n 1 13 THR n 1 14 ALA n 1 15 LEU n 1 16 MET n 1 17 GLY n 1 18 LEU n 1 19 GLY n 1 20 THR n 1 21 LEU n 1 22 TYR n 1 23 PHE n 1 24 LEU n 1 25 VAL n 1 26 LYS n 1 27 GLY n 1 28 MET n 1 29 GLY n 1 30 VAL n 1 31 SER n 1 32 ASP n 1 33 PRO n 1 34 ASP n 1 35 ALA n 1 36 LYS n 1 37 LYS n 1 38 PHE n 1 39 TYR n 1 40 ALA n 1 41 ILE n 1 42 THR n 1 43 THR n 1 44 LEU n 1 45 VAL n 1 46 PRO n 1 47 ALA n 1 48 ILE n 1 49 ALA n 1 50 PHE n 1 51 THR n 1 52 MET n 1 53 TYR n 1 54 LEU n 1 55 SER n 1 56 MET n 1 57 LEU n 1 58 LEU n 1 59 GLY n 1 60 TYR n 1 61 GLY n 1 62 LEU n 1 63 THR n 1 64 MET n 1 65 VAL n 1 66 PRO n 1 67 PHE n 1 68 GLY n 1 69 GLY n 1 70 GLU n 1 71 GLN n 1 72 ASN n 1 73 PRO n 1 74 ILE n 1 75 TYR n 1 76 TRP n 1 77 ALA n 1 78 ARG n 1 79 TYR n 1 80 ALA n 1 81 ASP n 1 82 TRP n 1 83 LEU n 1 84 PHE n 1 85 THR n 1 86 THR n 1 87 PRO n 1 88 LEU n 1 89 LEU n 1 90 LEU n 1 91 LEU n 1 92 ASP n 1 93 LEU n 1 94 ALA n 1 95 LEU n 1 96 LEU n 1 97 VAL n 1 98 ASP n 1 99 ALA n 1 100 ASP n 1 101 GLN n 1 102 GLY n 1 103 THR n 1 104 ILE n 1 105 LEU n 1 106 ALA n 1 107 LEU n 1 108 VAL n 1 109 GLY n 1 110 ALA n 1 111 ASP n 1 112 GLY n 1 113 ILE n 1 114 MET n 1 115 ILE n 1 116 GLY n 1 117 THR n 1 118 GLY n 1 119 LEU n 1 120 VAL n 1 121 GLY n 1 122 ALA n 1 123 LEU n 1 124 THR n 1 125 LYS n 1 126 VAL n 1 127 TYR n 1 128 SER n 1 129 TYR n 1 130 ARG n 1 131 PHE n 1 132 VAL n 1 133 TRP n 1 134 TRP n 1 135 ALA n 1 136 ILE n 1 137 SER n 1 138 THR n 1 139 ALA n 1 140 ALA n 1 141 MET n 1 142 LEU n 1 143 TYR n 1 144 ILE n 1 145 LEU n 1 146 TYR n 1 147 VAL n 1 148 LEU n 1 149 PHE n 1 150 PHE n 1 151 GLY n 1 152 PHE n 1 153 THR n 1 154 SER n 1 155 LYS n 1 156 ALA n 1 157 GLU n 1 158 SER n 1 159 MET n 1 160 ARG n 1 161 PRO n 1 162 GLU n 1 163 VAL n 1 164 ALA n 1 165 SER n 1 166 THR n 1 167 PHE n 1 168 LYS n 1 169 VAL n 1 170 LEU n 1 171 ARG n 1 172 ASN n 1 173 VAL n 1 174 THR n 1 175 VAL n 1 176 VAL n 1 177 LEU n 1 178 TRP n 1 179 SER n 1 180 ALA n 1 181 TYR n 1 182 PRO n 1 183 VAL n 1 184 VAL n 1 185 TRP n 1 186 LEU n 1 187 ILE n 1 188 GLY n 1 189 SER n 1 190 GLU n 1 191 GLY n 1 192 ALA n 1 193 GLY n 1 194 ILE n 1 195 VAL n 1 196 PRO n 1 197 LEU n 1 198 ASN n 1 199 ILE n 1 200 GLU n 1 201 THR n 1 202 LEU n 1 203 LEU n 1 204 PHE n 1 205 MET n 1 206 VAL n 1 207 LEU n 1 208 ASP n 1 209 VAL n 1 210 SER n 1 211 ALA n 1 212 LYS n 1 213 VAL n 1 214 GLY n 1 215 PHE n 1 216 GLY n 1 217 LEU n 1 218 ILE n 1 219 LEU n 1 220 LEU n 1 221 ARG n 1 222 SER n 1 223 ARG n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 223 _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)' _entity_src_nat.pdbx_ncbi_taxonomy_id 64091 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RET non-polymer . RETINAL ? 'C20 H28 O' 284.436 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 5 5 THR THR A . n A 1 2 GLY 2 6 6 GLY GLY A . n A 1 3 ARG 3 7 7 ARG ARG A . n A 1 4 PRO 4 8 8 PRO PRO A . n A 1 5 GLU 5 9 9 GLU GLU A . n A 1 6 TRP 6 10 10 TRP TRP A . n A 1 7 ILE 7 11 11 ILE ILE A . n A 1 8 TRP 8 12 12 TRP TRP A . n A 1 9 LEU 9 13 13 LEU LEU A . n A 1 10 ALA 10 14 14 ALA ALA A . n A 1 11 LEU 11 15 15 LEU LEU A . n A 1 12 GLY 12 16 16 GLY GLY A . n A 1 13 THR 13 17 17 THR THR A . n A 1 14 ALA 14 18 18 ALA ALA A . n A 1 15 LEU 15 19 19 LEU LEU A . n A 1 16 MET 16 20 20 MET MET A . n A 1 17 GLY 17 21 21 GLY GLY A . n A 1 18 LEU 18 22 22 LEU LEU A . n A 1 19 GLY 19 23 23 GLY GLY A . n A 1 20 THR 20 24 24 THR THR A . n A 1 21 LEU 21 25 25 LEU LEU A . n A 1 22 TYR 22 26 26 TYR TYR A . n A 1 23 PHE 23 27 27 PHE PHE A . n A 1 24 LEU 24 28 28 LEU LEU A . n A 1 25 VAL 25 29 29 VAL VAL A . n A 1 26 LYS 26 30 30 LYS LYS A . n A 1 27 GLY 27 31 31 GLY GLY A . n A 1 28 MET 28 32 32 MET MET A . n A 1 29 GLY 29 33 33 GLY GLY A . n A 1 30 VAL 30 34 34 VAL VAL A . n A 1 31 SER 31 35 35 SER SER A . n A 1 32 ASP 32 36 36 ASP ASP A . n A 1 33 PRO 33 37 37 PRO PRO A . n A 1 34 ASP 34 38 38 ASP ASP A . n A 1 35 ALA 35 39 39 ALA ALA A . n A 1 36 LYS 36 40 40 LYS LYS A . n A 1 37 LYS 37 41 41 LYS LYS A . n A 1 38 PHE 38 42 42 PHE PHE A . n A 1 39 TYR 39 43 43 TYR TYR A . n A 1 40 ALA 40 44 44 ALA ALA A . n A 1 41 ILE 41 45 45 ILE ILE A . n A 1 42 THR 42 46 46 THR THR A . n A 1 43 THR 43 47 47 THR THR A . n A 1 44 LEU 44 48 48 LEU LEU A . n A 1 45 VAL 45 49 49 VAL VAL A . n A 1 46 PRO 46 50 50 PRO PRO A . n A 1 47 ALA 47 51 51 ALA ALA