data_6S89 # _entry.id 6S89 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6S89 pdb_00006s89 10.2210/pdb6s89/pdb WWPDB D_1292102030 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-10-16 2 'Structure model' 1 1 2020-01-01 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_ISSN' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation_author.name' 8 3 'Structure model' '_database_2.pdbx_DOI' 9 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6S89 _pdbx_database_status.recvd_initial_deposition_date 2019-07-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Niggenaber, J.' 1 0000-0003-2942-263X 'Mueller, M.P.' 2 0000-0002-1529-8933 'Rauh, D.' 3 0000-0002-1970-7642 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-6520 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 10789 _citation.page_last 10801 _citation.title 'Inhibition of osimertinib-resistant epidermal growth factor receptor EGFR-T790M/C797S.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/c9sc03445e _citation.pdbx_database_id_PubMed 31857889 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lategahn, J.' 1 ? primary 'Keul, M.' 2 ? primary 'Klovekorn, P.' 3 ? primary 'Tumbrink, H.L.' 4 ? primary 'Niggenaber, J.' 5 ? primary 'Muller, M.P.' 6 ? primary 'Hodson, L.' 7 ? primary 'Flasshoff, M.' 8 ? primary 'Hardick, J.' 9 ? primary 'Grabe, T.' 10 ? primary 'Engel, J.' 11 ? primary 'Schultz-Fademrecht, C.' 12 ? primary 'Baumann, M.' 13 ? primary 'Ketzer, J.' 14 ? primary 'Muhlenberg, T.' 15 ? primary 'Hiller, W.' 16 ? primary 'Gunther, G.' 17 ? primary 'Unger, A.' 18 ? primary 'Muller, H.' 19 ? primary 'Heimsoeth, A.' 20 ? primary 'Golz, C.' 21 ? primary 'Blank-Landeshammer, B.' 22 ? primary 'Kollipara, L.' 23 ? primary 'Zahedi, R.P.' 24 ? primary 'Strohmann, C.' 25 ? primary 'Hengstler, J.G.' 26 ? primary 'van Otterlo, W.A.L.' 27 ? primary 'Bauer, S.' 28 ? primary 'Rauh, D.' 29 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Epidermal growth factor receptor' 37715.613 1 2.7.10.1 'T790M, C797S, E865A, E866A, K867A' ? ? 2 non-polymer syn '~{N}-[3-[6-[4-(4-methylpiperazin-1-yl)phenyl]-4-propan-2-yloxy-7~{H}-pyrrolo[2,3-d]pyrimidin-5-yl]phenyl]propanamide' 498.619 1 ? ? ? ? 3 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proto-oncogene c-ErbB-1,Receptor tyrosine-protein kinase erbB-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMASGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASV DNPHVCRLLGICLTSTVQLIMQLMPFGSLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQ HVKITDFGLAKLLGAAAAEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEK GERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDD VVDADEYLIPQQG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMASGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASV DNPHVCRLLGICLTSTVQLIMQLMPFGSLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQ HVKITDFGLAKLLGAAAAEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEK GERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDD VVDADEYLIPQQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '~{N}-[3-[6-[4-(4-methylpiperazin-1-yl)phenyl]-4-propan-2-yloxy-7~{H}-pyrrolo[2,3-d]pyrimidin-5-yl]phenyl]propanamide' L0Q 3 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' MES # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 ALA n 1 10 PRO n 1 11 ASN n 1 12 GLN n 1 13 ALA n 1 14 LEU n 1 15 LEU n 1 16 ARG n 1 17 ILE n 1 18 LEU n 1 19 LYS n 1 20 GLU n 1 21 THR n 1 22 GLU n 1 23 PHE n 1 24 LYS n 1 25 LYS n 1 26 ILE n 1 27 LYS n 1 28 VAL n 1 29 LEU n 1 30 GLY n 1 31 SER n 1 32 GLY n 1 33 ALA n 1 34 PHE n 1 35 GLY n 1 36 THR n 1 37 VAL n 1 38 TYR n 1 39 LYS n 1 40 GLY n 1 41 LEU n 1 42 TRP n 1 43 ILE n 1 44 PRO n 1 45 GLU n 1 46 GLY n 1 47 GLU n 1 48 LYS n 1 49 VAL n 1 50 LYS n 1 51 ILE n 1 52 PRO n 1 53 VAL n 1 54 ALA n 1 55 ILE n 1 56 LYS n 1 57 GLU n 1 58 LEU n 1 59 ARG n 1 60 GLU n 1 61 ALA n 1 62 THR n 1 63 SER n 1 64 PRO n 1 65 LYS n 1 66 ALA n 1 67 ASN n 1 68 LYS n 1 69 GLU n 1 70 ILE n 1 71 LEU n 1 72 ASP n 1 73 GLU n 1 74 ALA n 1 75 TYR n 1 76 VAL n 1 77 MET n 1 78 ALA n 1 79 SER n 1 80 VAL n 1 81 ASP n 1 82 ASN n 1 83 PRO n 1 84 HIS n 1 85 VAL n 1 86 CYS n 1 87 ARG n 1 88 LEU n 1 89 LEU n 1 90 GLY n 1 91 ILE n 1 92 CYS n 1 93 LEU n 1 94 THR n 1 95 SER n 1 96 THR n 1 97 VAL n 1 98 GLN n 1 99 LEU n 1 100 ILE n 1 101 MET n 1 102 GLN n 1 103 LEU n 1 104 MET n 1 105 PRO n 1 106 PHE n 1 107 GLY n 1 108 SER n 1 109 LEU n 1 110 LEU n 1 111 ASP n 1 112 TYR n 1 113 VAL n 1 114 ARG n 1 115 GLU n 1 116 HIS n 1 117 LYS n 1 118 ASP n 1 119 ASN n 1 120 ILE n 1 121 GLY n 1 122 SER n 1 123 GLN n 1 124 TYR n 1 125 LEU n 1 126 LEU n 1 127 ASN n 1 128 TRP n 1 129 CYS n 1 130 VAL n 1 131 GLN n 1 132 ILE n 1 133 ALA n 1 134 LYS n 1 135 GLY n 1 136 MET n 1 137 ASN n 1 138 TYR n 1 139 LEU n 1 140 GLU n 1 141 ASP n 1 142 ARG n 1 143 ARG n 1 144 LEU n 1 145 VAL n 1 146 HIS n 1 147 ARG n 1 148 ASP n 1 149 LEU n 1 150 ALA n 1 151 ALA n 1 152 ARG n 1 153 ASN n 1 154 VAL n 1 155 LEU n 1 156 VAL n 1 157 LYS n 1 158 THR n 1 159 PRO n 1 160 GLN n 1 161 HIS n 1 162 VAL n 1 163 LYS n 1 164 ILE n 1 165 THR n 1 166 ASP n 1 167 PHE n 1 168 GLY n 1 169 LEU n 1 170 ALA n 1 171 LYS n 1 172 LEU n 1 173 LEU n 1 174 GLY n 1 175 ALA n 1 176 ALA n 1 177 ALA n 1 178 ALA n 1 179 GLU n 1 180 TYR n 1 181 HIS n 1 182 ALA n 1 183 GLU n 1 184 GLY n 1 185 GLY n 1 186 LYS n 1 187 VAL n 1 188 PRO n 1 189 ILE n 1 190 LYS n 1 191 TRP n 1 192 MET n 1 193 ALA n 1 194 LEU n 1 195 GLU n 1 196 SER n 1 197 ILE n 1 198 LEU n 1 199 HIS n 1 200 ARG n 1 201 ILE n 1 202 TYR n 1 203 THR n 1 204 HIS n 1 205 GLN n 1 206 SER n 1 207 ASP n 1 208 VAL n 1 209 TRP n 1 210 SER n 1 211 TYR n 1 212 GLY n 1 213 VAL n 1 214 THR n 1 215 VAL n 1 216 TRP n 1 217 GLU n 1 218 LEU n 1 219 MET n 1 220 THR n 1 221 PHE n 1 222 GLY n 1 223 SER n 1 224 LYS n 1 225 PRO n 1 226 TYR n 1 227 ASP n 1 228 GLY n 1 229 ILE n 1 230 PRO n 1 231 ALA n 1 232 SER n 1 233 GLU n 1 234 ILE n 1 235 