data_6RW2 # _entry.id 6RW2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.325 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6RW2 WWPDB D_1292102715 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6RW2 _pdbx_database_status.recvd_initial_deposition_date 2019-06-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Brown, D.G.' 1 0000-0003-4605-4779 'Schroeder, S.' 2 0000-0003-1703-9158 'Chen, L.' 3 0000-0003-1776-3146 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 63 _citation.language ? _citation.page_first 4107 _citation.page_last 4116 _citation.title 'Identification and Optimization of EphA2-Selective Bicycles for the Delivery of Cytotoxic Payloads.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.9b02129 _citation.pdbx_database_id_PubMed 32202781 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mudd, G.E.' 1 ? primary 'Brown, A.' 2 ? primary 'Chen, L.' 3 ? primary 'van Rietschoten, K.' 4 ? primary 'Watcham, S.' 5 ? primary 'Teufel, D.P.' 6 ? primary 'Pavan, S.' 7 ? primary 'Lani, R.' 8 ? primary 'Huxley, P.' 9 ? primary 'Bennett, G.S.' 10 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6RW2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.090 _cell.length_a_esd ? _cell.length_b 113.680 _cell.length_b_esd ? _cell.length_c 130.960 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6RW2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ephrin type-A receptor 2' 22006.697 1 2.7.10.1 ? ? ? 2 polymer syn ALA-ARG-ASP-CYS-PRO-LEU-VAL-ASN-PRO-LEU-CYS-LEU-HIS-PRO-GLY-TRP-THR-CYS 1997.366 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 non-polymer syn "1,1',1''-(1,3,5-triazinane-1,3,5-triyl)tripropan-1-one" 255.313 1 ? ? ? ? 5 water nat water 18.015 43 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Epithelial cell kinase,Tyrosine-protein kinase receptor ECK' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;ASRGSHHHHHHGASDDDDKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMNDMPIYMYSVCNVMSGDQDNWLRTNWVYR GEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEER SVGPLTRKGFYLAFQDIGACVALLSVRVYYKKC ; ;ASRGSHHHHHHGASDDDDKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMNDMPIYMYSVCNVMSGDQDNWLRTNWVYR GEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEER SVGPLTRKGFYLAFQDIGACVALLSVRVYYKKC ; A ? 2 'polypeptide(L)' no no ARDCPLVNPLCLHPGWTC ARDCPLVNPLCLHPGWTC B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 SER n 1 3 ARG n 1 4 GLY n 1 5 SER n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 HIS n 1 12 GLY n 1 13 ALA n 1 14 SER n 1 15 ASP n 1 16 ASP n 1 17 ASP n 1 18 ASP n 1 19 LYS n 1 20 GLU n 1 21 VAL n 1 22 VAL n 1 23 LEU n 1 24 LEU n 1 25 ASP n 1 26 PHE n 1 27 ALA n 1 28 ALA n 1 29 ALA n 1 30 GLY n 1 31 GLY n 1 32 GLU n 1 33 LEU n 1 34 GLY n 1 35 TRP n 1 36 LEU n 1 37 THR n 1 38 HIS n 1 39 PRO n 1 40 TYR n 1 41 GLY n 1 42 LYS n 1 43 GLY n 1 44 TRP n 1 45 ASP n 1 46 LEU n 1 47 MET n 1 48 GLN n 1 49 ASN n 1 50 ILE n 1 51 MET n 1 52 ASN n 1 53 ASP n 1 54 MET n 1 55 PRO n 1 56 ILE n 1 57 TYR n 1 58 MET n 1 59 TYR n 1 60 SER n 1 61 VAL n 1 62 CYS n 1 63 ASN n 1 64 VAL n 1 65 MET n 1 66 SER n 1 67 GLY n 1 68 ASP n 1 69 GLN n 1 70 ASP n 1 71 ASN n 1 72 TRP n 1 73 LEU n 1 74 ARG n 1 75 THR n 