A . n A 1 48 ILE 48 52 52 ILE ILE A . n A 1 49 ALA 49 53 53 ALA ALA A . n A 1 50 PHE 50 54 54 PHE PHE A . n A 1 51 THR 51 55 55 THR THR A . n A 1 52 MET 52 56 56 MET MET A . n A 1 53 TYR 53 57 57 TYR TYR A . n A 1 54 LEU 54 58 58 LEU LEU A . n A 1 55 SER 55 59 59 SER SER A . n A 1 56 MET 56 60 60 MET MET A . n A 1 57 LEU 57 61 61 LEU LEU A . n A 1 58 LEU 58 62 62 LEU LEU A . n A 1 59 GLY 59 63 63 GLY GLY A . n A 1 60 TYR 60 64 64 TYR TYR A . n A 1 61 GLY 61 65 65 GLY GLY A . n A 1 62 LEU 62 66 66 LEU LEU A . n A 1 63 THR 63 67 67 THR THR A . n A 1 64 MET 64 68 68 MET MET A . n A 1 65 VAL 65 69 69 VAL VAL A . n A 1 66 PRO 66 70 70 PRO PRO A . n A 1 67 PHE 67 71 71 PHE PHE A . n A 1 68 GLY 68 72 72 GLY GLY A . n A 1 69 GLY 69 73 73 GLY GLY A . n A 1 70 GLU 70 74 74 GLU GLU A . n A 1 71 GLN 71 75 75 GLN GLN A . n A 1 72 ASN 72 76 76 ASN ASN A . n A 1 73 PRO 73 77 77 PRO PRO A . n A 1 74 ILE 74 78 78 ILE ILE A . n A 1 75 TYR 75 79 79 TYR TYR A . n A 1 76 TRP 76 80 80 TRP TRP A . n A 1 77 ALA 77 81 81 ALA ALA A . n A 1 78 ARG 78 82 82 ARG ARG A . n A 1 79 TYR 79 83 83 TYR TYR A . n A 1 80 ALA 80 84 84 ALA ALA A . n A 1 81 ASP 81 85 85 ASP ASP A . n A 1 82 TRP 82 86 86 TRP TRP A . n A 1 83 LEU 83 87 87 LEU LEU A . n A 1 84 PHE 84 88 88 PHE PHE A . n A 1 85 THR 85 89 89 THR THR A . n A 1 86 THR 86 90 90 THR THR A . n A 1 87 PRO 87 91 91 PRO PRO A . n A 1 88 LEU 88 92 92 LEU LEU A . n A 1 89 LEU 89 93 93 LEU LEU A . n A 1 90 LEU 90 94 94 LEU LEU A . n A 1 91 LEU 91 95 95 LEU LEU A . n A 1 92 ASP 92 96 96 ASP ASP A . n A 1 93 LEU 93 97 97 LEU LEU A . n A 1 94 ALA 94 98 98 ALA ALA A . n A 1 95 LEU 95 99 99 LEU LEU A . n A 1 96 LEU 96 100 100 LEU LEU A . n A 1 97 VAL 97 101 101 VAL VAL A . n A 1 98 ASP 98 102 102 ASP ASP A . n A 1 99 ALA 99 103 103 ALA ALA A . n A 1 100 ASP 100 104 104 ASP ASP A . n A 1 101 GLN 101 105 105 GLN GLN A . n A 1 102 GLY 102 106 106 GLY GLY A . n A 1 103 THR 103 107 107 THR THR A . n A 1 104 ILE 104 108 108 ILE ILE A . n A 1 105 LEU 105 109 109 LEU LEU A . n A 1 106 ALA 106 110 110 ALA ALA A . n A 1 107 LEU 107 111 111 LEU LEU A . n A 1 108 VAL 108 112 112 VAL VAL A . n A 1 109 GLY 109 113 113 GLY GLY A . n A 1 110 ALA 110 114 114 ALA ALA A . n A 1 111 ASP 111 115 115 ASP ASP A . n A 1 112 GLY 112 116 116 GLY GLY A . n A 1 113 ILE 113 117 117 ILE ILE A . n A 1 114 MET 114 118 118 MET MET A . n A 1 115 ILE 115 119 119 ILE ILE A . n A 1 116 GLY 116 120 120 GLY GLY A . n A 1 117 THR 117 121 121 THR THR A . n A 1 118 GLY 118 122 122 GLY GLY A . n A 1 119 LEU 119 123 123 LEU LEU A . n A 1 120 VAL 120 124 124 VAL VAL A . n A 1 121 GLY 121 125 125 GLY GLY A . n A 1 122 ALA 122 126 126 ALA ALA A . n A 1 123 LEU 123 127 127 LEU LEU A . n A 1 124 THR 124 128 128 THR THR A . n A 1 125 LYS 125 129 129 LYS LYS A . n A 1 126 VAL 126 130 130 VAL VAL A . n A 1 127 TYR 127 131 131 TYR TYR A . n A 1 128 SER 128 132 132 SER SER A . n A 1 129 TYR 129 133 133 TYR TYR A . n A 1 130 ARG 130 134 134 ARG ARG A . n A 1 131 PHE 131 135 135 PHE PHE A . n A 1 132 VAL 132 136 136 VAL VAL A . n A 1 133 TRP 133 137 137 TRP TRP A . n A 1 134 TRP 134 138 138 TRP TRP A . n A 1 135 ALA 135 139 139 ALA ALA A . n A 1 136 ILE 136 140 140 ILE ILE A . n A 1 137 SER 137 141 141 SER SER A . n A 1 138 THR 138 142 142 THR THR A . n A 1 139 ALA 139 143 143 ALA ALA A . n A 1 140 ALA 140 144 144 ALA ALA A . n A 1 141 MET 141 145 145 MET MET A . n A 1 142 LEU 142 146 146 LEU LEU A . n A 1 143 TYR 143 147 147 TYR TYR A . n A 1 144 ILE 144 148 148 ILE ILE A . n A 1 145 LEU 145 149 149 LEU LEU A . n A 1 146 TYR 146 150 150 TYR TYR A . n A 1 147 VAL 147 151 151 VAL VAL A . n A 1 148 LEU 148 152 152 LEU LEU A . n A 1 149 PHE 149 153 153 PHE PHE A . n A 1 150 PHE 150 154 154 PHE PHE A . n A 1 151 GLY 151 155 155 GLY GLY A . n A 1 152 PHE 152 156 156 PHE PHE A . n A 1 153 THR 153 157 157 THR THR A . n A 1 154 SER 154 158 158 SER SER A . n A 1 155 LYS 155 159 159 LYS LYS A . n A 1 156 ALA 156 160 160 ALA ALA A . n A 1 157 GLU 157 161 161 GLU GLU A . n A 1 158 SER 158 162 162 SER SER A . n A 1 159 MET 159 163 163 MET MET A . n A 1 160 ARG 160 164 164 ARG ARG A . n A 1 161 PRO 161 165 165 PRO PRO A . n A 1 162 GLU 162 166 166 GLU GLU A . n A 1 163 VAL 163 167 167 VAL VAL A . n A 1 164 ALA 164 168 168 ALA ALA A . n A 1 165 SER 165 169 169 SER SER A . n A 1 166 THR 166 170 170 