SER n 1 236 SER n 1 237 ILE n 1 238 LEU n 1 239 GLU n 1 240 LYS n 1 241 GLY n 1 242 GLU n 1 243 ARG n 1 244 LEU n 1 245 PRO n 1 246 GLN n 1 247 PRO n 1 248 PRO n 1 249 ILE n 1 250 CYS n 1 251 THR n 1 252 ILE n 1 253 ASP n 1 254 VAL n 1 255 TYR n 1 256 MET n 1 257 ILE n 1 258 MET n 1 259 VAL n 1 260 LYS n 1 261 CYS n 1 262 TRP n 1 263 MET n 1 264 ILE n 1 265 ASP n 1 266 ALA n 1 267 ASP n 1 268 SER n 1 269 ARG n 1 270 PRO n 1 271 LYS n 1 272 PHE n 1 273 ARG n 1 274 GLU n 1 275 LEU n 1 276 ILE n 1 277 ILE n 1 278 GLU n 1 279 PHE n 1 280 SER n 1 281 LYS n 1 282 MET n 1 283 ALA n 1 284 ARG n 1 285 ASP n 1 286 PRO n 1 287 GLN n 1 288 ARG n 1 289 TYR n 1 290 LEU n 1 291 VAL n 1 292 ILE n 1 293 GLN n 1 294 GLY n 1 295 ASP n 1 296 GLU n 1 297 ARG n 1 298 MET n 1 299 HIS n 1 300 LEU n 1 301 PRO n 1 302 SER n 1 303 PRO n 1 304 THR n 1 305 ASP n 1 306 SER n 1 307 ASN n 1 308 PHE n 1 309 TYR n 1 310 ARG n 1 311 ALA n 1 312 LEU n 1 313 MET n 1 314 ASP n 1 315 GLU n 1 316 GLU n 1 317 ASP n 1 318 MET n 1 319 ASP n 1 320 ASP n 1 321 VAL n 1 322 VAL n 1 323 ASP n 1 324 ALA n 1 325 ASP n 1 326 GLU n 1 327 TYR n 1 328 LEU n 1 329 ILE n 1 330 PRO n 1 331 GLN n 1 332 GLN n 1 333 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 333 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EGFR, ERBB, ERBB1, HER1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 L0Q non-polymer . '~{N}-[3-[6-[4-(4-methylpiperazin-1-yl)phenyl]-4-propan-2-yloxy-7~{H}-pyrrolo[2,3-d]pyrimidin-5-yl]phenyl]propanamide' ? 'C29 H34 N6 O2' 498.619 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MES non-polymer . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ? 'C6 H13 N O4 S' 195.237 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 690 ? ? ? A . n A 1 2 SER 2 691 ? ? ? A . n A 1 3 HIS 3 692 ? ? ? A . n A 1 4 MET 4 693 ? ? ? A . n A 1 5 ALA 5 694 ? ? ? A . n A 1 6 SER 6 695 ? ? ? A . n A 1 7 GLY 7 696 ? ? ? A . n A 1 8 GLU 8 697 697 GLU GLU A . n A 1 9 ALA 9 698 698 ALA ALA A . n A 1 10 PRO 10 699 699 PRO PRO A . n A 1 11 ASN 11 700 700 ASN ASN A . n A 1 12 GLN 12 701 701 GLN GLN A . n A 1 13 ALA 13 702 702 ALA ALA A . n A 1 14 LEU 14 703 703 LEU LEU A . n A 1 15 LEU 15 704 704 LEU LEU A . n A 1 16 ARG 16 705 705 ARG ARG A . n A 1 17 ILE 17 706 706 ILE ILE A . n A 1 18 LEU 18 707 707 LEU LEU A . n A 1 19 LYS 19 708 708 LYS LYS A . n A 1 20 GLU 20 709 709 GLU GLU A . n A 1 21 THR 21 710 710 THR THR A . n A 1 22 GLU 22 711 711 GLU GLU A . n A 1 23 PHE 23 712 712 PHE PHE A . n A 1 24 LYS 24 713 713 LYS LYS A . n A 1 25 LYS 25 714 714 LYS LYS A . n A 1 26 ILE 26 715 715 ILE ILE A . n A 1 27 LYS 27 716 716 LYS LYS A . n A 1 28 VAL 28 717 717 VAL VAL A . n A 1 29 LEU 29 718 718 LEU LEU A . n A 1 30 GLY 30 719 719 GLY GLY A . n A 1 31 SER 31 720 720 SER SER A . n A 1 32 GLY 32 721 721 GLY GLY A . n A 1 33 ALA 33 722 722 ALA ALA A . n A 1 34 PHE 34 723 723 PHE PHE A . n A 1 35 GLY 35 724 724 GLY GLY A . n A 1 36 THR 36 725 725 THR THR A . n A 1 37 VAL 37 726 726 VAL VAL A . n A 1 38 TYR 38 727 727 TYR TYR A . n A 1 39 LYS 39 728 728 LYS LYS A . n A 1 40 GLY 40 729 729 GLY GLY A . n A 1 41 LEU 41 730 730 LEU LEU A . n A 1 42 TRP 42 731 731 TRP TRP A . n A 1 43 ILE 43 732 732 ILE ILE A . n A 1 44 PRO 44 733 733 PRO PRO A . n A 1 45 GLU 45 734 734 GLU GLU A . n A 1 46 GLY 46 735 735 GLY GLY A . n A 1 47 GLU 47 736 736 GLU GLU A . n A 1 48 LYS 48 737 737 LYS LYS A . n A 1 49 VAL 49 738 738 VAL VAL A . n A 1 50 LYS 50 739 739 LYS LYS A . n A 1 51 ILE 51 740 740 ILE ILE A . n A 1 52 PRO 52 741 741 PRO PRO A . n A 1 53 VAL 53 742 742 VAL VAL A . n A 1 54 ALA 54 743 743 ALA ALA A . n A 1 55 ILE 55 744 744 ILE ILE A . n A 1 56 LYS 56 745 745 LYS LYS A . n A 1 57 GLU 57 746 746 GLU GLU A . n A 1 58 LEU 58 747 747 LEU LEU A . n A 1 59 ARG 59 748 748 ARG ARG A . n A 1 60 GLU 60 749 749 GLU GLU A . n A 1 61 ALA 61 750 750 ALA ALA A . n A 1 62 THR 62 751 751 THR THR A . n A 1 63 SER 63 752 752 SER SER A . n A 1 64 PRO 64 753 753 PRO PRO A . n A 1 65 LYS 65 754 754 LYS LYS A . n A 1 66 ALA 66 755 755 ALA ALA A . n A 1 67 ASN 67 756 756 ASN ASN A . n A 1 68 LYS 68 757 757 LYS LYS A . n A 1 69 GLU 69 758 758 GLU GLU A . n A 1 70 ILE 70 759 759 ILE ILE A . n A 1 71 LEU 71 760 760 LEU LEU A . n A 1 72 ASP 72 761 761 ASP ASP A . n A 1 73 GLU 73 762 762 GLU GLU A . n A 1 74 ALA 74 763 763 ALA ALA A . n A 1 75 TYR 75 764 764 TYR TYR A . n A 1 76 VAL 76 765 765 VAL VAL A . n A 1 77 MET 77 766 766 MET MET A . n A 1 78 ALA 78 767 767 ALA ALA A . n A 1 79 SER 79 768 768 SER SER A . n A 1 80 VAL 80 769 769 VAL VAL A . n A 1 81 ASP 81 770 770 ASP ASP A . n A 1 82 ASN 82 771 771 ASN ASN A . n A 1 83 PRO 83 772 772 PRO PRO A . n A 1 84 HIS 84 773 773 HIS HIS A . n A 1 85 VAL 85 774 774 VAL VAL A . n A 1 86 CYS 86 775 775 CYS CYS A . n A 1 87 ARG 87 776 776 ARG ARG A . n A 1 88 LEU 88 777 777 LEU LEU A . n A 1 89 LEU 89 778 778 LEU LEU A . n A 1 90 GLY 90 779 779 GLY GLY A . n A 1 91 ILE 91 780 780 ILE ILE A . n A 1 92 CYS 92 781 781 CYS CYS A . n A 1 93 LEU 93 782 782 LEU LEU A . n A 1 94 THR 94 783 783 THR THR A . n A 1 95 SER 95 784 784 SER SER A . n A 1 96 THR 96 785 785 THR THR A . n A 1 97 VAL 97 786 786 VAL VAL A . n A 1 98 GLN 98 787 787 GLN GLN A . n A 1 99 LEU 99 788 788 LEU LEU A . n A 1 100 ILE 100 789 789 ILE ILE A . n A 1 101 MET 101 790 790 MET MET A . n A 1 102 GLN 102 791 791 GLN GLN A . n A 1 103 LEU 103 792 792 LEU LEU A . n A 1 104 MET 104 793 793 MET MET A . n A 1 105 PRO 105 794 794 PRO PRO A . n A 1 106 PHE 106 795 795 PHE PHE A . n A 1 107 GLY 107 796 796 GLY GLY A . n A 1 108 SER 108 797 797 SER SER A . n A 1 109 LEU 109 798 798 LEU LEU A . n A 1 110 LEU 110 799 799 LEU LEU A . n A 1 111 ASP 111 800 800 ASP ASP A . n A 1 112 TYR 112 801 801 TYR TYR A . n A 1 113 VAL 113 802 802 VAL VAL A . n A 1 114 ARG 114 803 803 ARG ARG A . n A 1 115 GLU 115 804 804 GLU GLU A . n A 1 116 HIS 116 805 805 HIS HIS A . n A 1 117 LYS 117 806 806 LYS LYS A . n A 1 118 ASP 118 807 807 ASP ASP A . n A 1 119 ASN 119 808 808 ASN ASN A . n A 1 120 ILE 120 809 809 ILE ILE A . n A 1 121 GLY 121 810 810 GLY GLY A . n A 1 122 SER 122 811 811 SER SER A . n A 1 123 GLN 123 812 812 GLN GLN A . n A 1 124 TYR 124 813 813 TYR TYR A . n A 1 125 LEU 125 814 814 LEU LEU A . n A 1 126 LEU 126 815 815 LEU LEU A . n A 1 127 ASN 127 816 816 ASN ASN A . n A 1 128 TRP 128 817 817 TRP TRP A . n A 1 129 CYS 129 818 818 CYS CYS A . n A 1 130 VAL 130 819 819 VAL VAL A . n A 1 131 GLN 131 820 820 GLN GLN A . n A 1 132 ILE 132 821 821 ILE ILE A . n A 1 133 ALA 133 822 822 ALA ALA A . n A 1 134 LYS 134 823 823 LYS LYS A . n A 1 135 GLY 135 824 824 GLY GLY A . n A 1 136 MET 136 825 825 MET MET A . n A 1 137 ASN 137 826 826 ASN ASN A . n A 1 138 TYR 138 827 827 TYR TYR A . n A 1 139 LEU 139 828 828 LEU LEU A . n A 1 140 GLU 140 829 829 GLU GLU A . n A 1 141 ASP 141 830 830 ASP ASP A . n A 1 142 ARG 142 831 831 ARG ARG A . n A 1 143 ARG 143 832 832 ARG ARG A . n A 1 144 LEU 144 833 833 LEU LEU A . n A 1 145 VAL 145 834 834 VAL VAL A . n A 1 146 HIS 146 835 835 HIS HIS A . n A 1 147 ARG 147 836 836 ARG ARG A . n A 1 148 ASP 148 837 837 ASP ASP A . n A 1 149 LEU 149 838 838 LEU LEU A . n A 1 150 ALA 150 839 839 ALA ALA A . n A 1 151 ALA 151 840 840 ALA ALA A . n A 1 152 ARG 152 841 841 ARG ARG A . n A 1 153 ASN 153 842 842 ASN ASN A . n A 1 154 VAL 154 843 843 VAL VAL A . n A 1 155 LEU 155 844 844 LEU LEU A . n A 1 156 VAL 156 845 845 VAL VAL A . n A 1 157 LYS 157 846 846 LYS LYS A . n A 1 158 THR 158 847 847 THR THR A . n A 1 159 PRO 159 848 848 PRO PRO A . n A 1 160 GLN 160 849 849 GLN GLN A . n A 1 161 HIS 161 850 850 HIS HIS A . n A 1 162 VAL 162 851 851 VAL VAL A . n A 1 163 LYS 163 852 852 LYS LYS A . n A 1 164 ILE 164 853 853 ILE ILE A . n A 1 165 THR 165 854 854 THR THR A . n A 1 166 ASP 166 855 855 ASP ASP A . n A 1 167 PHE 167 856 856 PHE PHE A . n A 1 168 GLY 168 857 857 GLY GLY A . n A 1 169 LEU 169 858 858 LEU LEU A . n A 1 170 ALA 170 859 859 ALA ALA A . n A 1 171 LYS 171 860 860 LYS LYS A . n A 1 172 LEU 172 861 861 LEU LEU A . n A 1 173 LEU 173 862 862 LEU LEU A . n A 1 174 GLY 174 863 863 GLY GLY A . n A 1 175 ALA 175 864 864 ALA ALA A . n A 1 176 ALA 176 865 865 ALA ALA A . n A 1 177 ALA 177 866 866 ALA ALA A . n A 1 178 ALA 178 867 867 ALA ALA A . n A 1 179 GLU 179 868 868 GLU GLU A . n A 1 180 TYR 180 869 869 TYR TYR A . n A 1 181 HIS 181 870 870 HIS HIS A . n A 1 182 ALA 182 871 871 ALA ALA A . n A 1 183 GLU 183 872 872 GLU GLU A . n A 1 184 GLY 184 873 873 GLY GLY A . n A 1 185 GLY 185 874 874 GLY GLY A . n A 1 186 LYS 186 875 875 LYS LYS A . n A 1 187 VAL 187 876 876 VAL VAL A . n A 1 188 PRO 188 877 877 PRO PRO A . n A 1 189 ILE 189 878 878 ILE ILE A . n A 1 190 LYS 190 879 879 LYS LYS A . n A 1 191 TRP 191 880 880 TRP TRP A . n A 1 192 MET 192 881 881 MET MET A . n A 1 193 ALA 193 882 882 ALA ALA A . n A 1 194 LEU 194 883 883 LEU LEU A . n A 1 195 GLU 195 884 884 GLU GLU A . n A 1 196 SER 196 885 885 SER SER A . n A 1 197 ILE 197 886 886 ILE ILE A . n A 1 198 LEU 198 887 887 LEU LEU A . n A 1 199 HIS 199 888 888 HIS HIS A . n A 1 200 ARG 200 889 889 ARG ARG A . n A 1 201 ILE 201 890 890 ILE ILE A . n A 1 202 TYR 202 891 891 TYR TYR A . n A 1 203 THR 203 892 892 THR THR A . n A 1 204 HIS 204 893 893 HIS HIS A . n A 1 205 GLN 205 894 894 GLN GLN A . n A 1 206 SER 206 895 895 SER SER A . n A 1 207 ASP 207 896 896 ASP ASP A . n A 1 208 VAL 208 897 897 VAL VAL A . n A 1 209 TRP 209 898 898 TRP TRP A . n A 1 210 SER 210 899 899 SER SER A . n A 1 211 TYR 211 900 900 TYR TYR A . n A 1 212 GLY 212 901 901 GLY GLY A . n A 1 213 VAL 213 902 902 VAL VAL A . n A 1 214 THR 214 903 903 THR THR A . n A 1 215 VAL 215 904 904 VAL VAL A . n A 1 216 TRP 216 905 905 TRP TRP A . n A 1 217 GLU 217 906 906 GLU GLU A . n A 1 218 LEU 218 907 907 LEU LEU A . n A 1 219 MET 219 908 908 MET MET A . n A 1 220 THR 220 909 909 THR THR A . n A 1 221 PHE 221 910 910 PHE PHE A . n A 1 222 GLY 222 911 911 GLY GLY A . n A 1 223 SER 223 912 912 SER SER A . n A 1 224 LYS 224 913 913 LYS LYS A . n A 1 225 PRO 225 914 914 PRO PRO A . n A 1 226 TYR 226 915 915 TYR TYR A . n A 1 227 ASP 227 916 916 ASP ASP A . n A 1 228 GLY 228 917 917 GLY GLY A . n A 1 229 ILE 229 918 918 ILE ILE A . n A 1 230 PRO 230 919 919 PRO PRO A . n A 1 231 ALA 231 920 920 ALA ALA A . n A 1 232 SER 232 921 921 SER SER A . n A 1 233 GLU 233 922 922 GLU GLU A . n A 1 234 ILE 234 923 923 ILE ILE A . n A 1 235 SER 235 924 924 SER SER A . n A 1 236 SER 236 925 925 SER SER A . n A 1 237 ILE 237 926 926 ILE ILE A . n A 1 238 LEU 238 927 927 LEU LEU A . n A 1 239 GLU 239 928 928 GLU GLU A . n A 1 240 LYS 240 929 929 LYS LYS A . n A 1 241 GLY 241 930 930 GLY GLY A . n A 1 242 GLU 242 931 931 GLU GLU A . n A 1 243 ARG 243 932 932 ARG ARG A . n A 1 244 LEU 244 933 933 LEU LEU A . n A 1 245 PRO 245 934 934 PRO PRO A . n A 1 246 GLN 246 935 935 GLN GLN A . n A 1 247 PRO 247 936 936 PRO PRO A . n A 1 248 PRO 248 937 937 PRO PRO A . n A 1 249 ILE 249 938 938 ILE ILE A . n A 1 250 CYS 250 939 939 CYS CYS A . n A 1 251 THR 251 940 940 THR THR A . n A 1 252 ILE 252 941 941 ILE ILE A . n A 1 253 ASP 253 942 942 ASP ASP A . n A 1 254 VAL 254 943 943 VAL VAL A . n A 1 255 TYR 255 944 944 TYR TYR A . n A 1 256 MET 256 945 945 MET MET A . n A 1 257 ILE 257 946 946 ILE ILE A . n A 1 258 MET 258 947 947 MET MET A . n A 1 259 VAL 259 948 948 VAL VAL A . n A 1 260 LYS 260 949 949 LYS LYS A . n A 1 261 CYS 261 950 950 CYS CYS A . n A 1 262 TRP 262 951 951 TRP TRP A . n A 1 263 MET 263 952 952 MET MET A . n A 1 264 ILE 264 953 953 ILE ILE A . n A 1 265 ASP 265 954 954 ASP ASP A . n A 1 266 ALA 266 955 955 ALA ALA A . n A 1 267 ASP 267 956 956 ASP ASP A . n A 1 268 SER 268 957 957 SER SER A . n A 1 269 ARG 269 958 958 ARG ARG A . n A 1 270 PRO 270 959 959 PRO PRO A . n A 1 271 LYS 271 960 960 LYS LYS A . n A 1 272 PHE 272 961 961 PHE PHE A . n A 1 273 ARG 273 962 962 ARG ARG A . n A 1 274 GLU 274 963 963 GLU GLU A . n A 1 275 LEU 275 964 964 LEU LEU A . n A 1 276 ILE 276 965 965 ILE ILE A . n A 1 277 ILE 277 966 966 ILE ILE A . n A 1 278 GLU 278 967 967 GLU GLU A . n A 1 279 PHE 279 968 968 PHE PHE A . n A 1 280 SER 280 969 969 SER SER A . n A 1 281 LYS 281 970 970 LYS LYS A . n A 1 282 MET 282 971 971 MET MET A . n A 1 283 ALA 283 972 972 ALA ALA A . n A 1 284 ARG 284 973 973 ARG ARG A . n A 1 285 ASP 285 974 974 ASP ASP A . n A 1 286 PRO 286 975 975 PRO PRO A . n A 1 287 GLN 287 976 976 GLN GLN A . n A 1 288 ARG 288 977 977 ARG ARG A . n A 1 289 TYR 289 978 978 TYR TYR A . n A 1 290 LEU 290 979 979 LEU LEU A . n A 1 291 VAL 291 980 980 VAL VAL A . n A 1 292 ILE 292 981 981 ILE ILE A . n A 1 293 GLN 293 982 982 GLN GLN A . n A 1 294 GLY 294 983 983 GLY GLY A . n A 1 295 ASP 295 984 984 ASP ASP A . n A 1 296 GLU 296 985 985 GLU GLU A . n A 1 297 ARG 297 986 ? ? ? A . n A 1 298 MET 298 987 ? ? ? A . n A 1 299 HIS 299 988 ? ? ? A . n A 1 300 LEU 300 989 ? ? ? A . n A 1 301 PRO 301 990 ? ? ? A . n A 1 302 SER 302 991 ? ? ? A . n A 1 303 PRO 303 992 ? ? ? A . n A 1 304 THR 304 993 ? ? ? A . n A 1 305 ASP 305 994 ? ? ? A . n A 1 306 SER 306 995 ? ? ? A . n A 1 307 ASN 307 996 ? ? ? A . n A 1 308 PHE 308 997 997 PHE PHE A . n A 1 309 TYR 309 998 998 TYR TYR A . n A 1 310 ARG 310 999 999 ARG ARG A . n A 1 311 ALA 311 1000 1000 ALA ALA A . n A 1 312 LEU 312 1001 1001 LEU LEU A . n A 1 313 MET 313 1002 1002 MET MET A . n A 1 314 ASP 314 1003 1003 ASP ASP A . n A 1 315 GLU 315 1004 1004 GLU GLU A . n A 1 316 GLU 316 1005 1005 GLU GLU A . n A 1 317 ASP 317 1006 1006 ASP ASP A . n A 1 318 MET 318 1007 1007 MET MET A . n A 1 319 ASP 319 1008 1008 ASP ASP A . n A 1 320 ASP 320 1009 1009 ASP ASP A . n A 1 321 VAL 321 1010 1010 VAL VAL A . n A 1 322 VAL 322 1011 1011 VAL VAL A . n A 1 323 ASP 323 1012 1012 ASP ASP A . n A 1 324 ALA 324 1013 1013 ALA ALA A . n A 1 325 ASP 325 1014 1014 ASP ASP A . n A 1 326 GLU 326 1015 1015 GLU GLU A . n A 1 327 TYR 327 1016 1016 TYR TYR A . n A 1 328 LEU 328 1017 1017 LEU LEU A . n A 1 329 ILE 329 1018 ? ? ? A . n A 1 330 PRO 330 1019 ? ? ? A . n A 1 331 GLN 331 1020 ? ? ? A . n A 1 332 GLN 332 1021 ? ? ? A . n A 1 333 GLY 333 1022 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 L0Q 1 1101 1101 L0Q DRG A . C 3 MES 1 1102 1201 MES MES A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 716 ? CG ? A LYS 27 CG 2 1 Y 1 A LYS 716 ? CD ? A LYS 27 CD 3 1 Y 1 A LYS 716 ? CE ? A LYS 27 CE 4 1 Y 1 A LYS 716 ? NZ ? A LYS 27 NZ 5 1 Y 1 A PHE 723 ? CG ? A PHE 34 CG 6 1 Y 1 A PHE 723 ? CD1 ? A PHE 34 CD1 7 1 Y 1 A PHE 723 ? CD2 ? A PHE 34 CD2 8 1 Y 1 A PHE 723 ? CE1 ? A PHE 34 CE1 9 1 Y 1 A PHE 723 ? CE2 ? A PHE 34 CE2 10 1 Y 1 A PHE 723 ? CZ ? A PHE 34 CZ 11 1 Y 1 A LYS 737 ? CG ? A LYS 48 CG 12 1 Y 1 A LYS 737 ? CD ? A LYS 48 CD 13 1 Y 1 A LYS 737 ? CE ? A LYS 48 CE 14 1 Y 1 A LYS 737 ? NZ ? A LYS 48 NZ 15 1 Y 1 A ARG 748 ? CG ? A ARG 59 CG 16 1 Y 1 A ARG 748 ? CD ? A ARG 59 CD 17 1 Y 1 A ARG 748 ? NE ? A ARG 59 NE 18 1 Y 1 A ARG 748 ? CZ ? A ARG 59 CZ 19 1 Y 1 A ARG 748 ? NH1 ? A ARG 59 NH1 20 1 Y 1 A ARG 748 ? NH2 ? A ARG 59 NH2 21 1 Y 1 A GLU 749 ? CG ? A GLU 60 CG 22 1 Y 1 A GLU 749 ? CD ? A GLU 60 CD 23 1 Y 1 A GLU 749 ? OE1 ? A GLU 60 OE1 24 1 Y 1 A GLU 749 ? OE2 ? A GLU 60 OE2 25 1 Y 1 A LYS 754 ? CG ? A LYS 65 CG 26 1 Y 1 A LYS 754 ? CD ? A LYS 65 CD 27 1 Y 1 A LYS 754 ? CE ? A LYS 65 CE 28 1 Y 1 A LYS 754 ? NZ ? A LYS 65 NZ 29 1 Y 1 A LYS 757 ? CG ? A LYS 68 CG 30 1 Y 1 A LYS 757 ? CD ? A LYS 68 CD 31 1 Y 1 A LYS 757 ? CE ? A LYS 68 CE 32 1 Y 1 A LYS 757 ? NZ ? A LYS 68 NZ 33 1 Y 1 A GLU 758 ? CG ? A GLU 69 CG 34 1 Y 1 A GLU 758 ? CD ? A GLU 69 CD 35 1 Y 1 A GLU 758 ? OE1 ? A GLU 69 OE1 36 1 Y 1 A GLU 758 ? OE2 ? A GLU 69 OE2 37 1 Y 1 A GLU 804 ? CG ? A GLU 115 CG 38 1 Y 1 A GLU 804 ? CD ? A GLU 115 CD 39 1 Y 1 A GLU 804 ? OE1 ? A GLU 115 OE1 40 1 Y 1 A GLU 804 ? OE2 ? A GLU 115 OE2 41 1 Y 1 A GLU 868 ? CG ? A GLU 179 CG 42 1 Y 1 A GLU 868 ? CD ? A GLU 179 CD 43 1 Y 1 A GLU 868 ? OE1 ? A GLU 179 OE1 44 1 Y 1 A GLU 868 ? OE2 ? A GLU 179 OE2 45 1 Y 1 A GLU 872 ? CG ? A GLU 183 CG 46 1 Y 1 A GLU 872 ? CD ? A GLU 183 CD 47 1 Y 1 A GLU 872 ? OE1 ? A GLU 183 OE1 48 1 Y 1 A GLU 872 ? OE2 ? A GLU 183 OE2 49 1 Y 1 A LYS 875 ? CG ? A LYS 186 CG 50 1 Y 1 A LYS 875 ? CD ? A LYS 186 CD 51 1 Y 1 A LYS 875 ? CE ? A LYS 186 CE 52 1 Y 1 A LYS 875 ? NZ ? A LYS 186 NZ 53 1 Y 1 A PHE 997 ? CG ? A PHE 308 CG 54 1 Y 1 A PHE 997 ? CD1 ? A PHE 308 CD1 55 1 Y 1 A PHE 997 ? CD2 ? A PHE 308 CD2 56 1 Y 1 A PHE 997 ? CE1 ? A PHE 308 CE1 57 1 Y 1 A PHE 997 ? CE2 ? A PHE 308 CE2 58 1 Y 1 A PHE 997 ? CZ ? A PHE 308 CZ 59 1 Y 1 A TYR 998 ? CG ? A TYR 309 CG 60 1 Y 1 A TYR 998 ? CD1 ? A TYR 309 CD1 61 1 Y 1 A TYR 998 ? CD2 ? A TYR 309 CD2 62 1 Y 1 A TYR 998 ? CE1 ? A TYR 309 CE1 63 1 Y 1 A TYR 998 ? CE2 ? A TYR 309 CE2 64 1 Y 1 A TYR 998 ? CZ ? A TYR 309 CZ 65 1 Y 1 A TYR 998 ? OH ? A TYR 309 OH 66 1 Y 1 A ARG 999 ? CG ? A ARG 310 CG 67 1 Y 1 A ARG 999 ? CD ? A ARG 310 CD 68 1 Y 1 A ARG 999 ? NE ? A ARG 310 NE 69 1 Y 1 A ARG 999 ? CZ ? A ARG 310 CZ 70 1 Y 1 A ARG 999 ? NH1 ? A ARG 310 NH1 71 1 Y 1 A ARG 999 ? NH2 ? A ARG 310 NH2 72 1 Y 1 A LEU 1001 ? CG ? A LEU 312 CG 73 1 Y 1 A LEU 1001 ? CD1 ? A LEU 312 CD1 74 1 Y 1 A LEU 1001 ? CD2 ? A LEU 312 CD2 75 1 Y 1 A GLU 1004 ? CG ? A GLU 315 CG 76 1 Y 1 A GLU 1004 ? CD ? A GLU 315 CD 77 1 Y 1 A GLU 1004 ? OE1 ? A GLU 315 OE1 78 1 Y 1 A GLU 1004 ? OE2 ? A GLU 315 OE2 79 1 Y 1 A GLU 1005 ? CG ? A GLU 316 CG 80 1 Y 1 A GLU 1005 ? CD ? A GLU 316 CD 81 1 Y 1 A GLU 1005 ? OE1 ? A GLU 316 OE1 82 1 Y 1 A GLU 1005 ? OE2 ? A GLU 316 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10_2155 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6S89 _cell.details ? _cell.formula_units_Z ? _cell.length_a 143.830 _cell.length_a_esd ? _cell.length_b 143.830 _cell.length_b_esd ? _cell.length_c 143.830 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6S89 _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6S89 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.30 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 62.67 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;1.35 K-Na-tartrate, 100 mM Na-MES (pH 6.5), 2 % 1,3-Propanediol, 5.5 mg/ml EGFR T790M/C797 (in 100 mM NaCl, 25mM Tris-HCl, 10 % Glycerol, 1mM TCEP, pH 8.0), 1 ul reservoir + 1 ul protein solution ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-02-10 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6S89 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.7 _reflns.d_resolution_low 41.52 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13758 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.01 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.64 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.119 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.8 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.17 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1398 _reflns_shell.percent_possible_all 99.9 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 9.59 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.089 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.475 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 192.880 _refine.B_iso_mean 80.0011 _refine.B_iso_min 41.580 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6S89 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7010 _refine.ls_d_res_low 41.5200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13756 _refine.ls_number_reflns_R_free 688 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9900 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1906 _refine.ls_R_factor_R_free 0.2337 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1882 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5j9z _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.7300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.7010 _refine_hist.d_res_low 41.5200 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2457 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 310 _refine_hist.pdbx_B_iso_mean_ligand 106.44 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2395 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 62 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 2498 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.989 ? 3395 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.051 ? 382 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 425 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.947 ? 1520 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.7010 2.9093 . . 136 2589 100.0000 . . . 0.4138 0.0000 0.3506 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9093 3.2020 . . 136 2593 100.0000 . . . 0.3075 0.0000 0.2412 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2020 3.6651 . . 137 2586 100.0000 . . . 0.2582 0.0000 0.1969 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6651 4.6166 . . 137 2613 100.0000 . . . 0.1958 0.0000 0.1573 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.6166 41.5200 . . 142 2687 100.0000 . . . 0.2176 0.0000 0.1782 . . . . . . . . . . # _struct.entry_id 6S89 _struct.title 'Crystal Structure of EGFR-T790M/C797S in Complex with Covalent Pyrrolopyrimidine 19g' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6S89 _struct_keywords.text 'EGFR, T790M/C797S, covalent Pyrrolopyrimide, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EGFR_HUMAN _struct_ref.pdbx_db_accession P00533 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV CRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKIT DFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLP QPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDAD EYLIPQQG ; _struct_ref.pdbx_align_begin 695 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6S89 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 333 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00533 _struct_ref_seq.db_align_beg 695 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1022 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 695 _struct_ref_seq.pdbx_auth_seq_align_end 1022 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6S89 GLY A 1 ? UNP P00533 ? ? 'expression tag' 690 1 1 6S89 SER A 2 ? UNP P00533 ? ? 'expression tag' 691 2 1 6S89 HIS A 3 ? UNP P00533 ? ? 'expression tag' 692 3 1 6S89 MET A 4 ? UNP P00533 ? ? 'expression tag' 693 4 1 6S89 ALA A 5 ? UNP P00533 ? ? 'expression tag' 694 5 1 6S89 MET A 101 ? UNP P00533 THR 790 'engineered mutation' 790 6 1 6S89 SER A 108 ? UNP P00533 CYS 797 'engineered mutation' 797 7 1 6S89 ALA A 176 ? UNP P00533 GLU 865 'engineered mutation' 865 8 1 6S89 ALA A 177 ? UNP P00533 GLU 866 'engineered mutation' 866 9 1 6S89 ALA A 178 ? UNP P00533 LYS 867 'engineered mutation' 867 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 270 ? 1 MORE 1 ? 1 'SSA (A^2)' 14760 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 19 ? THR A 21 ? LYS A 708 THR A 710 5 ? 3 HELX_P HELX_P2 AA2 SER A 63 ? SER A 79 ? SER A 752 SER A 768 1 ? 17 HELX_P HELX_P3 AA3 SER A 108 ? HIS A 116 ? SER A 797 HIS A 805 1 ? 9 HELX_P HELX_P4 AA4 LYS A 117 ? ILE A 120 ? LYS A 806 ILE A 809 5 ? 4 HELX_P HELX_P5 AA5 GLY A 121 ? ARG A 142 ? GLY A 810 ARG A 831 1 ? 22 HELX_P HELX_P6 AA6 ALA A 150 ? ARG A 152 ? ALA A 839 ARG A 841 5 ? 3 HELX_P HELX_P7 AA7 ASP A 166 ? ALA A 170 ? ASP A 855 ALA A 859 5 ? 5 HELX_P HELX_P8 AA8 PRO A 188 ? MET A 192 ? PRO A 877 MET A 881 5 ? 5 HELX_P HELX_P9 AA9 ALA A 193 ? ARG A 200 ? ALA A 882 ARG A 889 1 ? 8 HELX_P HELX_P10 AB1 THR A 203 ? THR A 220 ? THR A 892 THR A 909 1 ? 18 HELX_P HELX_P11 AB2 PRO A 230 ? SER A 232 ? PRO A 919 SER A 921 5 ? 3 HELX_P HELX_P12 AB3 GLU A 233 ? LYS A 240 ? GLU A 922 LYS A 929 1 ? 8 HELX_P HELX_P13 AB4 THR A 251 ? TRP A 262 ? THR A 940 TRP A 951 1 ? 12 HELX_P HELX_P14 AB5 ASP A 265 ? ARG A 269 ? ASP A 954 ARG A 958 5 ? 5 HELX_P HELX_P15 AB6 LYS A 271 ? ARG A 284 ? LYS A 960 ARG A 973 1 ? 14 HELX_P HELX_P16 AB7 ASP A 285 ? TYR A 289 ? ASP A 974 TYR A 978 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 23 ? SER A 31 ? PHE A 712 SER A 720 AA1 2 GLY A 35 ? TRP A 42 ? GLY A 724 TRP A 731 AA1 3 ILE A 51 ? LEU A 58 ? ILE A 740 LEU A 747 AA1 4 VAL A 97 ? GLN A 102 ? VAL A 786 GLN A 791 AA1 5 LEU A 88 ? LEU A 93 ? LEU A 777 LEU A 782 AA2 1 LEU A 144 ? VAL A 145 ? LEU A 833 VAL A 834 AA2 2 LYS A 171 ? LEU A 172 ? LYS A 860 LEU A 861 AA3 1 VAL A 154 ? THR A 158 ? VAL A 843 THR A 847 AA3 2 HIS A 161 ? ILE A 164 ? HIS A 850 ILE A 853 AA4 1 TYR A 180 ? HIS A 181 ? TYR A 869 HIS A 870 AA4 2 ILE A 201 ? TYR A 202 ? ILE A 890 TYR A 891 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 30 ? N GLY A 719 O VAL A 37 ? O VAL A 726 AA1 2 3 N TYR A 38 ? N TYR A 727 O ILE A 55 ? O ILE A 744 AA1 3 4 N ALA A 54 ? N ALA A 743 O MET A 101 ? O MET A 790 AA1 4 5 O ILE A 100 ? O ILE A 789 N GLY A 90 ? N GLY A 779 AA2 1 2 N VAL A 145 ? N VAL A 834 O LYS A 171 ? O LYS A 860 AA3 1 2 N LEU A 155 ? N LEU A 844 O LYS A 163 ? O LYS A 852 AA4 1 2 N TYR A 180 ? N TYR A 869 O TYR A 202 ? O TYR A 891 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A L0Q 1101 ? 8 'binding site for residue L0Q A 1101' AC2 Software A MES 1102 ? 4 'binding site for residue MES A 1102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 LEU A 29 ? LEU A 718 . ? 1_555 ? 2 AC1 8 VAL A 37 ? VAL A 726 . ? 1_555 ? 3 AC1 8 ALA A 54 ? ALA A 743 . ? 1_555 ? 4 AC1 8 GLN A 102 ? GLN A 791 . ? 1_555 ? 5 AC1 8 MET A 104 ? MET A 793 . ? 1_555 ? 6 AC1 8 PRO A 105 ? PRO A 794 . ? 1_555 ? 7 AC1 8 GLY A 107 ? GLY A 796 . ? 1_555 ? 8 AC1 8 LEU A 155 ? LEU A 844 . ? 1_555 ? 9 AC2 4 PRO A 188 ? PRO A 877 . ? 1_555 ? 10 AC2 4 ILE A 189 ? ILE A 878 . ? 1_555 ? 11 AC2 4 LYS A 190 ? LYS A 879 . ? 1_555 ? 12 AC2 4 TRP A 191 ? TRP A 880 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 836 ? ? 66.27 -3.02 2 1 ASP A 837 ? ? -149.13 48.38 3 1 THR A 854 ? ? -157.33 -148.66 4 1 ASP A 855 ? ? 33.58 65.80 5 1 PHE A 856 ? ? -75.53 25.04 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -7.3400 _pdbx_refine_tls.origin_y 57.0172 _pdbx_refine_tls.origin_z -24.9653 _pdbx_refine_tls.T[1][1] 0.4816 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0320 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0212 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.4606 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0636 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.3523 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 3.0665 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.9771 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -1.6920 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.3216 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.2279 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.5271 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0882 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0878 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.2627 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.1107 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0341 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0630 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.2948 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.0116 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0010 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 697 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 1017 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '(chain A and resseq 697:1017)' # _pdbx_entry_details.entry_id 6S89 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 690 ? A GLY 1 2 1 Y 1 A SER 691 ? A SER 2 3 1 Y 1 A HIS 692 ? A HIS 3 4 1 Y 1 A MET 693 ? A MET 4 5 1 Y 1 A ALA 694 ? A ALA 5 6 1 Y 1 A SER 695 ? A SER 6 7 1 Y 1 A GLY 696 ? A GLY 7 8 1 Y 1 A ARG 986 ? A ARG 297 9 1 Y 1 A MET 987 ? A MET 298 10 1 Y 1 A HIS 988 ? A HIS 299 11 1 Y 1 A LEU 989 ? A LEU 300 12 1 Y 1 A PRO 990 ? A PRO 301 13 1 Y 1 A SER 991 ? A SER 302 14 1 Y 1 A PRO 992 ? A PRO 303 15 1 Y 1 A THR 993 ? A THR 304 16 1 Y 1 A ASP 994 ? A ASP 305 17 1 Y 1 A SER 995 ? A SER 306 18 1 Y 1 A ASN 996 ? A ASN 307 19 1 Y 1 A ILE 1018 ? A ILE 329 20 1 Y 1 A PRO 1019 ? A PRO 330 21 1 Y 1 A GLN 1020 ? A GLN 331 22 1 Y 1 A GLN 1021 ? A GLN 332 23 1 Y 1 A GLY 1022 ? A GLY 333 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 L0Q C4 C Y N 180 L0Q C5 C Y N 181 L0Q C6 C Y N 182 L0Q N1 N Y N 183 L0Q N3 N Y N 184 L0Q CBE C N N 185 L0Q CBG C N N 186 L0Q NBH N N N 187 L0Q CBJ C N N 188 L0Q CBI C N N 189 L0Q CBF C N N 190 L0Q NBD N N N 191 L0Q CAR C Y N 192 L0Q CAS C Y N 193 L0Q CAT C Y N 194 L0Q CAQ C Y N 195 L0Q CAP C Y N 196 L0Q CAJ C Y N 197 L0Q CAH C Y N 198 L0Q NAG N Y N 199 L0Q C2 C Y N 200 L0Q OAL O N N 201 L0Q CAM C N N 202 L0Q CAO C N N 203 L0Q CAN C N N 204 L0Q CAI C Y N 205 L0Q CAK C Y N 206 L0Q CAU C Y N 207 L0Q CAY C Y N 208 L0Q CAX C Y N 209 L0Q CAW C Y N 210 L0Q CAV C Y N 211 L0Q NAZ N N N 212 L0Q CBA C N N 213 L0Q OBK O N N 214 L0Q CBB C N N 215 L0Q CBC C N N 216 L0Q H1 H N N 217 L0Q H2 H N N 218 L0Q H3 H N N 219 L0Q H4 H N N 220 L0Q H6 H N N 221 L0Q H7 H N N 222 L0Q H8 H N N 223 L0Q H9 H N N 224 L0Q H10 H N N 225 L0Q H11 H N N 226 L0Q H12 H N N 227 L0Q H13 H N N 228 L0Q H14 H N N 229 L0Q H15 H N N 230 L0Q H16 H N N 231 L0Q H17 H N N 232 L0Q H18 H N N 233 L0Q H19 H N N 234 L0Q H20 H N N 235 L0Q H21 H N N 236 L0Q H22 H N N 237 L0Q H23 H N N 238 L0Q H24 H N N 239 L0Q H25 H N N 240 L0Q H26 H N N 241 L0Q H27 H N N 242 L0Q H28 H N N 243 L0Q H29 H N N 244 L0Q H30 H N N 245 L0Q H31 H N N 246 L0Q H32 H N N 247 L0Q H33 H N N 248 L0Q H34 H N N 249 L0Q H35 H N N 250 LEU N N N N 251 LEU CA C N S 252 LEU C C N N 253 LEU O O N N 254 LEU CB C N N 255 LEU CG C N N 256 LEU CD1 C N N 257 LEU CD2 C N N 258 LEU OXT O N N 259 LEU H H N N 260 LEU H2 H N N 261 LEU HA H N N 262 LEU HB2 H N N 263 LEU HB3 H N N 264 LEU HG H N N 265 LEU HD11 H N N 266 LEU HD12 H N N 267 LEU HD13 H N N 268 LEU HD21 H N N 269 LEU HD22 H N N 270 LEU HD23 H N N 271 LEU HXT H N N 272 LYS N N N N 273 LYS CA C N S 274 LYS C C N N 275 LYS O O N N 276 LYS CB C N N 277 LYS CG C N N 278 LYS CD C N N 279 LYS CE C N N 280 LYS NZ N N N 281 LYS OXT O N N 282 LYS H H N N 283 LYS H2 H N N 284 LYS HA H N N 285 LYS HB2 H N N 286 LYS HB3 H N N 287 LYS HG2 H N N 288 LYS HG3 H N N 289 LYS HD2 H N N 290 LYS HD3 H N N 291 LYS HE2 H N N 292 LYS HE3 H N N 293 LYS HZ1 H N N 294 LYS HZ2 H N N 295 LYS HZ3 H N N 296 LYS HXT H N N 297 MES O1 O N N 298 MES C2 C N N 299 MES C3 C N N 300 MES N4 N N N 301 MES C5 C N N 302 MES C6 C N N 303 MES C7 C N N 304 MES C8 C N N 305 MES S S N N 306 MES O1S O N N 307 MES O2S O N N 308 MES O3S O N N 309 MES H21 H N N 310 MES H22 H N N 311 MES H31 H N N 312 MES H32 H N N 313 MES HN4 H N N 314 MES H51 H N N 315 MES H52 H N N 316 MES H61 H N N 317 MES H62 H N N 318 MES H71 H N N 319 MES H72 H N N 320 MES H81 H N N 321 MES H82 H N N 322 MET N N N N 323 MET CA C N S 324 MET C C N N 325 MET O O N N 326 MET CB C N N 327 MET CG C N N 328 MET SD S N N 329 MET CE C N N 330 MET OXT O N N 331 MET H H N N 332 MET H2 H N N 333 MET HA H N N 334 MET HB2 H N N 335 MET HB3 H N N 336 MET HG2 H N N 337 MET HG3 H N N 338 MET HE1 H N N 339 MET HE2 H N N 340 MET HE3 H N N 341 MET HXT H N N 342 PHE N N N N 343 PHE CA C N S 344 PHE C C N N 345 PHE O O N N 346 PHE CB C N N 347 PHE CG C Y N 348 PHE CD1 C Y N 349 PHE CD2 C Y N 350 PHE CE1 C Y N 351 PHE CE2 C Y N 352 PHE CZ C Y N 353 PHE OXT O N N 354 PHE H H N N 355 PHE H2 H N N 356 PHE HA H N N 357 PHE HB2 H N N 358 PHE HB3 H N N 359 PHE HD1 H N N 360 PHE HD2 H N N 361 PHE HE1 H N N 362 PHE HE2 H N N 363 PHE HZ H N N 364 PHE HXT H N N 365 PRO N N N N 366 PRO CA C N S 367 PRO C C N N 368 PRO O O N N 369 PRO CB C N N 370 PRO CG C N N 371 PRO CD C N N 372 PRO OXT O N N 373 PRO H H N N 374 PRO HA H N N 375 PRO HB2 H N N 376 PRO HB3 H N N 377 PRO HG2 H N N 378 PRO HG3 H N N 379 PRO HD2 H N N 380 PRO HD3 H N N 381 PRO HXT H N N 382 SER N N N N 383 SER CA C N S 384 SER C C N N 385 SER O O N N 386 SER CB C N N 387 SER OG O N N 388 SER OXT O N N 389 SER H H N N 390 SER H2 H N N 391 SER HA H N N 392 SER HB2 H N N 393 SER HB3 H N N 394 SER HG H N N 395 SER HXT H N N 396 THR N N N N 397 THR CA C N S 398 THR C C N N 399 THR O O N N 400 THR CB C N R 401 THR OG1 O N N 402 THR CG2 C N N 403 THR OXT O N N 404 THR H H N N 405 THR H2 H N N 406 THR HA H N N 407 THR HB H N N 408 THR HG1 H N N 409 THR HG21 H N N 410 THR HG22 H N N 411 THR HG23 H N N 412 THR HXT H N N 413 TRP N N N N 414 TRP CA C N S 415 TRP C C N N 416 TRP O O N N 417 TRP CB C N N 418 TRP CG C Y N 419 TRP CD1 C Y N 420 TRP CD2 C Y N 421 TRP NE1 N Y N 422 TRP CE2 C Y N 423 TRP CE3 C Y N 424 TRP CZ2 C Y N 425 TRP CZ3 C Y N 426 TRP CH2 C Y N 427 TRP OXT O N N 428 TRP H H N N 429 TRP H2 H N N 430 TRP HA H N N 431 TRP HB2 H N N 432 TRP HB3 H N N 433 TRP HD1 H N N 434 TRP HE1 H N N 435 TRP HE3 H N N 436 TRP HZ2 H N N 437 TRP HZ3 H N N 438 TRP HH2 H N N 439 TRP HXT H N N 440 TYR N N N N 441 TYR CA C N S 442 TYR C C N N 443 TYR O O N N 444 TYR CB C N N 445 TYR CG C Y N 446 TYR CD1 C Y N 447 TYR CD2 C Y N 448 TYR CE1 C Y N 449 TYR CE2 C Y N 450 TYR CZ C Y N 451 TYR OH O N N 452 TYR OXT O N N 453 TYR H H N N 454 TYR H2 H N N 455 TYR HA H N N 456 TYR HB2 H N N 457 TYR HB3 H N N 458 TYR HD1 H N N 459 TYR HD2 H N N 460 TYR HE1 H N N 461 TYR HE2 H N N 462 TYR HH H N N 463 TYR HXT H N N 464 VAL N N N N 465 VAL CA C N S 466 VAL C C N N 467 VAL O O N N 468 VAL CB C N N 469 VAL CG1 C N N 470 VAL CG2 C N N 471 VAL OXT O N N 472 VAL H H N N 473 VAL H2 H N N 474 VAL HA H N N 475 VAL HB H N N 476 VAL HG11 H N N 477 VAL HG12 H N N 478 VAL HG13 H N N 479 VAL HG21 H N N 480 VAL HG22 H N N 481 VAL HG23 H N N 482 VAL HXT H N N 483 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 L0Q CAN CAM sing N N 171 L0Q CAO CAM sing N N 172 L0Q CAM OAL sing N N 173 L0Q CBB CBC sing N N 174 L0Q CBB CBA sing N N 175 L0Q N1 C2 doub Y N 176 L0Q N1 C6 sing Y N 177 L0Q OAL C6 sing N N 178 L0Q OBK CBA doub N N 179 L0Q CBA NAZ sing N N 180 L0Q C2 N3 sing Y N 181 L0Q C6 C5 doub Y N 182 L0Q NAZ CAV sing N N 183 L0Q CAV CAU doub Y N 184 L0Q CAV CAW sing Y N 185 L0Q N3 C4 doub Y N 186 L0Q CAU CAK sing Y N 187 L0Q C5 C4 sing Y N 188 L0Q C5 CAI sing Y N 189 L0Q CAW CAX doub Y N 190 L0Q C4 NAG sing Y N 191 L0Q CAK CAI sing N N 192 L0Q CAK CAY doub Y N 193 L0Q CAI CAH doub Y N 194 L0Q CAX CAY sing Y N 195 L0Q NAG CAH sing Y N 196 L0Q CAH CAJ sing N N 197 L0Q CAJ CAP doub Y N 198 L0Q CAJ CAT sing Y N 199 L0Q CAP CAQ sing Y N 200 L0Q CAT CAS doub Y N 201 L0Q CAQ CAR doub Y N 202 L0Q CAS CAR sing Y N 203 L0Q CAR NBD sing N N 204 L0Q NBD CBE sing N N 205 L0Q NBD CBF sing N N 206 L0Q CBE CBG sing N N 207 L0Q CBF CBI sing N N 208 L0Q CBG NBH sing N N 209 L0Q CBI NBH sing N N 210 L0Q NBH CBJ sing N N 211 L0Q CBE H1 sing N N 212 L0Q CBE H2 sing N N 213 L0Q CBG H3 sing N N 214 L0Q CBG H4 sing N N 215 L0Q CBJ H6 sing N N 216 L0Q CBJ H7 sing N N 217 L0Q CBJ H8 sing N N 218 L0Q CBI H9 sing N N 219 L0Q CBI H10 sing N N 220 L0Q CBF H11 sing N N 221 L0Q CBF H12 sing N N 222 L0Q CAS H13 sing N N 223 L0Q CAT H14 sing N N 224 L0Q CAQ H15 sing N N 225 L0Q CAP H16 sing N N 226 L0Q NAG H17 sing N N 227 L0Q C2 H18 sing N N 228 L0Q CAM H19 sing N N 229 L0Q CAO H20 sing N N 230 L0Q CAO H21 sing N N 231 L0Q CAO H22 sing N N 232 L0Q CAN H23 sing N N 233 L0Q CAN H24 sing N N 234 L0Q CAN H25 sing N N 235 L0Q CAU H26 sing N N 236 L0Q CAY H27 sing N N 237 L0Q CAX H28 sing N N 238 L0Q CAW H29 sing N N 239 L0Q NAZ H30 sing N N 240 L0Q CBB H31 sing N N 241 L0Q CBB H32 sing N N 242 L0Q CBC H33 sing N N 243 L0Q CBC H34 sing N N 244 L0Q CBC H35 sing N N 245 LEU N CA sing N N 246 LEU N H sing N N 247 LEU N H2 sing N N 248 LEU CA C sing N N 249 LEU CA CB sing N N 250 LEU CA HA sing N N 251 LEU C O doub N N 252 LEU C OXT sing N N 253 LEU CB CG sing N N 254 LEU CB HB2 sing N N 255 LEU CB HB3 sing N N 256 LEU CG CD1 sing N N 257 LEU CG CD2 sing N N 258 LEU CG HG sing N N 259 LEU CD1 HD11 sing N N 260 LEU CD1 HD12 sing N N 261 LEU CD1 HD13 sing N N 262 LEU CD2 HD21 sing N N 263 LEU CD2 HD22 sing N N 264 LEU CD2 HD23 sing N N 265 LEU OXT HXT sing N N 266 LYS N CA sing N N 267 LYS N H sing N N 268 LYS N H2 sing N N 269 LYS CA C sing N N 270 LYS CA CB sing N N 271 LYS CA HA sing N N 272 LYS C O doub N N 273 LYS C OXT sing N N 274 LYS CB CG sing N N 275 LYS CB HB2 sing N N 276 LYS CB HB3 sing N N 277 LYS CG CD sing N N 278 LYS CG HG2 sing N N 279 LYS CG HG3 sing N N 280 LYS CD CE sing N N 281 LYS CD HD2 sing N N 282 LYS CD HD3 sing N N 283 LYS CE NZ sing N N 284 LYS CE HE2 sing N N 285 LYS CE HE3 sing N N 286 LYS NZ HZ1 sing N N 287 LYS NZ HZ2 sing N N 288 LYS NZ HZ3 sing N N 289 LYS OXT HXT sing N N 290 MES O1 C2 sing N N 291 MES O1 C6 sing N N 292 MES C2 C3 sing N N 293 MES C2 H21 sing N N 294 MES C2 H22 sing N N 295 MES C3 N4 sing N N 296 MES C3 H31 sing N N 297 MES C3 H32 sing N N 298 MES N4 C5 sing N N 299 MES N4 C7 sing N N 300 MES N4 HN4 sing N N 301 MES C5 C6 sing N N 302 MES C5 H51 sing N N 303 MES C5 H52 sing N N 304 MES C6 H61 sing N N 305 MES C6 H62 sing N N 306 MES C7 C8 sing N N 307 MES C7 H71 sing N N 308 MES C7 H72 sing N N 309 MES C8 S sing N N 310 MES C8 H81 sing N N 311 MES C8 H82 sing N N 312 MES S O1S doub N N 313 MES S O2S doub N N 314 MES S O3S sing N N 315 MET N CA sing N N 316 MET N H sing N N 317 MET N H2 sing N N 318 MET CA C sing N N 319 MET CA CB sing N N 320 MET CA HA sing N N 321 MET C O doub N N 322 MET C OXT sing N N 323 MET CB CG sing N N 324 MET CB HB2 sing N N 325 MET CB HB3 sing N N 326 MET CG SD sing N N 327 MET CG HG2 sing N N 328 MET CG HG3 sing N N 329 MET SD CE sing N N 330 MET CE HE1 sing N N 331 MET CE HE2 sing N N 332 MET CE HE3 sing N N 333 MET OXT HXT sing N N 334 PHE N CA sing N N 335 PHE N H sing N N 336 PHE N H2 sing N N 337 PHE CA C sing N N 338 PHE CA CB sing N N 339 PHE CA HA sing N N 340 PHE C O doub N N 341 PHE C OXT sing N N 342 PHE CB CG sing N N 343 PHE CB HB2 sing N N 344 PHE CB HB3 sing N N 345 PHE CG CD1 doub Y N 346 PHE CG CD2 sing Y N 347 PHE CD1 CE1 sing Y N 348 PHE CD1 HD1 sing N N 349 PHE CD2 CE2 doub Y N 350 PHE CD2 HD2 sing N N 351 PHE CE1 CZ doub Y N 352 PHE CE1 HE1 sing N N 353 PHE CE2 CZ sing Y N 354 PHE CE2 HE2 sing N N 355 PHE CZ HZ sing N N 356 PHE OXT HXT sing N N 357 PRO N CA sing N N 358 PRO N CD sing N N 359 PRO N H sing N N 360 PRO CA C sing N N 361 PRO CA CB sing N N 362 PRO CA HA sing N N 363 PRO C O doub N N 364 PRO C OXT sing N N 365 PRO CB CG sing N N 366 PRO CB HB2 sing N N 367 PRO CB HB3 sing N N 368 PRO CG CD sing N N 369 PRO CG HG2 sing N N 370 PRO CG HG3 sing N N 371 PRO CD HD2 sing N N 372 PRO CD HD3 sing N N 373 PRO OXT HXT sing N N 374 SER N CA sing N N 375 SER N H sing N N 376 SER N H2 sing N N 377 SER CA C sing N N 378 SER CA CB sing N N 379 SER CA HA sing N N 380 SER C O doub N N 381 SER C OXT sing N N 382 SER CB OG sing N N 383 SER CB HB2 sing N N 384 SER CB HB3 sing N N 385 SER OG HG sing N N 386 SER OXT HXT sing N N 387 THR N CA sing N N 388 THR N H sing N N 389 THR N H2 sing N N 390 THR CA C sing N N 391 THR CA CB sing N N 392 THR CA HA sing N N 393 THR C O doub N N 394 THR C OXT sing N N 395 THR CB OG1 sing N N 396 THR CB CG2 sing N N 397 THR CB HB sing N N 398 THR OG1 HG1 sing N N 399 THR CG2 HG21 sing N N 400 THR CG2 HG22 sing N N 401 THR CG2 HG23 sing N N 402 THR OXT HXT sing N N 403 TRP N CA sing N N 404 TRP N H sing N N 405 TRP N H2 sing N N 406 TRP CA C sing N N 407 TRP CA CB sing N N 408 TRP CA HA sing N N 409 TRP C O doub N N 410 TRP C OXT sing N N 411 TRP CB CG sing N N 412 TRP CB HB2 sing N N 413 TRP CB HB3 sing N N 414 TRP CG CD1 doub Y N 415 TRP CG CD2 sing Y N 416 TRP CD1 NE1 sing Y N 417 TRP CD1 HD1 sing N N 418 TRP CD2 CE2 doub Y N 419 TRP CD2 CE3 sing Y N 420 TRP NE1 CE2 sing Y N 421 TRP NE1 HE1 sing N N 422 TRP CE2 CZ2 sing Y N 423 TRP CE3 CZ3 doub Y N 424 TRP CE3 HE3 sing N N 425 TRP CZ2 CH2 doub Y N 426 TRP CZ2 HZ2 sing N N 427 TRP CZ3 CH2 sing Y N 428 TRP CZ3 HZ3 sing N N 429 TRP CH2 HH2 sing N N 430 TRP OXT HXT sing N N 431 TYR N CA sing N N 432 TYR N H sing N N 433 TYR N H2 sing N N 434 TYR CA C sing N N 435 TYR CA CB sing N N 436 TYR CA HA sing N N 437 TYR C O doub N N 438 TYR C OXT sing N N 439 TYR CB CG sing N N 440 TYR CB HB2 sing N N 441 TYR CB HB3 sing N N 442 TYR CG CD1 doub Y N 443 TYR CG CD2 sing Y N 444 TYR CD1 CE1 sing Y N 445 TYR CD1 HD1 sing N N 446 TYR CD2 CE2 doub Y N 447 TYR CD2 HD2 sing N N 448 TYR CE1 CZ doub Y N 449 TYR CE1 HE1 sing N N 450 TYR CE2 CZ sing Y N 451 TYR CE2 HE2 sing N N 452 TYR CZ OH sing N N 453 TYR OH HH sing N N 454 TYR OXT HXT sing N N 455 VAL N CA sing N N 456 VAL N H sing N N 457 VAL N H2 sing N N 458 VAL CA C sing N N 459 VAL CA CB sing N N 460 VAL CA HA sing N N 461 VAL C O doub N N 462 VAL C OXT sing N N 463 VAL CB CG1 sing N N 464 VAL CB CG2 sing N N 465 VAL CB HB sing N N 466 VAL CG1 HG11 sing N N 467 VAL CG1 HG12 sing N N 468 VAL CG1 HG13 sing N N 469 VAL CG2 HG21 sing N N 470 VAL CG2 HG22 sing N N 471 VAL CG2 HG23 sing N N 472 VAL OXT HXT sing N N 473 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'German Federal Ministry for Education and Research' Germany 'BMBF 01GS08104' 1 'German Federal Ministry for Education and Research' Germany 'BMBF 01ZX1303C' 2 'European Regional Development Fund' Germany EFRE-800400 3 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id L0Q _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id L0Q _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5J9Z _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6S89 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.006953 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006953 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006953 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_