1 76 ASN n 1 77 TRP n 1 78 VAL n 1 79 TYR n 1 80 ARG n 1 81 GLY n 1 82 GLU n 1 83 ALA n 1 84 GLU n 1 85 ARG n 1 86 ILE n 1 87 PHE n 1 88 ILE n 1 89 GLU n 1 90 LEU n 1 91 LYS n 1 92 PHE n 1 93 THR n 1 94 VAL n 1 95 ARG n 1 96 ASP n 1 97 CYS n 1 98 ASN n 1 99 SER n 1 100 PHE n 1 101 PRO n 1 102 GLY n 1 103 GLY n 1 104 ALA n 1 105 SER n 1 106 SER n 1 107 CYS n 1 108 LYS n 1 109 GLU n 1 110 THR n 1 111 PHE n 1 112 ASN n 1 113 LEU n 1 114 TYR n 1 115 TYR n 1 116 ALA n 1 117 GLU n 1 118 SER n 1 119 ASP n 1 120 LEU n 1 121 ASP n 1 122 TYR n 1 123 GLY n 1 124 THR n 1 125 ASN n 1 126 PHE n 1 127 GLN n 1 128 LYS n 1 129 ARG n 1 130 LEU n 1 131 PHE n 1 132 THR n 1 133 LYS n 1 134 ILE n 1 135 ASP n 1 136 THR n 1 137 ILE n 1 138 ALA n 1 139 PRO n 1 140 ASP n 1 141 GLU n 1 142 ILE n 1 143 THR n 1 144 VAL n 1 145 SER n 1 146 SER n 1 147 ASP n 1 148 PHE n 1 149 GLU n 1 150 ALA n 1 151 ARG n 1 152 HIS n 1 153 VAL n 1 154 LYS n 1 155 LEU n 1 156 ASN n 1 157 VAL n 1 158 GLU n 1 159 GLU n 1 160 ARG n 1 161 SER n 1 162 VAL n 1 163 GLY n 1 164 PRO n 1 165 LEU n 1 166 THR n 1 167 ARG n 1 168 LYS n 1 169 GLY n 1 170 PHE n 1 171 TYR n 1 172 LEU n 1 173 ALA n 1 174 PHE n 1 175 GLN n 1 176 ASP n 1 177 ILE n 1 178 GLY n 1 179 ALA n 1 180 CYS n 1 181 VAL n 1 182 ALA n 1 183 LEU n 1 184 LEU n 1 185 SER n 1 186 VAL n 1 187 ARG n 1 188 VAL n 1 189 TYR n 1 190 TYR n 1 191 LYS n 1 192 LYS n 1 193 CYS n 2 1 ALA n 2 2 ARG n 2 3 ASP n 2 4 CYS n 2 5 PRO n 2 6 LEU n 2 7 VAL n 2 8 ASN n 2 9 PRO n 2 10 LEU n 2 11 CYS n 2 12 LEU n 2 13 HIS n 2 14 PRO n 2 15 GLY n 2 16 TRP n 2 17 THR n 2 18 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 193 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EPHA2, ECK' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 18 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP EPHA2_HUMAN P29317 ? 1 ;KEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMNDMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCN SFPGGASSCKETFNLYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYLAFQDIG ACVALLSVRVYYKKC ; 27 2 PDB 6RW2 6RW2 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6RW2 A 19 ? 193 ? P29317 27 ? 201 ? 27 201 2 2 6RW2 B 1 ? 18 ? 6RW2 -1 ? 16 ? -1 16 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6RW2 ALA A 1 ? UNP P29317 ? ? 'expression tag' 9 1 1 6RW2 SER A 2 ? UNP P29317 ? ? 'expression tag' 10 2 1 6RW2 ARG A 3 ? UNP P29317 ? ? 'expression tag' 11 3 1 6RW2 GLY A 4 ? UNP P29317 ? ? 'expression tag' 12 4 1 6RW2 SER A 5 ? UNP P29317 ? ? 'expression tag' 13 5 1 6RW2 HIS A 6 ? UNP P29317 ? ? 'expression tag' 14 6 1 6RW2 HIS A 7 ? UNP P29317 ? ? 'expression tag' 15 7 1 6RW2 HIS A 8 ? UNP P29317 ? ? 'expression tag' 16 8 1 6RW2 HIS A 9 ? UNP P29317 ? ? 'expression tag' 17 9 1 6RW2 HIS A 10 ? UNP P29317 ? ? 'expression tag' 18 10 1 6RW2 HIS A 11 ? UNP P29317 ? ? 'expression tag' 19 11 1 6RW2 GLY A 12 ? UNP P29317 ? ? 'expression tag' 20 12 1 6RW2 ALA A 13 ? UNP P29317 ? ? 'expression tag' 21 13 1 6RW2 SER A 14 ? UNP P29317 ? ? 'expression tag' 22 14 1 6RW2 ASP A 15 ? UNP P29317 ? ? 'expression tag' 23 15 1 6RW2 ASP A 16 ? UNP P29317 ? ? 'expression tag' 24 16 1 6RW2 ASP A 17 ? UNP P29317 ? ? 'expression tag' 25 17 1 6RW2 ASP A 18 ? UNP P29317 ? ? 