THR THR A . n A 1 167 PHE 167 171 171 PHE PHE A . n A 1 168 LYS 168 172 172 LYS LYS A . n A 1 169 VAL 169 173 173 VAL VAL A . n A 1 170 LEU 170 174 174 LEU LEU A . n A 1 171 ARG 171 175 175 ARG ARG A . n A 1 172 ASN 172 176 176 ASN ASN A . n A 1 173 VAL 173 177 177 VAL VAL A . n A 1 174 THR 174 178 178 THR THR A . n A 1 175 VAL 175 179 179 VAL VAL A . n A 1 176 VAL 176 180 180 VAL VAL A . n A 1 177 LEU 177 181 181 LEU LEU A . n A 1 178 TRP 178 182 182 TRP TRP A . n A 1 179 SER 179 183 183 SER SER A . n A 1 180 ALA 180 184 184 ALA ALA A . n A 1 181 TYR 181 185 185 TYR TYR A . n A 1 182 PRO 182 186 186 PRO PRO A . n A 1 183 VAL 183 187 187 VAL VAL A . n A 1 184 VAL 184 188 188 VAL VAL A . n A 1 185 TRP 185 189 189 TRP TRP A . n A 1 186 LEU 186 190 190 LEU LEU A . n A 1 187 ILE 187 191 191 ILE ILE A . n A 1 188 GLY 188 192 192 GLY GLY A . n A 1 189 SER 189 193 193 SER SER A . n A 1 190 GLU 190 194 194 GLU GLU A . n A 1 191 GLY 191 195 195 GLY GLY A . n A 1 192 ALA 192 196 196 ALA ALA A . n A 1 193 GLY 193 197 197 GLY GLY A . n A 1 194 ILE 194 198 198 ILE ILE A . n A 1 195 VAL 195 199 199 VAL VAL A . n A 1 196 PRO 196 200 200 PRO PRO A . n A 1 197 LEU 197 201 201 LEU LEU A . n A 1 198 ASN 198 202 202 ASN ASN A . n A 1 199 ILE 199 203 203 ILE ILE A . n A 1 200 GLU 200 204 204 GLU GLU A . n A 1 201 THR 201 205 205 THR THR A . n A 1 202 LEU 202 206 206 LEU LEU A . n A 1 203 LEU 203 207 207 LEU LEU A . n A 1 204 PHE 204 208 208 PHE PHE A . n A 1 205 MET 205 209 209 MET MET A . n A 1 206 VAL 206 210 210 VAL VAL A . n A 1 207 LEU 207 211 211 LEU LEU A . n A 1 208 ASP 208 212 212 ASP ASP A . n A 1 209 VAL 209 213 213 VAL VAL A . n A 1 210 SER 210 214 214 SER SER A . n A 1 211 ALA 211 215 215 ALA ALA A . n A 1 212 LYS 212 216 216 LYS LYS A . n A 1 213 VAL 213 217 217 VAL VAL A . n A 1 214 GLY 214 218 218 GLY GLY A . n A 1 215 PHE 215 219 219 PHE PHE A . n A 1 216 GLY 216 220 220 GLY GLY A . n A 1 217 LEU 217 221 221 LEU LEU A . n A 1 218 ILE 218 222 222 ILE ILE A . n A 1 219 LEU 219 223 223 LEU LEU A . n A 1 220 LEU 220 224 224 LEU LEU A . n A 1 221 ARG 221 225 225 ARG ARG A . n A 1 222 SER 222 226 226 SER SER A . n A 1 223 ARG 223 227 227 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 RET 1 501 501 RET RET A . C 3 HOH 1 601 453 HOH HOH A . C 3 HOH 2 602 451 HOH HOH A . C 3 HOH 3 603 404 HOH HOH A . C 3 HOH 4 604 6 HOH HOH A . C 3 HOH 5 605 456 HOH HOH A . C 3 HOH 6 606 403 HOH HOH A . C 3 HOH 7 607 454 HOH HOH A . C 3 HOH 8 608 406 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 225 ? CG ? A ARG 221 CG 2 1 Y 1 A ARG 225 ? CD ? A ARG 221 CD 3 1 Y 1 A ARG 225 ? NE ? A ARG 221 NE 4 1 Y 1 A ARG 225 ? CZ ? A ARG 221 CZ 5 1 Y 1 A ARG 225 ? NH1 ? A ARG 221 NH1 6 1 Y 1 A ARG 225 ? NH2 ? A ARG 221 NH2 7 1 Y 1 A ARG 227 ? CG ? A ARG 223 CG 8 1 Y 1 A ARG 227 ? CD ? A ARG 223 CD 9 1 Y 1 A ARG 227 ? NE ? A ARG 223 NE 10 1 Y 1 A ARG 227 ? CZ ? A ARG 223 CZ 11 1 Y 1 A ARG 227 ? NH1 ? A ARG 223 NH1 12 1 Y 1 A ARG 227 ? NH2 ? A ARG 223 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? 0.7 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? 0.7 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6RQO _cell.details ? _cell.formula_units_Z ? _cell.length_a 62.000 _cell.length_a_esd ? _cell.length_b 62.000 _cell.length_b_esd ? _cell.length_c 110.300 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6RQO _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6RQO _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.50 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'LIPIDIC CUBIC PHASE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM Na/K Phosphate buffer pH 5.6 30 % PEG 2000' _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt _diffrn.pdbx_serial_crystal_experiment ? 298 ? ? 1 ? ? ? 1 ? ? ? ? ? ? Y ? 298 ? ? 1 ? ? ? 2 ? ? ? ? ? ? Y ? 298 ? ? 1 ? ? ? 3 ? ? ? ? ? ? Y # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date _diffrn_detector.pdbx_frequency ? PIXEL 1 'DECTRIS EIGER X 16M' ? ? ? ? 2018-06-05 ? ? PIXEL 2 'DECTRIS EIGER X 16M' ? ? ? ? 2018-06-05 ? ? PIXEL 3 'DECTRIS EIGER X 16M' ? ? ? ? 2018-05-06 ? # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? ? ? ? ? ? ? 1 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 2 ? ? ? ? ? ? ? ? 2 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 3 ? ? ? ? ? ? ? ? 