'expression tag' 26 18 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 29N non-polymer . "1,1',1''-(1,3,5-triazinane-1,3,5-triyl)tripropan-1-one" ;1,1',1''-(1,3,5-triazinane-1,3,5-triyl)triprop-2-en-1-one, bound form ; 'C12 H21 N3 O3' 255.313 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6RW2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.55 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 65.39 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1M sodium acetate 0.2M lithium sulphate 8-10% PEG 6000 ; _exptl_crystal_grow.pdbx_pH_range 5.5-5.75 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-02-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6RW2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.26 _reflns.d_resolution_low 58.64 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15014 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.8 _reflns.pdbx_Rmerge_I_obs 0.077 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.26 _reflns_shell.d_res_low 2.33 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 667 _reflns_shell.percent_possible_all 87.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.935 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -1.2000 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] 1.5500 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -0.3500 _refine.B_iso_max 131.320 _refine.B_iso_mean 41.7520 _refine.B_iso_min 20.170 _refine.correlation_coeff_Fo_to_Fc 0.9490 _refine.correlation_coeff_Fo_to_Fc_free 0.9030 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6RW2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2600 _refine.ls_d_res_low 56.9000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14234 _refine.ls_number_reflns_R_free 780 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.6800 _refine.ls_percent_reflns_R_free 5.2000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2138 _refine.ls_R_factor_R_free 0.2646 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2110 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2250 _refine.pdbx_overall_ESU_R_Free 0.2070 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2600 _refine_hist.d_res_low 56.9000 _refine_hist.number_atoms_solvent 43 _refine_hist.number_atoms_total 1613 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 193 _refine_hist.pdbx_B_iso_mean_ligand 52.66 _refine_hist.pdbx_B_iso_mean_solvent 48.04 _refine_hist.pdbx_number_atoms_protein 1546 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 0.013 1637 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.035 0.017 1471 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.019 1.658 2221 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 3.068 1.600 3406 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 9.582 5.000 195 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.244 22.045 88 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.744 15.000 262 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.963 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.088 0.200 199 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.012 0.020 1848 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.017 0.020 366 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 3.644 4.285 780 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.644 4.285 779 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 5.627 6.416 975 ? r_mcangle_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.2600 _refine_ls_shell.d_res_low 2.3190 _refine_ls_shell.number_reflns_all 988 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 54 _refine_ls_shell.number_reflns_R_work 934 _refine_ls_shell.percent_reflns_obs 88.6100 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3410 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3400 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6RW2 _struct.title 'Bicycle Toxin Conjugate bound to EphA2' _struct.pdbx_descriptor 'Ephrin type-A receptor 2 (E.C.2.7.10.1), ALA-ARG-ASP-CYS-PRO-LEU-VAL-ASN-PRO-LEU-CYS-LEU-HIS-PRO-GLY-TRP-THR-CYS' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6RW2 _struct_keywords.text 'EphA2, inhibitor, complex, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 27 ? ALA A 29 ? ALA A 35 ALA A 37 5 ? 3 HELX_P HELX_P2 AA2 CYS A 97 ? PHE A 100 ? CYS A 105 PHE A 108 5 ? 4 HELX_P HELX_P3 AA3 GLN A 127 ? PHE A 131 ? GLN A 135 PHE A 139 5 ? 5 HELX_P HELX_P4 AA4 VAL A 144 ? ALA A 150 ? VAL A 152 ALA A 158 1 ? 7 HELX_P HELX_P5 AA5 ASN B 8 ? HIS B 13 ? ASN B 6 HIS B 11 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 62 SG ? ? ? 1_555 A CYS 180 SG ? ? A CYS 70 A CYS 188 1_555 ? ? ? ? ? ? ? 2.099 ? disulf2 disulf ? ? A CYS 97 SG ? ? ? 1_555 A CYS 107 SG ? ? A CYS 105 A CYS 115 1_555 ? ? ? ? ? ? ? 2.074 ? disulf3 disulf ? ? A CYS 193 SG ? ? ? 1_555 A CYS 193 SG ? ? A CYS 201 A CYS 201 3_555 ? ? ? ? ? ? ? 1.863 ? covale1 covale none ? B CYS 4 SG ? ? ? 1_555 D 29N . C16 ? ? B CYS 2 B 29N 101 1_555 ? ? ? ? ? ? ? 1.754 ? covale2 covale none ? B CYS 11 SG ? ? ? 1_555 D 29N . C25 ? ? B CYS 9 B 29N 101 1_555 ? ? ? ? ? ? ? 1.762 ? covale3 covale none ? B CYS 18 SG ? ? ? 1_555 D 29N . C19 ? ? B CYS 16 B 29N 101 1_555 ? ? ? ? ? ? ? 1.776 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 HIS 38 A . ? HIS 46 A PRO 39 A ? PRO 47 A 1 1.21 2 GLY 163 A . ? GLY 171 A PRO 164 A ? PRO 172 A 1 2.55 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 5 ? AA3 ? 4 ? AA4 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 20 ? ASP A 25 ? GLU A 28 ASP A 33 AA1 2 CYS A 180 ? LYS A 191 ? CYS A 188 LYS A 199 AA1 3 ILE A 86 ? ARG A 95 ? ILE A 94 ARG A 103 AA1 4 ILE A 142 ? THR A 143 ? ILE A 150 THR A 151 AA2 1 ASP A 45 ? MET A 51 ? ASP A 53 MET A 59 AA2 2 MET A 54 ? CYS A 62 ? MET A 62 CYS A 70 AA2 3 CYS A 180 ? LYS A 191 ? CYS A 188 LYS A 199 AA2 4 ILE A 86 ? ARG A 95 ? ILE A 94 ARG A 103 AA2 5 ASN A 156 ? VAL A 162 ? ASN A 164 VAL A 170 AA3 1 LEU A 36 ? HIS A 38 ? LEU A 44 HIS A 46 AA3 2 ASN A 71 ? ARG A 74 ? ASN A 79 ARG A 82 AA3 3 GLY A 169 ? ASP A 176 ? GLY A 177 ASP A 184 AA3 4 VAL A 78 ? TYR A 79 ? VAL A 86 TYR A 87 AA4 1 LEU A 36 ? HIS A 38 ? LEU A 44 HIS A 46 AA4 2 ASN A 71 ? ARG A 74 ? ASN A 79 ARG A 82 AA4 3 GLY A 169 ? ASP A 176 ? GLY A 177 ASP A 184 AA4 4 PHE A 111 ? SER A 118 ? PHE A 119 SER A 126 AA4 5 THR A 132 ? ILE A 137 ? THR A 140 ILE A 145 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 23 ? N LEU A 31 O VAL A 188 ? O VAL A 196 AA1 2 3 O ARG A 187 ? O ARG A 195 N GLU A 89 ? N GLU A 97 AA1 3 4 N VAL A 94 ? N VAL A 102 O THR A 143 ? O THR A 151 AA2 1 2 N MET A 47 ? N MET A 55 O MET A 58 ? O MET A 66 AA2 2 3 N TYR A 59 ? N TYR A 67 O LEU A 183 ? O LEU A 191 AA2 3 4 O ARG A 187 ? O ARG A 195 N GLU A 89 ? N GLU A 97 AA2 4 5 N LEU A 90 ? N LEU A 98 O GLU A 158 ? O GLU A 166 AA3 1 2 N HIS A 38 ? N HIS A 46 O TRP A 72 ? O TRP A 80 AA3 2 3 N ASN A 71 ? N ASN A 79 O ASP A 176 ? O ASP A 184 AA3 3 4 O PHE A 170 ? O PHE A 178 N VAL A 78 ? N VAL A 86 AA4 1 2 N HIS A 38 ? N HIS A 46 O TRP A 72 ? O TRP A 80 AA4 2 3 N ASN A 71 ? N ASN A 79 O ASP A 176 ? O ASP A 184 AA4 3 4 O GLN A 175 ? O GLN A 183 N ASN A 112 ? N ASN A 120 AA4 4 5 N TYR A 115 ? N TYR A 123 O THR A 132 ? O THR A 140 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GOL 301 ? 4 'binding site for residue GOL A 301' AC2 Software B 29N 101 ? 10 'binding site for residue 29N B 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 TYR A 79 ? TYR A 87 . ? 1_655 ? 2 AC1 4 LYS A 108 ? LYS A 116 . ? 1_555 ? 3 AC1 4 GLU A 109 ? GLU A 117 . ? 1_555 ? 4 AC1 4 THR A 110 ? THR A 118 . ? 1_555 ? 5 AC2 10 MET A 47 ? MET A 55 . ? 1_555 ? 6 AC2 10 MET A 58 ? MET A 66 . ? 1_555 ? 7 AC2 10 ARG B 2 ? ARG B 0 . ? 1_555 ? 8 AC2 10 CYS B 4 ? CYS B 2 . ? 1_555 ? 9 AC2 10 PRO B 5 ? PRO B 3 . ? 1_555 ? 10 AC2 10 LEU B 6 ? LEU B 4 . ? 1_555 ? 11 AC2 10 VAL B 7 ? VAL B 5 . ? 1_555 ? 12 AC2 10 CYS B 11 ? CYS B 9 . ? 1_555 ? 13 AC2 10 TRP B 16 ? TRP B 14 . ? 1_555 ? 14 AC2 10 CYS B 18 ? CYS B 16 . ? 1_555 ? # _atom_sites.entry_id 6RW2 _atom_sites.fract_transf_matrix[1][1] 0.023759 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008797 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007636 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 9 ? ? ? A . n A 1 2 SER 2 10 ? ? ? A . n A 1 3 ARG 3 11 ? ? ? A . n A 1 4 GLY 4 12 ? ? ? A . n A 1 5 SER 5 13 ? ? ? A . n A 1 6 HIS 6 14 ? ? ? A . n A 1 7 HIS 7 15 ? ? ? A . n A 1 8 HIS 8 16 ? ? ? A . n A 1 9 HIS 9 17 ? ? ? A . n A 1 10 HIS 10 18 ? ? ? A . n A 1 11 HIS 11 19 ? ? ? A . n A 1 12 GLY 12 20 ? ? ? A . n A 1 13 ALA 13 21 ? ? ? A . n A 1 14 SER 14 22 ? ? ? A . n A 1 15 ASP 15 23 ? ? ? A . n A 1 16 ASP 16 24 ? ? ? A . n A 1 17 ASP 17 25 ? ? ? A . n A 1 18 ASP 18 26 ? ? ? A . n A 1 19 LYS 19 27 27 LYS LYS A . n A 1 20 GLU 20 28 28 GLU GLU A . n A 1 21 VAL 21 29 29 VAL VAL A . n A 1 22 VAL 22 30 30 VAL VAL A . n A 1 23 LEU 23 31 31 LEU LEU A . n A 1 24 LEU 24 32 32 LEU LEU A . n A 1 25 ASP 25 33 33 ASP ASP A . n A 1 26 PHE 26 34 34 PHE PHE A . n A 1 27 ALA 27 35 35 ALA ALA A . n A 1 28 ALA 28 36 36 ALA ALA A . n A 1 29 ALA 29 37 37 ALA ALA A . n A 1 30 GLY 30 38 38 GLY GLY A . n A 1 31 GLY 31 39 39 GLY GLY A . n A 1 32 GLU 32 40 40 GLU GLU A . n A 1 33 LEU 33 41 41 LEU LEU A . n A 1 34 GLY 34 42 42 GLY GLY A . n A 1 35 TRP 35 43 43 TRP TRP A . n A 1 36 LEU 36 44 44 LEU LEU A . n A 1 37 THR 37 45 45 THR THR A . n A 1 38 HIS 38 46 46 HIS HIS A . n A 1 39 PRO 39 47 47 PRO PRO A . n A 1 40 TYR 40 48 48 TYR TYR A . n A 1 41 GLY 41 49 49 GLY GLY A . n A 1 42 LYS 42 50 50 LYS LYS A . n A 1 43 GLY 43 51 51 GLY GLY A . n A 1 44 TRP 44 52 52 TRP TRP A . n A 1 45 ASP 45 53 53 ASP ASP A . n A 1 46 