3 M ? ? 'SINGLE WAVELENGTH' ? x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.0 1.0 2 . 1.0 3 . 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? SYNCHROTRON ? 'SLS BEAMLINE X06SA' ? ? 1.0 ? X06SA SLS ? ? 2 ? ? SYNCHROTRON ? 'SLS BEAMLINE X06SA' ? ? 1.0 ? X06SA SLS ? ? 3 ? ? SYNCHROTRON ? 'SLS BEAMLINE X06SA' ? ? 1.0 ? X06SA SLS # loop_ _reflns.B_iso_Wilson_estimate _reflns.entry_id _reflns.data_reduction_details _reflns.data_reduction_method _reflns.d_resolution_high _reflns.d_resolution_low _reflns.details _reflns.limit_h_max _reflns.limit_h_min _reflns.limit_k_max _reflns.limit_k_min _reflns.limit_l_max _reflns.limit_l_min _reflns.number_all _reflns.number_obs _reflns.observed_criterion _reflns.observed_criterion_F_max _reflns.observed_criterion_F_min _reflns.observed_criterion_I_max _reflns.observed_criterion_I_min _reflns.observed_criterion_sigma_F _reflns.observed_criterion_sigma_I _reflns.percent_possible_obs _reflns.R_free_details _reflns.Rmerge_F_all _reflns.Rmerge_F_obs _reflns.Friedel_coverage _reflns.number_gt _reflns.threshold_expression _reflns.pdbx_redundancy _reflns.pdbx_Rmerge_I_obs _reflns.pdbx_Rmerge_I_all _reflns.pdbx_Rsym_value _reflns.pdbx_netI_over_av_sigmaI _reflns.pdbx_netI_over_sigmaI _reflns.pdbx_res_netI_over_av_sigmaI_2 _reflns.pdbx_res_netI_over_sigmaI_2 _reflns.pdbx_chi_squared _reflns.pdbx_scaling_rejects _reflns.pdbx_d_res_high_opt _reflns.pdbx_d_res_low_opt _reflns.pdbx_d_res_opt_method _reflns.phase_calculation_details _reflns.pdbx_Rrim_I_all _reflns.pdbx_Rpim_I_all _reflns.pdbx_d_opt _reflns.pdbx_number_measured_all _reflns.pdbx_diffrn_id _reflns.pdbx_ordinal _reflns.pdbx_CC_half _reflns.pdbx_R_split ? 6RQO ? ? 2.0 30.4 ? ? ? ? ? ? ? ? 15903 ? ? ? ? ? ? ? 98.1 ? ? ? ? ? ? 1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? ? ? ? 1 1 ? ? ? 6RQO ? ? 1.8 30.8 ? ? ? ? ? ? ? ? 21976 ? ? ? ? ? ? ? 100 ? ? ? ? ? ? 1390.3 ? ? ? ? 12.4 ? ? ? ? ? ? ? ? ? ? ? ? 2 2 0.99 0.024 ? 6RQO ? ? 1.8 30.8 ? ? ? ? ? ? ? ? 21977 ? ? ? ? ? ? ? 100 ? ? ? ? ? ? 1587.9 ? ? ? ? 14.3 ? ? ? ? ? ? ? ? ? ? ? ? 3 3 0.99 0.026 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.0 2.1 ? ? ? ? ? ? 2127 99 ? ? ? ? ? ? ? ? ? ? ? ? ? 1 ? ? ? ? ? ? ? 1 1 ? ? 1.8 1.85 ? 0.36 ? ? ? ? ? 99.5 ? ? ? ? ? ? ? ? ? ? ? ? ? 58.1 ? ? ? ? ? ? ? 2 2 0.05 4.0 1.8 1.85 ? 0.69 ? ? ? ? ? 100 ? ? ? ? ? ? ? ? ? ? ? ? ? 198.2 ? ? ? ? ? ? ? 3 3 0.31 1.06 # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 110.410 _refine.B_iso_mean 43.9909 _refine.B_iso_min 22.110 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6RQO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0000 _refine.ls_d_res_low 30.3360 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15903 _refine.ls_number_reflns_R_free 1011 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.0000 _refine.ls_percent_reflns_R_free 6.3600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2074 _refine.ls_R_factor_R_free 0.2458 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2047 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.020 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5B6Z _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.4400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.0000 _refine_hist.d_res_low 30.3360 _refine_hist.number_atoms_solvent 16 _refine_hist.number_atoms_total 1772 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 220 _refine_hist.pdbx_B_iso_mean_ligand 32.78 _refine_hist.pdbx_B_iso_mean_solvent 56.61 _refine_hist.pdbx_number_atoms_protein 1716 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 40 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.0002 2.1056 2260 . 133 2127 99.0000 . . . 0.3522 0.0000 0.3107 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.1056 2.2375 2254 . 162 2092 98.0000 . . . 0.2792 0.0000 0.2321 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.2375 2.4102 2287 . 145 2142 99.0000 . . . 0.2812 0.0000 0.1998 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.4102 2.6526 2238 . 134 2104 97.0000 . . . 0.2437 0.0000 0.1764 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.6526 3.0362 2257 . 146 2111 97.0000 . . . 0.2170 0.0000 0.1682 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.0362 3.8240 2295 . 156 2139 98.0000 . . . 0.2493 0.0000 0.1971 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.8240 30.3396 2312 . 135 2177 98.0000 . . . 0.2338 0.0000 0.2101 . . . . . . 7 . . . # _struct.entry_id 6RQO _struct.title 'Steady-state-SMX activated state structure of bacteriorhodopsin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6RQO _struct_keywords.text 'retinal, serial crystallography, time-resolved crystallography, TR-SMX, PROTON TRANSPORT' _struct_keywords.pdbx_keywords 'PROTON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BACR_HALSA _struct_ref.pdbx_db_accession P02945 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYWARYA DWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKAESMR PEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSR ; _struct_ref.pdbx_align_begin 18 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6RQO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 223 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02945 _struct_ref_seq.db_align_beg 18 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 240 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 227 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6210 ? 1 MORE -48 ? 1 'SSA (A^2)' 26890 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 31.0000000000 0.8660254038 -0.5000000000 0.0000000000 53.6935750346 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_565 -x+y,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -31.0000000000 -0.8660254038 -0.5000000000 0.0000000000 53.6935750346 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 5 ? GLY A 27 ? GLU A 9 GLY A 31 1 ? 23 HELX_P HELX_P2 AA2 ASP A 32 ? LEU A 58 ? ASP A 36 LEU A 62 1 ? 27 HELX_P HELX_P3 AA3 TYR A 75 ? ASP A 98 ? TYR A 79 ASP A 102 1 ? 24 HELX_P HELX_P4 AA4 ASP A 100 ? LEU A 123 ? ASP A 104 LEU A 127 1 ? 24 HELX_P HELX_P5 AA5 VAL A 126 ? GLY A 151 ? VAL A 130 GLY A 155 1 ? 26 HELX_P HELX_P6 AA6 GLY A 151 ? MET A 159 ? GLY A 155 MET A 163 1 ? 9 HELX_P HELX_P7 AA7 ARG A 160 ? GLY A 188 ? ARG A 164 GLY A 192 1 ? 29 HELX_P HELX_P8 AA8 PRO A 196 ? VAL A 213 ? PRO A 200 VAL A 217 1 ? 18 HELX_P HELX_P9 AA9 VAL A 213 ? ARG A 221 ? VAL A 217 ARG A 225 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? A LYS 212 NZ A ? ? 1_555 B RET . C15 A ? A LYS 216 A RET 501 1_555 ? ? ? ? ? ? ? 1.466 ? ? covale2 covale one ? A LYS 212 NZ B ? ? 1_555 B RET . C15 B ? A LYS 216 A RET 501 1_555 ? ? ? ? ? ? ? 1.422 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 63 ? PHE A 67 ? THR A 67 PHE A 71 AA1 2 GLU A 70 ? ILE A 74 ? GLU A 74 ILE A 78 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 63 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 67 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 74 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 78 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id RET _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 17 _struct_site.details 'binding site for residue RET A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 17 TRP A 82 ? TRP A 86 . ? 1_555 ? 2 AC1 17 THR A 85 ? THR A 89 . ? 1_555 ? 3 AC1 17 THR A 86 ? THR A 90 . ? 1_555 ? 4 AC1 17 LEU A 89 ? LEU A 93 . ? 1_555 ? 5 AC1 17 MET A 114 ? MET A 118 . ? 1_555 ? 6 AC1 17 ILE A 115 ? ILE A 119 . ? 1_555 ? 7 AC1 17 TRP A 134 ? TRP A 138 . ? 1_555 ? 8 AC1 17 SER A 137 ? SER A 141 . ? 1_555 ? 9 AC1 17 THR A 138 ? THR A 142 . ? 1_555 ? 10 AC1 17 MET A 141 ? MET A 145 . ? 1_555 ? 11 AC1 17 TRP A 178 ? TRP A 182 . ? 1_555 ? 12 AC1 17 TYR A 181 ? TYR A 185 . ? 1_555 ? 13 AC1 17 PRO A 182 ? PRO A 186 . ? 1_555 ? 14 AC1 17 TRP A 185 ? TRP A 189 . ? 1_555 ? 15 AC1 17 ASP A 208 ? ASP A 212 . ? 1_555 ? 16 AC1 17 ALA A 211 ? ALA A 215 . ? 1_555 ? 17 AC1 17 LYS A 212 ? LYS A 216 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 102 ? B 55.82 75.11 2 1 GLU A 161 ? B -67.03 -176.69 3 1 MET A 163 ? A -86.78 -142.67 4 1 MET A 163 ? B 53.72 -116.05 5 1 ARG A 164 ? B 65.99 144.98 6 1 PRO A 165 ? B -114.18 -82.75 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 17.0842 _pdbx_refine_tls.origin_y 39.5250 _pdbx_refine_tls.origin_z 35.8918 _pdbx_refine_tls.T[1][1] 0.2483 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0134 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0616 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.3245 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0112 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.3310 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.7175 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.1987 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.3052 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 2.2982 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.4412 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.9962 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0283 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0147 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.1230 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0314 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0143 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.2191 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0187 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.2449 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0384 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 5 ? ? A 501 ? all 2 'X-RAY DIFFRACTION' 1 ? ? B 6 ? ? B 456 ? all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 0 A SER 162 ? A SER 158 2 1 Y 0 A MET 163 ? A MET 159 3 1 Y 0 A ARG 164 ? A ARG 160 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HOH O O N N 123 HOH H1 H N N 124 HOH H2 H N N 125 ILE N N N N 126 ILE CA C N S 127 ILE C C N N 128 ILE O O N N 129 ILE CB C N S 130 ILE CG1 C N N 131 ILE CG2 C N N 132 ILE CD1 C N N 133 ILE OXT O N N 134 ILE H H N N 135 ILE H2 H N N 136 ILE HA H N N 137 ILE HB H N N 138 ILE HG12 H N N 139 ILE HG13 H N N 140 ILE HG21 H N N 141 ILE HG22 H N N 142 ILE HG23 H N N 143 ILE HD11 H N N 144 ILE HD12 H N N 145 ILE HD13 H N N 146 ILE HXT H N N 147 LEU N N N N 148 LEU CA C N S 149 LEU C C N N 150 LEU O O N N 151 LEU CB C N N 152 LEU CG C N N 153 LEU CD1 C N N 154 LEU CD2 C N N 155 LEU OXT O N N 156 LEU H H N N 157 LEU H2 H N N 158 LEU HA H N N 159 LEU HB2 H N N 160 LEU HB3 H N N 161 LEU HG H N N 162 LEU HD11 H N N 163 LEU HD12 H N N 164 LEU HD13 H N N 165 LEU HD21 H N N 166 LEU HD22 H N N 167 LEU HD23 H N N 168 LEU HXT H N N 169 LYS N N N N 170 LYS CA C N S 171 LYS C C N N 172 LYS O O N N 173 LYS CB C N N 174 LYS CG C N N 175 LYS CD C N N 176 LYS CE C N N 177 LYS NZ N N N 178 LYS OXT O N N 179 LYS H H N N 180 LYS H2 H N N 181 LYS HA H N N 182 LYS HB2 H N N 183 LYS HB3 H N N 184 LYS HG2 H N N 185 LYS HG3 H N N 186 LYS HD2 H N N 187 LYS HD3 H N N 188 LYS HE2 H N N 189 LYS HE3 H N N 190 LYS HZ1 H N N 191 LYS HZ2 H N N 192 LYS HZ3 H N N 193 LYS HXT H N N 194 MET N N N N 195 MET CA C N S 196 MET C C N N 197 MET O O N N 198 MET CB C N N 199 MET CG C N N 200 MET SD S N N 201 MET CE C N N 202 MET OXT O N N 203 MET H H N N 204 MET H2 H N N 205 MET HA H N N 206 MET HB2 H N N 207 MET HB3 H N N 208 MET HG2 H N N 209 MET HG3 H N N 210 MET HE1 H N N 211 MET HE2 H N N 212 MET HE3 H N N 213 MET HXT H N N 214 PHE N N N N 215 PHE CA C N S 216 PHE C C N N 217 PHE O O N N 218 PHE CB C N N 219 PHE CG C Y N 220 PHE CD1 C Y N 221 PHE CD2 C Y N 222 PHE CE1 C Y N 223 PHE CE2 C Y N 224 PHE CZ C Y N 225 PHE OXT O N N 226 PHE H H N N 227 PHE H2 H N N 228 PHE HA H N N 229 PHE HB2 H N N 230 PHE HB3 H N N 231 PHE HD1 H N N 232 PHE HD2 H N N 233 PHE HE1 H N N 234 PHE HE2 H N N 235 PHE HZ H N N 236 PHE HXT H N N 237 PRO N N N N 238 PRO CA C N S 239 PRO C C N N 240 PRO O O N N 241 PRO CB C N N 242 PRO CG C N N 243 PRO CD C N N 244 PRO OXT O N N 245 PRO H H N N 246 PRO HA H N N 247 PRO HB2 H N N 248 PRO HB3 H N N 249 PRO HG2 H N N 250 PRO HG3 H N N 251 PRO HD2 H N N 252 PRO HD3 H N N 253 PRO HXT H N N 254 RET C1 C N N 255 RET C2 C N N 256 RET C3 C N N 257 RET C4 C N N 258 RET C5 C N N 259 RET C6 C N N 260 RET C7 C N N 261 RET C8 C N N 262 RET C9 C N N 263 RET C10 C N N 264 RET C11 C N N 265 RET C12 C N N 266 RET C13 C N N 267 RET C14 C N N 268 RET C15 C N N 269 RET O1 O N N 270 RET C16 C N N 271 RET C17 C N N 272 RET C18 C N N 273 RET C19 C N N 274 RET C20 C N N 275 RET H21 H N N 276 RET H22 H N N 277 RET H31 H N N 278 RET H32 H N N 279 RET H41 H N N 280 RET H42 H N N 281 RET H7 H N N 282 RET H8 H N N 283 RET H10 H N N 284 RET H11 H N N 285 RET H12 H N N 286 RET H14 H N N 287 RET H15 H N N 288 RET H161 H N N 289 RET H162 H N N 290 RET H163 H N N 291 RET H171 H N N 292 RET H172 H N N 293 RET H173 H N N 294 RET H181 H N N 295 RET H182 H N N 296 RET H183 H N N 297 RET H191 H N N 298 RET H192 H N N 299 RET H193 H N N 300 RET H201 H N N 301 RET H202 H N N 302 RET H203 H N N 303 SER N N N N 304 SER CA C N S 305 SER C C N N 306 SER O O N N 307 SER CB C N N 308 SER OG O N N 309 SER OXT O N N 310 SER H H N N 311 SER H2 H N N 312 SER HA H N N 313 SER HB2 H N N 314 SER HB3 H N N 315 SER HG H N N 316 SER HXT H N N 317 THR N N N N 318 THR CA C N S 319 THR C C N N 320 THR O O N N 321 THR CB C N R 322 THR OG1 O N N 323 THR CG2 C N N 324 THR OXT O N N 325 THR H H N N 326 THR H2 H N N 327 THR HA H N N 328 THR HB H N N 329 THR HG1 H N N 330 THR HG21 H N N 331 THR HG22 H N N 332 THR HG23 H N N 333 THR HXT H N N 334 TRP N N N N 335 TRP CA C N S 336 TRP C C N N 337 TRP O O N N 338 TRP CB C N N 339 TRP CG C Y N 340 TRP CD1 C Y N 341 TRP CD2 C Y N 342 TRP NE1 N Y N 343 TRP CE2 C Y N 344 TRP CE3 C Y N 345 TRP CZ2 C Y N 346 TRP CZ3 C Y N 347 TRP CH2 C Y N 348 TRP OXT O N N 349 TRP H H N N 350 TRP H2 H N N 351 TRP HA H N N 352 TRP HB2 H N N 353 TRP HB3 H N N 354 TRP HD1 H N N 355 TRP HE1 H N N 356 TRP HE3 H N N 357 TRP HZ2 H N N 358 TRP HZ3 H N N 359 TRP HH2 H N N 360 TRP HXT H N N 361 TYR N N N N 362 TYR CA C N S 363 TYR C C N N 364 TYR O O N N 365 TYR CB C N N 366 TYR CG C Y N 367 TYR CD1 C Y N 368 TYR CD2 C Y N 369 TYR CE1 C Y N 370 TYR CE2 C Y N 371 TYR CZ C Y N 372 TYR OH O N N 373 TYR OXT O N N 374 TYR H H N N 375 TYR H2 H N N 376 TYR HA H N N 377 TYR HB2 H N N 378 TYR HB3 H N N 379 TYR HD1 H N N 380 TYR HD2 H N N 381 TYR HE1 H N N 382 TYR HE2 H N N 383 TYR HH H N N 384 TYR HXT H N N 385 VAL N N N N 386 VAL CA C N S 387 VAL C C N N 388 VAL O O N N 389 VAL CB C N N 390 VAL CG1 C N N 391 VAL CG2 C N N 392 VAL OXT O N N 393 VAL H H N N 394 VAL H2 H N N 395 VAL HA H N N 396 VAL HB H N N 397 VAL HG11 H N N 398 VAL HG12 H N N 399 VAL HG13 H N N 400 VAL HG21 H N N 401 VAL HG22 H N N 402 VAL HG23 H N N 403 VAL HXT H N N 404 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HOH O H1 sing N N 116 HOH O H2 sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MET N CA sing N N 184 MET N H sing N N 185 MET N H2 sing N N 186 MET CA C sing N N 187 MET CA CB sing N N 188 MET CA HA sing N N 189 MET C O doub N N 190 MET C OXT sing N N 191 MET CB CG sing N N 192 MET CB HB2 sing N N 193 MET CB HB3 sing N N 194 MET CG SD sing N N 195 MET CG HG2 sing N N 196 MET CG HG3 sing N N 197 MET SD CE sing N N 198 MET CE HE1 sing N N 199 MET CE HE2 sing N N 200 MET CE HE3 sing N N 201 MET OXT HXT sing N N 202 PHE N CA sing N N 203 PHE N H sing N N 204 PHE N H2 sing N N 205 PHE CA C sing N N 206 PHE CA CB sing N N 207 PHE CA HA sing N N 208 PHE C O doub N N 209 PHE C OXT sing N N 210 PHE CB CG sing N N 211 PHE CB HB2 sing N N 212 PHE CB HB3 sing N N 213 PHE CG CD1 doub Y N 214 PHE CG CD2 sing Y N 215 PHE CD1 CE1 sing Y N 216 PHE CD1 HD1 sing N N 217 PHE CD2 CE2 doub Y N 218 PHE CD2 HD2 sing N N 219 PHE CE1 CZ doub Y N 220 PHE CE1 HE1 sing N N 221 PHE CE2 CZ sing Y N 222 PHE CE2 HE2 sing N N 223 PHE CZ HZ sing N N 224 PHE OXT HXT sing N N 225 PRO N CA sing N N 226 PRO N CD sing N N 227 PRO N H sing N N 228 PRO CA C sing N N 229 PRO CA CB sing N N 230 PRO CA HA sing N N 231 PRO C O doub N N 232 PRO C OXT sing N N 233 PRO CB CG sing N N 234 PRO CB HB2 sing N N 235 PRO CB HB3 sing N N 236 PRO CG CD sing N N 237 PRO CG HG2 sing N N 238 PRO CG HG3 sing N N 239 PRO CD HD2 sing N N 240 PRO CD HD3 sing N N 241 PRO OXT HXT sing N N 242 RET C1 C2 sing N N 243 RET C1 C6 sing N N 244 RET C1 C16 sing N N 245 RET C1 C17 sing N N 246 RET C2 C3 sing N N 247 RET C2 H21 sing N N 248 RET C2 H22 sing N N 249 RET C3 C4 sing N N 250 RET C3 H31 sing N N 251 RET C3 H32 sing N N 252 RET C4 C5 sing N N 253 RET C4 H41 sing N N 254 RET C4 H42 sing N N 255 RET C5 C6 doub N N 256 RET C5 C18 sing N N 257 RET C6 C7 sing N N 258 RET C7 C8 doub N E 259 RET C7 H7 sing N N 260 RET C8 C9 sing N N 261 RET C8 H8 sing N N 262 RET C9 C10 doub N E 263 RET C9 C19 sing N N 264 RET C10 C11 sing N N 265 RET C10 H10 sing N N 266 RET C11 C12 doub N E 267 RET C11 H11 sing N N 268 RET C12 C13 sing N N 269 RET C12 H12 sing N N 270 RET C13 C14 doub N E 271 RET C13 C20 sing N N 272 RET C14 C15 sing N N 273 RET C14 H14 sing N N 274 RET C15 O1 doub N N 275 RET C15 H15 sing N N 276 RET C16 H161 sing N N 277 RET C16 H162 sing N N 278 RET C16 H163 sing N N 279 RET C17 H171 sing N N 280 RET C17 H172 sing N N 281 RET C17 H173 sing N N 282 RET C18 H181 sing N N 283 RET C18 H182 sing N N 284 RET C18 H183 sing N N 285 RET C19 H191 sing N N 286 RET C19 H192 sing N N 287 RET C19 H193 sing N N 288 RET C20 H201 sing N N 289 RET C20 H202 sing N N 290 RET C20 H203 sing N N 291 SER N CA sing N N 292 SER N H sing N N 293 SER N H2 sing N N 294 SER CA C sing N N 295 SER CA CB sing N N 296 SER CA HA sing N N 297 SER C O doub N N 298 SER C OXT sing N N 299 SER CB OG sing N N 300 SER CB HB2 sing N N 301 SER CB HB3 sing N N 302 SER OG HG sing N N 303 SER OXT HXT sing N N 304 THR N CA sing N N 305 THR N H sing N N 306 THR N H2 sing N N 307 THR CA C sing N N 308 THR CA CB sing N N 309 THR CA HA sing N N 310 THR C O doub N N 311 THR C OXT sing N N 312 THR CB OG1 sing N N 313 THR CB CG2 sing N N 314 THR CB HB sing N N 315 THR OG1 HG1 sing N N 316 THR CG2 HG21 sing N N 317 THR CG2 HG22 sing N N 318 THR CG2 HG23 sing N N 319 THR OXT HXT sing N N 320 TRP N CA sing N N 321 TRP N H sing N N 322 TRP N H2 sing N N 323 TRP CA C sing N N 324 TRP CA CB sing N N 325 TRP CA HA sing N N 326 TRP C O doub N N 327 TRP C OXT sing N N 328 TRP CB CG sing N N 329 TRP CB HB2 sing N N 330 TRP CB HB3 sing N N 331 TRP CG CD1 doub Y N 332 TRP CG CD2 sing Y N 333 TRP CD1 NE1 sing Y N 334 TRP CD1 HD1 sing N N 335 TRP CD2 CE2 doub Y N 336 TRP CD2 CE3 sing Y N 337 TRP NE1 CE2 sing Y N 338 TRP NE1 HE1 sing N N 339 TRP CE2 CZ2 sing Y N 340 TRP CE3 CZ3 doub Y N 341 TRP CE3 HE3 sing N N 342 TRP CZ2 CH2 doub Y N 343 TRP CZ2 HZ2 sing N N 344 TRP CZ3 CH2 sing Y N 345 TRP CZ3 HZ3 sing N N 346 TRP CH2 HH2 sing N N 347 TRP OXT HXT sing N N 348 TYR N CA sing N N 349 TYR N H sing N N 350 TYR N H2 sing N N 351 TYR CA C sing N N 352 TYR CA CB sing N N 353 TYR CA HA sing N N 354 TYR C O doub N N 355 TYR C OXT sing N N 356 TYR CB CG sing N N 357 TYR CB HB2 sing N N 358 TYR CB HB3 sing N N 359 TYR CG CD1 doub Y N 360 TYR CG CD2 sing Y N 361 TYR CD1 CE1 sing Y N 362 TYR CD1 HD1 sing N N 363 TYR CD2 CE2 doub Y N 364 TYR CD2 HD2 sing N N 365 TYR CE1 CZ doub Y N 366 TYR CE1 HE1 sing N N 367 TYR CE2 CZ sing Y N 368 TYR CE2 HE2 sing N N 369 TYR CZ OH sing N N 370 TYR OH HH sing N N 371 TYR OXT HXT sing N N 372 VAL N CA sing N N 373 VAL N H sing N N 374 VAL N H2 sing N N 375 VAL CA C sing N N 376 VAL CA CB sing N N 377 VAL CA HA sing N N 378 VAL C O doub N N 379 VAL C OXT sing N N 380 VAL CB CG1 sing N N 381 VAL CB CG2 sing N N 382 VAL CB HB sing N N 383 VAL CG1 HG11 sing N N 384 VAL CG1 HG12 sing N N 385 VAL CG1 HG13 sing N N 386 VAL CG2 HG21 sing N N 387 VAL CG2 HG22 sing N N 388 VAL CG2 HG23 sing N N 389 VAL OXT HXT sing N N 390 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id RET _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id RET _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5B6Z _pdbx_initial_refinement_model.details ? # loop_ _pdbx_serial_crystallography_sample_delivery.diffrn_id _pdbx_serial_crystallography_sample_delivery.description _pdbx_serial_crystallography_sample_delivery.method 1 ? injection 2 ? injection 3 ? injection # loop_ _pdbx_serial_crystallography_sample_delivery_injection.diffrn_id _pdbx_serial_crystallography_sample_delivery_injection.description _pdbx_serial_crystallography_sample_delivery_injection.injector_diameter _pdbx_serial_crystallography_sample_delivery_injection.injector_temperature _pdbx_serial_crystallography_sample_delivery_injection.injector_pressure _pdbx_serial_crystallography_sample_delivery_injection.flow_rate _pdbx_serial_crystallography_sample_delivery_injection.carrier_solvent _pdbx_serial_crystallography_sample_delivery_injection.crystal_concentration _pdbx_serial_crystallography_sample_delivery_injection.preparation _pdbx_serial_crystallography_sample_delivery_injection.power_by _pdbx_serial_crystallography_sample_delivery_injection.injector_nozzle _pdbx_serial_crystallography_sample_delivery_injection.jet_diameter _pdbx_serial_crystallography_sample_delivery_injection.filter_size 1 ? ? ? ? ? LCP ? ? ? ? 50 ? 2 ? ? ? ? ? LCP ? ? ? ? 50 ? 3 ? ? ? ? ? LCP ? ? ? ? 50 ? # _atom_sites.entry_id 6RQO _atom_sites.fract_transf_matrix[1][1] 0.016129 _atom_sites.fract_transf_matrix[1][2] 0.009312 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018624 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009066 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_