LEU 46 54 54 LEU LEU A . n A 1 47 MET 47 55 55 MET MET A . n A 1 48 GLN 48 56 56 GLN GLN A . n A 1 49 ASN 49 57 57 ASN ASN A . n A 1 50 ILE 50 58 58 ILE ILE A . n A 1 51 MET 51 59 59 MET MET A . n A 1 52 ASN 52 60 60 ASN ASN A . n A 1 53 ASP 53 61 61 ASP ASP A . n A 1 54 MET 54 62 62 MET MET A . n A 1 55 PRO 55 63 63 PRO PRO A . n A 1 56 ILE 56 64 64 ILE ILE A . n A 1 57 TYR 57 65 65 TYR TYR A . n A 1 58 MET 58 66 66 MET MET A . n A 1 59 TYR 59 67 67 TYR TYR A . n A 1 60 SER 60 68 68 SER SER A . n A 1 61 VAL 61 69 69 VAL VAL A . n A 1 62 CYS 62 70 70 CYS CYS A . n A 1 63 ASN 63 71 71 ASN ASN A . n A 1 64 VAL 64 72 72 VAL VAL A . n A 1 65 MET 65 73 73 MET MET A . n A 1 66 SER 66 74 74 SER SER A . n A 1 67 GLY 67 75 75 GLY GLY A . n A 1 68 ASP 68 76 76 ASP ASP A . n A 1 69 GLN 69 77 77 GLN GLN A . n A 1 70 ASP 70 78 78 ASP ASP A . n A 1 71 ASN 71 79 79 ASN ASN A . n A 1 72 TRP 72 80 80 TRP TRP A . n A 1 73 LEU 73 81 81 LEU LEU A . n A 1 74 ARG 74 82 82 ARG ARG A . n A 1 75 THR 75 83 83 THR THR A . n A 1 76 ASN 76 84 84 ASN ASN A . n A 1 77 TRP 77 85 85 TRP TRP A . n A 1 78 VAL 78 86 86 VAL VAL A . n A 1 79 TYR 79 87 87 TYR TYR A . n A 1 80 ARG 80 88 88 ARG ARG A . n A 1 81 GLY 81 89 89 GLY GLY A . n A 1 82 GLU 82 90 90 GLU GLU A . n A 1 83 ALA 83 91 91 ALA ALA A . n A 1 84 GLU 84 92 92 GLU GLU A . n A 1 85 ARG 85 93 93 ARG ARG A . n A 1 86 ILE 86 94 94 ILE ILE A . n A 1 87 PHE 87 95 95 PHE PHE A . n A 1 88 ILE 88 96 96 ILE ILE A . n A 1 89 GLU 89 97 97 GLU GLU A . n A 1 90 LEU 90 98 98 LEU LEU A . n A 1 91 LYS 91 99 99 LYS LYS A . n A 1 92 PHE 92 100 100 PHE PHE A . n A 1 93 THR 93 101 101 THR THR A . n A 1 94 VAL 94 102 102 VAL VAL A . n A 1 95 ARG 95 103 103 ARG ARG A . n A 1 96 ASP 96 104 104 ASP ASP A . n A 1 97 CYS 97 105 105 CYS CYS A . n A 1 98 ASN 98 106 106 ASN ASN A . n A 1 99 SER 99 107 107 SER SER A . n A 1 100 PHE 100 108 108 PHE PHE A . n A 1 101 PRO 101 109 109 PRO PRO A . n A 1 102 GLY 102 110 110 GLY GLY A . n A 1 103 GLY 103 111 111 GLY GLY A . n A 1 104 ALA 104 112 112 ALA ALA A . n A 1 105 SER 105 113 113 SER SER A . n A 1 106 SER 106 114 114 SER SER A . n A 1 107 CYS 107 115 115 CYS CYS A . n A 1 108 LYS 108 116 116 LYS LYS A . n A 1 109 GLU 109 117 117 GLU GLU A . n A 1 110 THR 110 118 118 THR THR A . n A 1 111 PHE 111 119 119 PHE PHE A . n A 1 112 ASN 112 120 120 ASN ASN A . n A 1 113 LEU 113 121 121 LEU LEU A . n A 1 114 TYR 114 122 122 TYR TYR A . n A 1 115 TYR 115 123 123 TYR TYR A . n A 1 116 ALA 116 124 124 ALA ALA A . n A 1 117 GLU 117 125 125 GLU GLU A . n A 1 118 SER 118 126 126 SER SER A . n A 1 119 ASP 119 127 127 ASP ASP A . n A 1 120 LEU 120 128 128 LEU LEU A . n A 1 121 ASP 121 129 129 ASP ASP A . n A 1 122 TYR 122 130 130 TYR TYR A . n A 1 123 GLY 123 131 131 GLY GLY A . n A 1 124 THR 124 132 132 THR THR A . n A 1 125 ASN 125 133 133 ASN ASN A . n A 1 126 PHE 126 134 134 PHE PHE A . n A 1 127 GLN 127 135 135 GLN GLN A . n A 1 128 LYS 128 136 136 LYS LYS A . n A 1 129 ARG 129 137 137 ARG ARG A . n A 1 130 LEU 130 138 138 LEU LEU A . n A 1 131 PHE 131 139 139 PHE PHE A . n A 1 132 THR 132 140 140 THR THR A . n A 1 133 LYS 133 141 141 LYS LYS A . n A 1 134 ILE 134 142 142 ILE ILE A . n A 1 135 ASP 135 143 143 ASP ASP A . n A 1 136 THR 136 144 144 THR THR A . n A 1 137 ILE 137 145 145 ILE ILE A . n A 1 138 ALA 138 146 146 ALA ALA A . n A 1 139 PRO 139 147 147 PRO PRO A . n A 1 140 ASP 140 148 148 ASP ASP A . n A 1 141 GLU 141 149 149 GLU GLU A . n A 1 142 ILE 142 150 150 ILE ILE A . n A 1 143 THR 143 151 151 THR THR A . n A 1 144 VAL 144 152 152 VAL VAL A . n A 1 145 SER 145 153 153 SER SER A . n A 1 146 SER 146 154 154 SER SER A . n A 1 147 ASP 147 155 155 ASP ASP A . n A 1 148 PHE 148 156 156 PHE PHE A . n A 1 149 GLU 149 157 157 GLU GLU A . n A 1 150 ALA 150 158 158 ALA ALA A . n A 1 151 ARG 151 159 159 ARG ARG A . n A 1 152 HIS 152 160 160 HIS HIS A . n A 1 153 VAL 153 161 161 VAL VAL A . n A 1 154 LYS 154 162 162 LYS LYS A . n A 1 155 LEU 155 163 163 LEU LEU A . n A 1 156 ASN 156 164 164 ASN ASN A . n A 1 157 VAL 157 165 165 VAL VAL A . n A 1 158 GLU 158 166 166 GLU GLU A . n A 1 159 GLU 159 167 167 GLU GLU A . n A 1 160 ARG 160 168 168 ARG ARG A . n A 1 161 SER 161 169 169 SER SER A . n A 1 162 VAL 162 170 170 VAL VAL A . n A 1 163 GLY 163 171 171 GLY GLY A . n A 1 164 PRO 164 172 172 PRO PRO A . n A 1 165 LEU 165 173 173 LEU LEU A . n A 1 166 THR 166 174 174 THR THR A . n A 1 167 ARG 167 175 175 ARG ARG A . n A 1 168 LYS 168 176 176 LYS LYS A . n A 1 169 GLY 169 177 177 GLY GLY A . n A 1 170 PHE 170 178 178 PHE PHE A . n A 1 171 TYR 171 179 179 TYR TYR A . n A 1 172 LEU 172 180 180 LEU LEU A . n A 1 173 ALA 173 181 181 ALA ALA A . n A 1 174 PHE 174 182 182 PHE PHE A . n A 1 175 GLN 175 183 183 GLN GLN A . n A 1 176 ASP 176 184 184 ASP ASP A . n A 1 177 ILE 177 185 185 ILE ILE A . n A 1 178 GLY 178 186 186 GLY GLY A . n A 1 179 ALA 179 187 187 ALA ALA A . n A 1 180 CYS 180 188 188 CYS CYS A . n A 1 181 VAL 181 189 189 VAL VAL A . n A 1 182 ALA 182 190 190 ALA ALA A . n A 1 183 LEU 183 191 191 LEU LEU A . n A 1 184 LEU 184 192 192 LEU LEU A . n A 1 185 SER 185 193 193 SER SER A . n A 1 186 VAL 186 194 194 VAL VAL A . n A 1 187 ARG 187 195 195 ARG ARG A . n A 1 188 VAL 188 196 196 VAL VAL A . n A 1 189 TYR 189 197 197 TYR TYR A . n A 1 190 TYR 190 198 198 TYR TYR A . n A 1 191 LYS 191 199 199 LYS LYS A . n A 1 192 LYS 192 200 200 LYS LYS A . n A 1 193 CYS 193 201 201 CYS CYS A . n B 2 1 ALA 1 -1 -1 ALA ALA B . n B 2 2 ARG 2 0 0 ARG ARG B . n B 2 3 ASP 3 1 1 ASP ASP B . n B 2 4 CYS 4 2 2 CYS CYS B . n B 2 5 PRO 5 3 3 PRO PRO B . n B 2 6 LEU 6 4 4 LEU LEU B . n B 2 7 VAL 7 5 5 VAL VAL B . n B 2 8 ASN 8 6 6 ASN ASN B . n B 2 9 PRO 9 7 7 PRO PRO B . n B 2 10 LEU 10 8 8 LEU LEU B . n B 2 11 CYS 11 9 9 CYS CYS B . n B 2 12 LEU 12 10 10 LEU LEU B . n B 2 13 HIS 13 11 11 HIS HIS B . n B 2 14 PRO 14 12 12 PRO PRO B . n B 2 15 GLY 15 13 13 GLY GLY B . n B 2 16 TRP 16 14 14 TRP TRP B . n B 2 17 THR 17 15 15 THR THR B . n B 2 18 CYS 18 16 16 CYS CYS B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GOL 1 301 1 GOL GOL A . D 4 29N 1 101 1 29N DRG B . E 5 HOH 1 401 29 HOH HOH A . E 5 HOH 2 402 39 HOH HOH A . E 5 HOH 3 403 30 HOH HOH A . E 5 HOH 4 404 18 HOH HOH A . E 5 HOH 5 405 43 HOH HOH A . E 5 HOH 6 406 20 HOH HOH A . E 5 HOH 7 407 9 HOH HOH A . E 5 HOH 8 408 27 HOH HOH A . E 5 HOH 9 409 15 HOH HOH A . E 5 HOH 10 410 2 HOH HOH A . E 5 HOH 11 411 8 HOH HOH A . E 5 HOH 12 412 31 HOH HOH A . E 5 HOH 13 413 21 HOH HOH A . E 5 HOH 14 414 22 HOH HOH A . E 5 HOH 15 415 10 HOH HOH A . E 5 HOH 16 416 1 HOH HOH A . E 5 HOH 17 417 24 HOH HOH A . E 5 HOH 18 418 28 HOH HOH A . E 5 HOH 19 419 36 HOH HOH A . E 5 HOH 20 420 42 HOH HOH A . E 5 HOH 21 421 32 HOH HOH A . E 5 HOH 22 422 14 HOH HOH A . E 5 HOH 23 423 16 HOH HOH A . E 5 HOH 24 424 11 HOH HOH A . E 5 HOH 25 425 12 HOH HOH A . E 5 HOH 26 426 6 HOH HOH A . E 5 HOH 27 427 37 HOH HOH A . E 5 HOH 28 428 17 HOH HOH A . E 5 HOH 29 429 4 HOH HOH A . E 5 HOH 30 430 41 HOH HOH A . E 5 HOH 31 431 26 HOH HOH A . E 5 HOH 32 432 44 HOH HOH A . E 5 HOH 33 433 40 HOH HOH A . E 5 HOH 34 434 23 HOH HOH A . E 5 HOH 35 435 34 HOH HOH A . E 5 HOH 36 436 3 HOH HOH A . E 5 HOH 37 437 7 HOH HOH A . E 5 HOH 38 438 13 HOH HOH A . E 5 HOH 39 439 35 HOH HOH A . E 5 HOH 40 440 33 HOH HOH A . F 5 HOH 1 201 25 HOH HOH B . F 5 HOH 2 202 38 HOH HOH B . F 5 HOH 3 203 5 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2050 ? 1 MORE -15 ? 1 'SSA (A^2)' 9810 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-08 2 'Structure model' 1 1 2020-04-22 3 'Structure model' 1 2 2020-05-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.title' 2 2 'Structure model' '_citation_author.identifier_ORCID' 3 2 'Structure model' '_citation_author.name' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' 7 3 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLY _pdbx_validate_close_contact.auth_seq_id_1 49 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 401 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.00 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ASN _pdbx_validate_rmsd_angle.auth_seq_id_1 133 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ASN _pdbx_validate_rmsd_angle.auth_seq_id_2 133 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ASN _pdbx_validate_rmsd_angle.auth_seq_id_3 133 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 123.28 _pdbx_validate_rmsd_angle.angle_target_value 110.40 _pdbx_validate_rmsd_angle.angle_deviation 12.88 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.00 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 48 ? ? 44.90 -94.59 2 1 CYS A 70 ? ? -154.05 57.18 3 1 ARG B 0 ? ? 21.56 93.00 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 PRO A 47 ? ? TYR A 48 ? ? 147.18 2 1 GLY A 49 ? ? LYS A 50 ? ? 141.31 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 9 ? A ALA 1 2 1 Y 1 A SER 10 ? A SER 2 3 1 Y 1 A ARG 11 ? A ARG 3 4 1 Y 1 A GLY 12 ? A GLY 4 5 1 Y 1 A SER 13 ? A SER 5 6 1 Y 1 A HIS 14 ? A HIS 6 7 1 Y 1 A HIS 15 ? A HIS 7 8 1 Y 1 A HIS 16 ? A HIS 8 9 1 Y 1 A HIS 17 ? A HIS 9 10 1 Y 1 A HIS 18 ? A HIS 10 11 1 Y 1 A HIS 19 ? A HIS 11 12 1 Y 1 A GLY 20 ? A GLY 12 13 1 Y 1 A ALA 21 ? A ALA 13 14 1 Y 1 A SER 22 ? A SER 14 15 1 Y 1 A ASP 23 ? A ASP 15 16 1 Y 1 A ASP 24 ? A ASP 16 17 1 Y 1 A ASP 25 ? A ASP 17 18 1 Y 1 A ASP 26 ? A ASP 18 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 29N _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 29N _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 GLYCEROL GOL 4 "1,1',1''-(1,3,5-triazinane-1,3,5-triyl)tripropan-1-one" 29N 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #