data_6SAF # _entry.id 6SAF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6SAF pdb_00006saf 10.2210/pdb6saf/pdb WWPDB D_1292103361 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-12-18 2 'Structure model' 1 1 2020-01-22 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation.year' 6 2 'Structure model' '_citation_author.name' 7 3 'Structure model' '_database_2.pdbx_DOI' 8 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6SAF _pdbx_database_status.recvd_initial_deposition_date 2019-07-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Feng, X.' 1 ? 'Sippel, C.' 2 ? 'Knaup, F.' 3 ? 'Bracher, A.' 4 ? 'Staibano, S.' 5 ? 'Romano, M.F.' 6 ? 'Hausch, F.' 7 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary J.Med.Chem. JMCMAR 0151 0022-2623 ? ? 63 ? 231 240 'A Novel Decalin-Based Bicyclic Scaffold for FKBP51-Selective Ligands.' 2020 ? 10.1021/acs.jmedchem.9b01157 31800244 ? ? ? ? ? ? ? ? ? ? ? 1 'Acta Cryst. Sect. D' ? ? ? ? ? 67 ? 549 559 'Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90' 2011 ? 10.1107/S0907444911013862 21636895 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Feng, X.' 1 ? primary 'Sippel, C.' 2 ? primary 'Knaup, F.H.' 3 ? primary 'Bracher, A.' 4 ? primary 'Staibano, S.' 5 ? primary 'Romano, M.F.' 6 ? primary 'Hausch, F.' 7 ? 1 'Bracher, A.' 8 0000-0001-8530-7594 1 'Kozany, C.' 9 ? 1 'Thost, A.K.' 10 ? 1 'Hausch, F.' 11 0000-0002-3710-8838 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidyl-prolyl cis-trans isomerase FKBP5' 14026.077 1 5.2.1.8 'additional N-terminal sequence GAP, cloning artefact, mutation A19T' 'Fk1 domain' ? 2 non-polymer syn ;[(1~{R})-3-(3,4-dimethoxyphenyl)-1-[3-(2-morpholin-4-ylethoxy)phenyl]propyl] (2~{S})-1-[[(1~{R},4~{a}~{R},8~{a}~{R})-4-oxidanylidene-2,3,4~{a},5,6,7,8,8~{a}-octahydro-1~{H}-naphthalen-1-yl]carbonyl]piperidine-2-carboxylate ; 690.865 1 ? ? ? ? 3 water nat water 18.015 67 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;PPIase FKBP5,51 kDa FK506-binding protein,FKBP-51,54 kDa progesterone receptor-associated immunophilin,Androgen-regulated protein 6,FF1 antigen,FK506-binding protein 5,FKBP-5,FKBP54,p54,HSP90-binding immunophilin,Rotamase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDI GVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE ; _entity_poly.pdbx_seq_one_letter_code_can ;GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDI GVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;[(1~{R})-3-(3,4-dimethoxyphenyl)-1-[3-(2-morpholin-4-ylethoxy)phenyl]propyl] (2~{S})-1-[[(1~{R},4~{a}~{R},8~{a}~{R})-4-oxidanylidene-2,3,4~{a},5,6,7,8,8~{a}-octahydro-1~{H}-naphthalen-1-yl]carbonyl]piperidine-2-carboxylate ; L2Q 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 PRO n 1 4 ALA n 1 5 THR n 1 6 VAL n 1 7 THR n 1 8 GLU n 1 9 GLN n 1 10 GLY n 1 11 GLU n 1 12 ASP n 1 13 ILE n 1 14 THR n 1 15 SER n 1 16 LYS n 1 17 LYS n 1 18 ASP n 1 19 ARG n 1 20 GLY n 1 21 VAL n 1 22 LEU n 1 23 LYS n 1 24 ILE n 1 25 VAL n 1 26 LYS n 1 27 ARG n 1 28 VAL n 1 29 GLY n 1 30 ASN n 1 31 GLY n 1 32 GLU n 1 33 GLU n 1 34 THR n 1 35 PRO n 1 36 MET n 1 37 ILE n 1 38 GLY n 1 39 ASP n 1 40 LYS n 1 41 VAL n 1 42 TYR n 1 43 VAL n 1 44 HIS n 1 45 TYR n 1 46 LYS n 1 47 GLY n 1 48 LYS n 1 49 LEU n 1 50 SER n 1 51 ASN n 1 52 GLY n 1 53 LYS n 1 54 LYS n 1 55 PHE n 1 56 ASP n 1 57 SER n 1 58 SER n 1 59 HIS n 1 60 ASP n 1 61 ARG n 1 62 ASN n 1 63 GLU n 1 64 PRO n 1 65 PHE n 1 66 VAL n 1 67 PHE n 1 68 SER n 1 69 LEU n 1 70 GLY n 1 71 LYS n 1 72 GLY n 1 73 GLN n 1 74 VAL n 1 75 ILE n 1 76 LYS n 1 77 ALA n 1 78 TRP n 1 79 ASP n 1 80 ILE n 1 81 GLY n 1 82 VAL n 1 83 ALA n 1 84 THR n 1 85 MET n 1 86 LYS n 1 87 LYS n 1 88 GLY n 1 89 GLU n 1 90 ILE n 1 91 CYS n 1 92 HIS n 1 93 LEU n 1 94 LEU n 1 95 CYS n 1 96 LYS n 1 97 PRO n 1 98 GLU n 1 99 TYR n 1 100 ALA n 1 101 TYR n 1 102 GLY n 1 103 SER n 1 104 ALA n 1 105 GLY n 1 106 SER n 1 107 LEU n 1 108 PRO n 1 109 LYS n 1 110 ILE n 1 111 PRO n 1 112 SER n 1 113 ASN n 1 114 ALA n 1 115 THR n 1 116 LEU n 1 117 PHE n 1 118 PHE n 1 119 GLU n 1 120 ILE n 1 121 GLU n 1 122 LEU n 1 123 LEU n 1 124 ASP n 1 125 PHE n 1 126 LYS n 1 127 GLY n 1 128 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 128 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FKBP5, AIG6, FKBP51' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant 'codon+ RIL' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pProEx-HtB _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 L2Q non-polymer . ;[(1~{R})-3-(3,4-dimethoxyphenyl)-1-[3-(2-morpholin-4-ylethoxy)phenyl]propyl] (2~{S})-1-[[(1~{R},4~{a}~{R},8~{a}~{R})-4-oxidanylidene-2,3,4~{a},5,6,7,8,8~{a}-octahydro-1~{H}-naphthalen-1-yl]carbonyl]piperidine-2-carboxylate ; ? 'C40 H54 N2 O8' 690.865 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 13 13 GLY GLY A . n A 1 2 ALA 2 14 14 ALA ALA A . n A 1 3 PRO 3 15 15 PRO PRO A . n A 1 4 ALA 4 16 16 ALA ALA A . n A 1 5 THR 5 17 17 THR THR A . n A 1 6 VAL 6 18 18 VAL VAL A . n A 1 7 THR 7 19 19 THR THR A . n A 1 8 GLU 8 20 20 GLU GLU A . n A 1 9 GLN 9 21 21 GLN GLN A . n A 1 10 GLY 10 22 22 GLY GLY A . n A 1 11 GLU 11 23 23 GLU GLU A . n A 1 12 ASP 12 24 24 ASP ASP A . n A 1 13 ILE 13 25 25 ILE ILE A . n A 1 14 THR 14 26 26 THR THR A . n A 1 15 SER 15 27 27 SER SER A . n A 1 16 LYS 16 28 28 LYS LYS A . n A 1 17 LYS 17 29 29 LYS LYS A . n A 1 18 ASP 18 30 30 ASP ASP A . n A 1 19 ARG 19 31 31 ARG ARG A . n A 1 20 GLY 20 32 32 GLY GLY A . n A 1 21 VAL 21 33 33 VAL VAL A . n A 1 22 LEU 22 34 34 LEU LEU A . n A 1 23 LYS 23 35 35 LYS LYS A . n A 1 24 ILE 24 36 36 ILE ILE A . n A 1 25 VAL 25 37 37 VAL VAL A . n A 1 26 LYS 26 38 38 LYS LYS A . n A 1 27 ARG 27 39 39 ARG ARG A . n A 1 28 VAL 28 40 40 VAL VAL A . n A 1 29 GLY 29 41 41 GLY GLY A . n A 1 30 ASN 30 42 42 ASN ASN A . n A 1 31 GLY 31 43 43 GLY GLY A . n A 1 32 GLU 32 44 44 GLU GLU A . n A 1 33 GLU 33 45 45 GLU GLU A . n A 1 34 THR 34 46 46 THR THR A . n A 1 35 PRO 35 47 47 PRO PRO A . n A 1 36 MET 36 48 48 MET MET A . n A 1 37 ILE 37 49 49 ILE ILE A . n A 1 38 GLY 38 50 50 GLY GLY A . n A 1 39 ASP 39 51 51 ASP ASP A . n A 1 40 LYS 40 52 52 LYS LYS A . n A 1 41 VAL 41 53 53 VAL VAL A . n A 1 42 TYR 42 54 54 TYR TYR A . n A 1 43 VAL 43 55 55 VAL VAL A . n A 1 44 HIS 44 56 56 HIS HIS A . n A 1 45 TYR 45 57 57 TYR TYR A . n A 1 46 LYS 46 58 58 LYS LYS A . n A 1 47 GLY 47 59 59 GLY GLY A . n A 1 48 LYS 48 60 60 LYS LYS A . n A 1 49 LEU 49 61 61 LEU LEU A . n A 1 50 SER 50 62 62 SER SER A . n A 1 51 ASN 51 63 63 ASN ASN A . n A 1 52 GLY 52 64 64 GLY GLY A . n A 1 53 LYS 53 65 65 LYS LYS A . n A 1 54 LYS 54 66 66 LYS LYS A . n A 1 55 PHE 55 67 67 PHE PHE A . n A 1 56 ASP 56 68 68 ASP ASP A . n A 1 57 SER 57 69 69 SER SER A . n A 1 58 SER 58 70 70 SER SER A . n A 1 59 HIS 59 71 71 HIS HIS A . n A 1 60 ASP 60 72 72 ASP ASP A . n A 1 61 ARG 61 73 73 ARG ARG A . n A 1 62 ASN 62 74 74 ASN ASN A . n A 1 63 GLU 63 75 75 GLU GLU A . n A 1 64 PRO 64 76 76 PRO PRO A . n A 1 65 PHE 65 77 77 PHE PHE A . n A 1 66 VAL 66 78 78 VAL VAL A . n A 1 67 PHE 67 79 79 PHE PHE A . n A 1 68 SER 68 80 80 SER SER A . n A 1 69 LEU 69 81 81 LEU LEU A . n A 1 70 GLY 70 82 82 GLY GLY A . n A 1 71 LYS 71 83 83 LYS LYS A . n A 1 72 GLY 72 84 84 GLY GLY A . n A 1 73 GLN 73 85 85 GLN GLN A . n A 1 74 VAL 74 86 86 VAL VAL A . n A 1 75 ILE 75 87 87 ILE ILE A . n A 1 76 LYS 76 88 88 LYS LYS A . n A 1 77 ALA 77 89 89 ALA ALA A . n A 1 78 TRP 78 90 90 TRP TRP A . n A 1 79 ASP 79 91 91 ASP ASP A . n A 1 80 ILE 80 92 92 ILE ILE A . n A 1 81 GLY 81 93 93 GLY GLY A . n A 1 82 VAL 82 94 94 VAL VAL A . n A 1 83 ALA 83 95 95 ALA ALA A . n A 1 84 THR 84 96 96 THR THR A . n A 1 85 MET 85 97 97 MET MET A . n A 1 86 LYS 86 98 98 LYS LYS A . n A 1 87 LYS 87 99 99 LYS LYS A . n A 1 88 GLY 88 100 100 GLY GLY A . n A 1 89 GLU 89 101 101 GLU GLU A . n A 1 90 ILE 90 102 102 ILE ILE A . n A 1 91 CYS 91 103 103 CYS CYS A . n A 1 92 HIS 92 104 104 HIS HIS A . n A 1 93 LEU 93 105 105 LEU LEU A . n A 1 94 LEU 94 106 106 LEU LEU A . n A 1 95 CYS 95 107 107 CYS CYS A . n A 1 96 LYS 96 108 108 LYS LYS A . n A 1 97 PRO 97 109 109 PRO PRO A . n A 1 98 GLU 98 110 110 GLU GLU A . n A 1 99 TYR 99 111 111 TYR TYR A . n A 1 100 ALA 100 112 112 ALA ALA A . n A 1 101 TYR 101 113 113 TYR TYR A . n A 1 102 GLY 102 114 114 GLY GLY A . n A 1 103 SER 103 115 115 SER SER A . n A 1 104 ALA 104 116 116 ALA ALA A . n A 1 105 GLY 105 117 117 GLY GLY A . n A 1 106 SER 106 118 118 SER SER A . n A 1 107 LEU 107 119 119 LEU LEU A . n A 1 108 PRO 108 120 120 PRO PRO A . n A 1 109 LYS 109 121 121 LYS LYS A . n A 1 110 ILE 110 122 122 ILE ILE A . n A 1 111 PRO 111 123 123 PRO PRO A . n A 1 112 SER 112 124 124 SER SER A . n A 1 113 ASN 113 125 125 ASN ASN A . n A 1 114 ALA 114 126 126 ALA ALA A . n A 1 115 THR 115 127 127 THR THR A . n A 1 116 LEU 116 128 128 LEU LEU A . n A 1 117 PHE 117 129 129 PHE PHE A . n A 1 118 PHE 118 130 130 PHE PHE A . n A 1 119 GLU 119 131 131 GLU GLU A . n A 1 120 ILE 120 132 132 ILE ILE A . n A 1 121 GLU 121 133 133 GLU GLU A . n A 1 122 LEU 122 134 134 LEU LEU A . n A 1 123 LEU 123 135 135 LEU LEU A . n A 1 124 ASP 124 136 136 ASP ASP A . n A 1 125 PHE 125 137 137 PHE PHE A . n A 1 126 LYS 126 138 138 LYS LYS A . n A 1 127 GLY 127 139 139 GLY GLY A . n A 1 128 GLU 128 140 140 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 L2Q 1 201 1 L2Q DRG A . C 3 HOH 1 301 24 HOH HOH A . C 3 HOH 2 302 60 HOH HOH A . C 3 HOH 3 303 45 HOH HOH A . C 3 HOH 4 304 15 HOH HOH A . C 3 HOH 5 305 7 HOH HOH A . C 3 HOH 6 306 13 HOH HOH A . C 3 HOH 7 307 1 HOH HOH A . C 3 HOH 8 308 5 HOH HOH A . C 3 HOH 9 309 29 HOH HOH A . C 3 HOH 10 310 33 HOH HOH A . C 3 HOH 11 311 19 HOH HOH A . C 3 HOH 12 312 66 HOH HOH A . C 3 HOH 13 313 10 HOH HOH A . C 3 HOH 14 314 78 HOH HOH A . C 3 HOH 15 315 73 HOH HOH A . C 3 HOH 16 316 61 HOH HOH A . C 3 HOH 17 317 9 HOH HOH A . C 3 HOH 18 318 17 HOH HOH A . C 3 HOH 19 319 50 HOH HOH A . C 3 HOH 20 320 12 HOH HOH A . C 3 HOH 21 321 8 HOH HOH A . C 3 HOH 22 322 30 HOH HOH A . C 3 HOH 23 323 76 HOH HOH A . C 3 HOH 24 324 21 HOH HOH A . C 3 HOH 25 325 69 HOH HOH A . C 3 HOH 26 326 54 HOH HOH A . C 3 HOH 27 327 23 HOH HOH A . C 3 HOH 28 328 2 HOH HOH A . C 3 HOH 29 329 72 HOH HOH A . C 3 HOH 30 330 41 HOH HOH A . C 3 HOH 31 331 6 HOH HOH A . C 3 HOH 32 332 37 HOH HOH A . C 3 HOH 33 333 18 HOH HOH A . C 3 HOH 34 334 4 HOH HOH A . C 3 HOH 35 335 27 HOH HOH A . C 3 HOH 36 336 14 HOH HOH A . C 3 HOH 37 337 34 HOH HOH A . C 3 HOH 38 338 39 HOH HOH A . C 3 HOH 39 339 42 HOH HOH A . C 3 HOH 40 340 53 HOH HOH A . C 3 HOH 41 341 11 HOH HOH A . C 3 HOH 42 342 25 HOH HOH A . C 3 HOH 43 343 67 HOH HOH A . C 3 HOH 44 344 62 HOH HOH A . C 3 HOH 45 345 55 HOH HOH A . C 3 HOH 46 346 59 HOH HOH A . C 3 HOH 47 347 44 HOH HOH A . C 3 HOH 48 348 3 HOH HOH A . C 3 HOH 49 349 36 HOH HOH A . C 3 HOH 50 350 31 HOH HOH A . C 3 HOH 51 351 48 HOH HOH A . C 3 HOH 52 352 35 HOH HOH A . C 3 HOH 53 353 46 HOH HOH A . C 3 HOH 54 354 71 HOH HOH A . C 3 HOH 55 355 58 HOH HOH A . C 3 HOH 56 356 56 HOH HOH A . C 3 HOH 57 357 52 HOH HOH A . C 3 HOH 58 358 51 HOH HOH A . C 3 HOH 59 359 75 HOH HOH A . C 3 HOH 60 360 43 HOH HOH A . C 3 HOH 61 361 47 HOH HOH A . C 3 HOH 62 362 49 HOH HOH A . C 3 HOH 63 363 40 HOH HOH A . C 3 HOH 64 364 20 HOH HOH A . C 3 HOH 65 365 70 HOH HOH A . C 3 HOH 66 366 16 HOH HOH A . C 3 HOH 67 367 77 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 63 ? CG ? A ASN 51 CG 2 1 Y 1 A ASN 63 ? OD1 ? A ASN 51 OD1 3 1 Y 1 A ASN 63 ? ND2 ? A ASN 51 ND2 4 1 Y 1 A LYS 65 ? CG ? A LYS 53 CG 5 1 Y 1 A LYS 65 ? CD ? A LYS 53 CD 6 1 Y 1 A LYS 65 ? CE ? A LYS 53 CE 7 1 Y 1 A LYS 65 ? NZ ? A LYS 53 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'VERSION January 10, 2014' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.20 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? 11.0.05 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0155 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6SAF _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.555 _cell.length_a_esd ? _cell.length_b 50.334 _cell.length_b_esd ? _cell.length_c 62.776 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6SAF _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6SAF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.40 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.68 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.110 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '28 % PEG-3350, 0.2 M NH4-acetate and 0.1 M HEPES-NaOH pH 7.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-02-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97857 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97857 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 34.0 _reflns.entry_id 6SAF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.050 _reflns.d_resolution_low 39.270 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 8890 _reflns.number_obs 8890 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.300 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.065 _reflns.pdbx_netI_over_av_sigmaI 7.700 _reflns.pdbx_netI_over_sigmaI 13.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.072 _reflns.pdbx_Rpim_I_all 0.031 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 47289 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.050 2.160 ? 1.300 6794 ? ? ? 1253 99.600 ? ? ? ? 0.597 ? ? ? ? ? ? ? ? 5.400 0.597 ? ? 2.500 0.660 0.278 ? 1 1 ? ? 2.160 2.290 ? 1.800 6156 ? ? ? 1212 99.600 ? ? ? ? 0.422 ? ? ? ? ? ? ? ? 5.100 0.422 ? ? 3.400 0.470 0.204 ? 2 1 ? ? 2.290 2.450 ? 2.700 6336 ? ? ? 1126 99.600 ? ? ? ? 0.282 ? ? ? ? ? ? ? ? 5.600 0.282 ? ? 5.200 0.311 0.129 ? 3 1 ? ? 2.450 2.650 ? 4.100 5867 ? ? ? 1058 99.800 ? ? ? ? 0.181 ? ? ? ? ? ? ? ? 5.500 0.181 ? ? 7.600 0.200 0.084 ? 4 1 ? ? 2.650 2.900 ? 6.000 5174 ? ? ? 976 99.600 ? ? ? ? 0.119 ? ? ? ? ? ? ? ? 5.300 0.119 ? ? 10.900 0.133 0.057 ? 5 1 ? ? 2.900 3.240 ? 9.200 4876 ? ? ? 898 99.900 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 5.400 0.076 ? ? 16.600 0.084 0.035 ? 6 1 ? ? 3.240 3.740 ? 12.700 4281 ? ? ? 791 100.000 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 5.400 0.050 ? ? 25.200 0.056 0.023 ? 7 1 ? ? 3.740 4.580 ? 15.800 3447 ? ? ? 697 99.800 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 4.900 0.037 ? ? 31.500 0.041 0.018 ? 8 1 ? ? 4.580 6.480 ? 15.900 2897 ? ? ? 548 100.000 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 5.300 0.035 ? ? 33.900 0.039 0.017 ? 9 1 ? ? 6.480 50.334 ? 12.000 1461 ? ? ? 331 98.800 ? ? ? ? 0.036 ? ? ? ? ? ? ? ? 4.400 0.036 ? ? 34.100 0.041 0.019 ? 10 1 ? ? # _refine.aniso_B[1][1] 3.9600 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -2.6800 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -1.2700 _refine.B_iso_max 98.460 _refine.B_iso_mean 48.1310 _refine.B_iso_min 24.740 _refine.correlation_coeff_Fo_to_Fc 0.9670 _refine.correlation_coeff_Fo_to_Fc_free 0.9260 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : WITH TLS ADDED' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6SAF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0500 _refine.ls_d_res_low 30.0000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8428 _refine.ls_number_reflns_R_free 423 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5200 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1940 _refine.ls_R_factor_R_free 0.2731 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1903 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'pdbid 3O5Q' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2070 _refine.pdbx_overall_ESU_R_Free 0.2060 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 15.7570 _refine.overall_SU_ML 0.1770 _refine.overall_SU_R_Cruickshank_DPI 0.2068 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.0500 _refine_hist.d_res_low 30.0000 _refine_hist.number_atoms_solvent 67 _refine_hist.number_atoms_total 1096 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 128 _refine_hist.pdbx_B_iso_mean_ligand 50.24 _refine_hist.pdbx_B_iso_mean_solvent 58.28 _refine_hist.pdbx_number_atoms_protein 979 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 50 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 0.020 1054 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 1023 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.857 2.025 1417 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.450 3.022 2383 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.571 5.000 127 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.400 24.872 39 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.372 15.000 182 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.008 15.000 3 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.088 0.200 150 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.021 1141 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 214 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.0500 _refine_ls_shell.d_res_low 2.1030 _refine_ls_shell.number_reflns_all 630 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 33 _refine_ls_shell.number_reflns_R_work 597 _refine_ls_shell.percent_reflns_obs 99.2100 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3080 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3350 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6SAF _struct.title ;The Fk1 domain of FKBP51 in complex with (S)-(R)-3-(3,4-dimethoxyphenyl)-1-(3-(2-morpholinoethoxy)phenyl)propyl 1-((1R,4aR,8aR)-4-oxodecahydronaphthalene-1-carbonyl)piperidine-2-carboxylate ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6SAF _struct_keywords.text 'Fk-506 binding domain, Hsp90 cochaperone, immunophiline, peptidyl-prolyl isomerase, ligand selectivity, chaperone' _struct_keywords.pdbx_keywords CHAPERONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FKBP5_HUMAN _struct_ref.pdbx_db_accession Q13451 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVA TMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE ; _struct_ref.pdbx_align_begin 16 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6SAF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13451 _struct_ref_seq.db_align_beg 16 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 140 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 16 _struct_ref_seq.pdbx_auth_seq_align_end 140 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6SAF GLY A 1 ? UNP Q13451 ? ? 'expression tag' 13 1 1 6SAF ALA A 2 ? UNP Q13451 ? ? 'expression tag' 14 2 1 6SAF PRO A 3 ? UNP Q13451 ? ? 'expression tag' 15 3 1 6SAF THR A 7 ? UNP Q13451 ALA 19 'engineered mutation' 19 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6980 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 1 ? GLY A 10 ? GLY A 13 GLY A 22 1 ? 10 HELX_P HELX_P2 AA2 ILE A 75 ? ALA A 83 ? ILE A 87 ALA A 95 1 ? 9 HELX_P HELX_P3 AA3 PRO A 97 ? ALA A 100 ? PRO A 109 ALA A 112 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 107 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 119 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 108 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 120 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.72 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 11 ? ASP A 12 ? GLU A 23 ASP A 24 AA1 2 VAL A 21 ? ARG A 27 ? VAL A 33 ARG A 39 AA1 3 ILE A 90 ? CYS A 95 ? ILE A 102 CYS A 107 AA1 4 LEU A 116 ? LYS A 126 ? LEU A 128 LYS A 138 AA1 5 LYS A 40 ? LEU A 49 ? LYS A 52 LEU A 61 AA1 6 PHE A 55 ? SER A 57 ? PHE A 67 SER A 69 AA2 1 GLU A 11 ? ASP A 12 ? GLU A 23 ASP A 24 AA2 2 VAL A 21 ? ARG A 27 ? VAL A 33 ARG A 39 AA2 3 ILE A 90 ? CYS A 95 ? ILE A 102 CYS A 107 AA2 4 LEU A 116 ? LYS A 126 ? LEU A 128 LYS A 138 AA2 5 LYS A 40 ? LEU A 49 ? LYS A 52 LEU A 61 AA2 6 PHE A 65 ? SER A 68 ? PHE A 77 SER A 80 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 11 ? N GLU A 23 O LYS A 23 ? O LYS A 35 AA1 2 3 N ILE A 24 ? N ILE A 36 O HIS A 92 ? O HIS A 104 AA1 3 4 N CYS A 95 ? N CYS A 107 O LEU A 116 ? O LEU A 128 AA1 4 5 O GLU A 121 ? O GLU A 133 N HIS A 44 ? N HIS A 56 AA1 5 6 N GLY A 47 ? N GLY A 59 O ASP A 56 ? O ASP A 68 AA2 1 2 N GLU A 11 ? N GLU A 23 O LYS A 23 ? O LYS A 35 AA2 2 3 N ILE A 24 ? N ILE A 36 O HIS A 92 ? O HIS A 104 AA2 3 4 N CYS A 95 ? N CYS A 107 O LEU A 116 ? O LEU A 128 AA2 4 5 O GLU A 121 ? O GLU A 133 N HIS A 44 ? N HIS A 56 AA2 5 6 N VAL A 41 ? N VAL A 53 O PHE A 67 ? O PHE A 79 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id L2Q _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 13 _struct_site.details 'binding site for residue L2Q A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 GLU A 8 ? GLU A 20 . ? 2_555 ? 2 AC1 13 TYR A 45 ? TYR A 57 . ? 1_555 ? 3 AC1 13 LYS A 48 ? LYS A 60 . ? 1_555 ? 4 AC1 13 ASP A 56 ? ASP A 68 . ? 1_555 ? 5 AC1 13 PHE A 65 ? PHE A 77 . ? 1_555 ? 6 AC1 13 GLY A 72 ? GLY A 84 . ? 1_555 ? 7 AC1 13 GLN A 73 ? GLN A 85 . ? 1_555 ? 8 AC1 13 VAL A 74 ? VAL A 86 . ? 1_555 ? 9 AC1 13 ILE A 75 ? ILE A 87 . ? 1_555 ? 10 AC1 13 TRP A 78 ? TRP A 90 . ? 1_555 ? 11 AC1 13 ALA A 100 ? ALA A 112 . ? 1_555 ? 12 AC1 13 TYR A 101 ? TYR A 113 . ? 1_555 ? 13 AC1 13 LYS A 109 ? LYS A 121 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 344 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 347 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 31 ? ? 48.53 22.99 2 1 ASN A 74 ? ? 39.18 44.92 3 1 ALA A 112 ? ? -133.89 -110.58 4 1 SER A 118 ? ? -156.19 80.81 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 5.3908 _pdbx_refine_tls.origin_y 2.1914 _pdbx_refine_tls.origin_z 18.7297 _pdbx_refine_tls.T[1][1] 0.0421 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0175 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0005 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.0380 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0070 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0130 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 3.9510 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -1.1536 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.8689 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 7.0216 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.1054 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 4.1659 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0875 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.1918 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0246 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.1359 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.1346 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.2759 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.0803 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.1296 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0471 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 13 ? ? A 140 ? ? 2 'X-RAY DIFFRACTION' 1 ? ? A 201 ? ? A 201 ? ? 3 'X-RAY DIFFRACTION' 1 ? ? A 301 ? ? A 367 ? ? # _pdbx_phasing_MR.entry_id 6SAF _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 39.270 _pdbx_phasing_MR.d_res_low_rotation 3.000 _pdbx_phasing_MR.d_res_high_translation ? _pdbx_phasing_MR.d_res_low_translation ? _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # _pdbx_entry_details.entry_id 6SAF _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 L2Q CAN C N R 183 L2Q CAR C N N 184 L2Q CAQ C N N 185 L2Q CAP C N N 186 L2Q CAO C N N 187 L2Q CAM C N R 188 L2Q CAL C N N 189 L2Q OAS O N N 190 L2Q CAK C N N 191 L2Q CAJ C N N 192 L2Q CAI C N R 193 L2Q CAG C N N 194 L2Q OAH O N N 195 L2Q N N N N 196 L2Q CAE C N N 197 L2Q CAD C N N 198 L2Q CAC C N N 199 L2Q CB C N N 200 L2Q CA C N S 201 L2Q C C N N 202 L2Q O O N N 203 L2Q OAV O N N 204 L2Q CAW C N R 205 L2Q CAY C N N 206 L2Q CAZ C N N 207 L2Q CBA C Y N 208 L2Q CBF C Y N 209 L2Q CBB C Y N 210 L2Q CBC C Y N 211 L2Q CBD C Y N 212 L2Q OBG O N N 213 L2Q CBH C N N 214 L2Q CBE C Y N 215 L2Q OBI O N N 216 L2Q CBJ C N N 217 L2Q CAX C Y N 218 L2Q CBK C Y N 219 L2Q CBO C Y N 220 L2Q CBN C Y N 221 L2Q CBM C Y N 222 L2Q CBL C Y N 223 L2Q OBP O N N 224 L2Q CBQ C N N 225 L2Q CBR C N N 226 L2Q NBS N N N 227 L2Q CBX C N N 228 L2Q CBW C N N 229 L2Q OBV O N N 230 L2Q CBU C N N 231 L2Q CBT C N N 232 L2Q H1 H N N 233 L2Q H2 H N N 234 L2Q H3 H N N 235 L2Q H4 H N N 236 L2Q H5 H N N 237 L2Q H6 H N N 238 L2Q H7 H N N 239 L2Q H8 H N N 240 L2Q H9 H N N 241 L2Q H10 H N N 242 L2Q H11 H N N 243 L2Q H12 H N N 244 L2Q H13 H N N 245 L2Q H14 H N N 246 L2Q H15 H N N 247 L2Q H16 H N N 248 L2Q H17 H N N 249 L2Q H18 H N N 250 L2Q H19 H N N 251 L2Q H20 H N N 252 L2Q H21 H N N 253 L2Q H22 H N N 254 L2Q H23 H N N 255 L2Q H24 H N N 256 L2Q H25 H N N 257 L2Q H26 H N N 258 L2Q H27 H N N 259 L2Q H28 H N N 260 L2Q H29 H N N 261 L2Q H30 H N N 262 L2Q H31 H N N 263 L2Q H32 H N N 264 L2Q H33 H N N 265 L2Q H34 H N N 266 L2Q H35 H N N 267 L2Q H36 H N N 268 L2Q H37 H N N 269 L2Q H38 H N N 270 L2Q H39 H N N 271 L2Q H40 H N N 272 L2Q H41 H N N 273 L2Q H42 H N N 274 L2Q H43 H N N 275 L2Q H44 H N N 276 L2Q H45 H N N 277 L2Q H46 H N N 278 L2Q H48 H N N 279 L2Q H49 H N N 280 L2Q H50 H N N 281 L2Q H51 H N N 282 L2Q H52 H N N 283 L2Q H53 H N N 284 L2Q H54 H N N 285 L2Q H55 H N N 286 LEU N N N N 287 LEU CA C N S 288 LEU C C N N 289 LEU O O N N 290 LEU CB C N N 291 LEU CG C N N 292 LEU CD1 C N N 293 LEU CD2 C N N 294 LEU OXT O N N 295 LEU H H N N 296 LEU H2 H N N 297 LEU HA H N N 298 LEU HB2 H N N 299 LEU HB3 H N N 300 LEU HG H N N 301 LEU HD11 H N N 302 LEU HD12 H N N 303 LEU HD13 H N N 304 LEU HD21 H N N 305 LEU HD22 H N N 306 LEU HD23 H N N 307 LEU HXT H N N 308 LYS N N N N 309 LYS CA C N S 310 LYS C C N N 311 LYS O O N N 312 LYS CB C N N 313 LYS CG C N N 314 LYS CD C N N 315 LYS CE C N N 316 LYS NZ N N N 317 LYS OXT O N N 318 LYS H H N N 319 LYS H2 H N N 320 LYS HA H N N 321 LYS HB2 H N N 322 LYS HB3 H N N 323 LYS HG2 H N N 324 LYS HG3 H N N 325 LYS HD2 H N N 326 LYS HD3 H N N 327 LYS HE2 H N N 328 LYS HE3 H N N 329 LYS HZ1 H N N 330 LYS HZ2 H N N 331 LYS HZ3 H N N 332 LYS HXT H N N 333 MET N N N N 334 MET CA C N S 335 MET C C N N 336 MET O O N N 337 MET CB C N N 338 MET CG C N N 339 MET SD S N N 340 MET CE C N N 341 MET OXT O N N 342 MET H H N N 343 MET H2 H N N 344 MET HA H N N 345 MET HB2 H N N 346 MET HB3 H N N 347 MET HG2 H N N 348 MET HG3 H N N 349 MET HE1 H N N 350 MET HE2 H N N 351 MET HE3 H N N 352 MET HXT H N N 353 PHE N N N N 354 PHE CA C N S 355 PHE C C N N 356 PHE O O N N 357 PHE CB C N N 358 PHE CG C Y N 359 PHE CD1 C Y N 360 PHE CD2 C Y N 361 PHE CE1 C Y N 362 PHE CE2 C Y N 363 PHE CZ C Y N 364 PHE OXT O N N 365 PHE H H N N 366 PHE H2 H N N 367 PHE HA H N N 368 PHE HB2 H N N 369 PHE HB3 H N N 370 PHE HD1 H N N 371 PHE HD2 H N N 372 PHE HE1 H N N 373 PHE HE2 H N N 374 PHE HZ H N N 375 PHE HXT H N N 376 PRO N N N N 377 PRO CA C N S 378 PRO C C N N 379 PRO O O N N 380 PRO CB C N N 381 PRO CG C N N 382 PRO CD C N N 383 PRO OXT O N N 384 PRO H H N N 385 PRO HA H N N 386 PRO HB2 H N N 387 PRO HB3 H N N 388 PRO HG2 H N N 389 PRO HG3 H N N 390 PRO HD2 H N N 391 PRO HD3 H N N 392 PRO HXT H N N 393 SER N N N N 394 SER CA C N S 395 SER C C N N 396 SER O O N N 397 SER CB C N N 398 SER OG O N N 399 SER OXT O N N 400 SER H H N N 401 SER H2 H N N 402 SER HA H N N 403 SER HB2 H N N 404 SER HB3 H N N 405 SER HG H N N 406 SER HXT H N N 407 THR N N N N 408 THR CA C N S 409 THR C C N N 410 THR O O N N 411 THR CB C N R 412 THR OG1 O N N 413 THR CG2 C N N 414 THR OXT O N N 415 THR H H N N 416 THR H2 H N N 417 THR HA H N N 418 THR HB H N N 419 THR HG1 H N N 420 THR HG21 H N N 421 THR HG22 H N N 422 THR HG23 H N N 423 THR HXT H N N 424 TRP N N N N 425 TRP CA C N S 426 TRP C C N N 427 TRP O O N N 428 TRP CB C N N 429 TRP CG C Y N 430 TRP CD1 C Y N 431 TRP CD2 C Y N 432 TRP NE1 N Y N 433 TRP CE2 C Y N 434 TRP CE3 C Y N 435 TRP CZ2 C Y N 436 TRP CZ3 C Y N 437 TRP CH2 C Y N 438 TRP OXT O N N 439 TRP H H N N 440 TRP H2 H N N 441 TRP HA H N N 442 TRP HB2 H N N 443 TRP HB3 H N N 444 TRP HD1 H N N 445 TRP HE1 H N N 446 TRP HE3 H N N 447 TRP HZ2 H N N 448 TRP HZ3 H N N 449 TRP HH2 H N N 450 TRP HXT H N N 451 TYR N N N N 452 TYR CA C N S 453 TYR C C N N 454 TYR O O N N 455 TYR CB C N N 456 TYR CG C Y N 457 TYR CD1 C Y N 458 TYR CD2 C Y N 459 TYR CE1 C Y N 460 TYR CE2 C Y N 461 TYR CZ C Y N 462 TYR OH O N N 463 TYR OXT O N N 464 TYR H H N N 465 TYR H2 H N N 466 TYR HA H N N 467 TYR HB2 H N N 468 TYR HB3 H N N 469 TYR HD1 H N N 470 TYR HD2 H N N 471 TYR HE1 H N N 472 TYR HE2 H N N 473 TYR HH H N N 474 TYR HXT H N N 475 VAL N N N N 476 VAL CA C N S 477 VAL C C N N 478 VAL O O N N 479 VAL CB C N N 480 VAL CG1 C N N 481 VAL CG2 C N N 482 VAL OXT O N N 483 VAL H H N N 484 VAL H2 H N N 485 VAL HA H N N 486 VAL HB H N N 487 VAL HG11 H N N 488 VAL HG12 H N N 489 VAL HG13 H N N 490 VAL HG21 H N N 491 VAL HG22 H N N 492 VAL HG23 H N N 493 VAL HXT H N N 494 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 L2Q CAQ CAR sing N N 173 L2Q CAQ CAP sing N N 174 L2Q CB CAC sing N N 175 L2Q CB CA sing N N 176 L2Q CAR CAN sing N N 177 L2Q CAP CAO sing N N 178 L2Q CAC CAD sing N N 179 L2Q CAD CAE sing N N 180 L2Q CA N sing N N 181 L2Q CA C sing N N 182 L2Q OAH CAG doub N N 183 L2Q N CAG sing N N 184 L2Q N CAE sing N N 185 L2Q CAG CAI sing N N 186 L2Q CAN CAI sing N N 187 L2Q CAN CAM sing N N 188 L2Q O C doub N N 189 L2Q CAO CAM sing N N 190 L2Q C OAV sing N N 191 L2Q CAI CAJ sing N N 192 L2Q CAM CAL sing N N 193 L2Q CBJ OBI sing N N 194 L2Q CBH OBG sing N N 195 L2Q OBG CBD sing N N 196 L2Q OAV CAW sing N N 197 L2Q CAJ CAK sing N N 198 L2Q CAL CAK sing N N 199 L2Q CAL OAS doub N N 200 L2Q CBD CBE doub Y N 201 L2Q CBD CBC sing Y N 202 L2Q OBI CBE sing N N 203 L2Q CBE CBF sing Y N 204 L2Q CBC CBB doub Y N 205 L2Q CAW CAY sing N N 206 L2Q CAW CAX sing N N 207 L2Q CBF CBA doub Y N 208 L2Q CBB CBA sing Y N 209 L2Q CAY CAZ sing N N 210 L2Q CBA CAZ sing N N 211 L2Q CAX CBK doub Y N 212 L2Q CAX CBO sing Y N 213 L2Q CBK CBL sing Y N 214 L2Q CBO CBN doub Y N 215 L2Q CBQ OBP sing N N 216 L2Q CBQ CBR sing N N 217 L2Q CBL OBP sing N N 218 L2Q CBL CBM doub Y N 219 L2Q CBN CBM sing Y N 220 L2Q CBX NBS sing N N 221 L2Q CBX CBW sing N N 222 L2Q NBS CBR sing N N 223 L2Q NBS CBT sing N N 224 L2Q CBW OBV sing N N 225 L2Q CBT CBU sing N N 226 L2Q OBV CBU sing N N 227 L2Q CAN H1 sing N N 228 L2Q CAR H2 sing N N 229 L2Q CAR H3 sing N N 230 L2Q CAQ H4 sing N N 231 L2Q CAQ H5 sing N N 232 L2Q CAP H6 sing N N 233 L2Q CAP H7 sing N N 234 L2Q CAO H8 sing N N 235 L2Q CAO H9 sing N N 236 L2Q CAM H10 sing N N 237 L2Q CAK H11 sing N N 238 L2Q CAK H12 sing N N 239 L2Q CAJ H13 sing N N 240 L2Q CAJ H14 sing N N 241 L2Q CAI H15 sing N N 242 L2Q CAE H16 sing N N 243 L2Q CAE H17 sing N N 244 L2Q CAD H18 sing N N 245 L2Q CAD H19 sing N N 246 L2Q CAC H20 sing N N 247 L2Q CAC H21 sing N N 248 L2Q CB H22 sing N N 249 L2Q CB H23 sing N N 250 L2Q CA H24 sing N N 251 L2Q CAW H25 sing N N 252 L2Q CAY H26 sing N N 253 L2Q CAY H27 sing N N 254 L2Q CAZ H28 sing N N 255 L2Q CAZ H29 sing N N 256 L2Q CBF H30 sing N N 257 L2Q CBB H31 sing N N 258 L2Q CBC H32 sing N N 259 L2Q CBH H33 sing N N 260 L2Q CBH H34 sing N N 261 L2Q CBH H35 sing N N 262 L2Q CBJ H36 sing N N 263 L2Q CBJ H37 sing N N 264 L2Q CBJ H38 sing N N 265 L2Q CBK H39 sing N N 266 L2Q CBO H40 sing N N 267 L2Q CBN H41 sing N N 268 L2Q CBM H42 sing N N 269 L2Q CBQ H43 sing N N 270 L2Q CBQ H44 sing N N 271 L2Q CBR H45 sing N N 272 L2Q CBR H46 sing N N 273 L2Q CBX H48 sing N N 274 L2Q CBX H49 sing N N 275 L2Q CBW H50 sing N N 276 L2Q CBW H51 sing N N 277 L2Q CBU H52 sing N N 278 L2Q CBU H53 sing N N 279 L2Q CBT H54 sing N N 280 L2Q CBT H55 sing N N 281 LEU N CA sing N N 282 LEU N H sing N N 283 LEU N H2 sing N N 284 LEU CA C sing N N 285 LEU CA CB sing N N 286 LEU CA HA sing N N 287 LEU C O doub N N 288 LEU C OXT sing N N 289 LEU CB CG sing N N 290 LEU CB HB2 sing N N 291 LEU CB HB3 sing N N 292 LEU CG CD1 sing N N 293 LEU CG CD2 sing N N 294 LEU CG HG sing N N 295 LEU CD1 HD11 sing N N 296 LEU CD1 HD12 sing N N 297 LEU CD1 HD13 sing N N 298 LEU CD2 HD21 sing N N 299 LEU CD2 HD22 sing N N 300 LEU CD2 HD23 sing N N 301 LEU OXT HXT sing N N 302 LYS N CA sing N N 303 LYS N H sing N N 304 LYS N H2 sing N N 305 LYS CA C sing N N 306 LYS CA CB sing N N 307 LYS CA HA sing N N 308 LYS C O doub N N 309 LYS C OXT sing N N 310 LYS CB CG sing N N 311 LYS CB HB2 sing N N 312 LYS CB HB3 sing N N 313 LYS CG CD sing N N 314 LYS CG HG2 sing N N 315 LYS CG HG3 sing N N 316 LYS CD CE sing N N 317 LYS CD HD2 sing N N 318 LYS CD HD3 sing N N 319 LYS CE NZ sing N N 320 LYS CE HE2 sing N N 321 LYS CE HE3 sing N N 322 LYS NZ HZ1 sing N N 323 LYS NZ HZ2 sing N N 324 LYS NZ HZ3 sing N N 325 LYS OXT HXT sing N N 326 MET N CA sing N N 327 MET N H sing N N 328 MET N H2 sing N N 329 MET CA C sing N N 330 MET CA CB sing N N 331 MET CA HA sing N N 332 MET C O doub N N 333 MET C OXT sing N N 334 MET CB CG sing N N 335 MET CB HB2 sing N N 336 MET CB HB3 sing N N 337 MET CG SD sing N N 338 MET CG HG2 sing N N 339 MET CG HG3 sing N N 340 MET SD CE sing N N 341 MET CE HE1 sing N N 342 MET CE HE2 sing N N 343 MET CE HE3 sing N N 344 MET OXT HXT sing N N 345 PHE N CA sing N N 346 PHE N H sing N N 347 PHE N H2 sing N N 348 PHE CA C sing N N 349 PHE CA CB sing N N 350 PHE CA HA sing N N 351 PHE C O doub N N 352 PHE C OXT sing N N 353 PHE CB CG sing N N 354 PHE CB HB2 sing N N 355 PHE CB HB3 sing N N 356 PHE CG CD1 doub Y N 357 PHE CG CD2 sing Y N 358 PHE CD1 CE1 sing Y N 359 PHE CD1 HD1 sing N N 360 PHE CD2 CE2 doub Y N 361 PHE CD2 HD2 sing N N 362 PHE CE1 CZ doub Y N 363 PHE CE1 HE1 sing N N 364 PHE CE2 CZ sing Y N 365 PHE CE2 HE2 sing N N 366 PHE CZ HZ sing N N 367 PHE OXT HXT sing N N 368 PRO N CA sing N N 369 PRO N CD sing N N 370 PRO N H sing N N 371 PRO CA C sing N N 372 PRO CA CB sing N N 373 PRO CA HA sing N N 374 PRO C O doub N N 375 PRO C OXT sing N N 376 PRO CB CG sing N N 377 PRO CB HB2 sing N N 378 PRO CB HB3 sing N N 379 PRO CG CD sing N N 380 PRO CG HG2 sing N N 381 PRO CG HG3 sing N N 382 PRO CD HD2 sing N N 383 PRO CD HD3 sing N N 384 PRO OXT HXT sing N N 385 SER N CA sing N N 386 SER N H sing N N 387 SER N H2 sing N N 388 SER CA C sing N N 389 SER CA CB sing N N 390 SER CA HA sing N N 391 SER C O doub N N 392 SER C OXT sing N N 393 SER CB OG sing N N 394 SER CB HB2 sing N N 395 SER CB HB3 sing N N 396 SER OG HG sing N N 397 SER OXT HXT sing N N 398 THR N CA sing N N 399 THR N H sing N N 400 THR N H2 sing N N 401 THR CA C sing N N 402 THR CA CB sing N N 403 THR CA HA sing N N 404 THR C O doub N N 405 THR C OXT sing N N 406 THR CB OG1 sing N N 407 THR CB CG2 sing N N 408 THR CB HB sing N N 409 THR OG1 HG1 sing N N 410 THR CG2 HG21 sing N N 411 THR CG2 HG22 sing N N 412 THR CG2 HG23 sing N N 413 THR OXT HXT sing N N 414 TRP N CA sing N N 415 TRP N H sing N N 416 TRP N H2 sing N N 417 TRP CA C sing N N 418 TRP CA CB sing N N 419 TRP CA HA sing N N 420 TRP C O doub N N 421 TRP C OXT sing N N 422 TRP CB CG sing N N 423 TRP CB HB2 sing N N 424 TRP CB HB3 sing N N 425 TRP CG CD1 doub Y N 426 TRP CG CD2 sing Y N 427 TRP CD1 NE1 sing Y N 428 TRP CD1 HD1 sing N N 429 TRP CD2 CE2 doub Y N 430 TRP CD2 CE3 sing Y N 431 TRP NE1 CE2 sing Y N 432 TRP NE1 HE1 sing N N 433 TRP CE2 CZ2 sing Y N 434 TRP CE3 CZ3 doub Y N 435 TRP CE3 HE3 sing N N 436 TRP CZ2 CH2 doub Y N 437 TRP CZ2 HZ2 sing N N 438 TRP CZ3 CH2 sing Y N 439 TRP CZ3 HZ3 sing N N 440 TRP CH2 HH2 sing N N 441 TRP OXT HXT sing N N 442 TYR N CA sing N N 443 TYR N H sing N N 444 TYR N H2 sing N N 445 TYR CA C sing N N 446 TYR CA CB sing N N 447 TYR CA HA sing N N 448 TYR C O doub N N 449 TYR C OXT sing N N 450 TYR CB CG sing N N 451 TYR CB HB2 sing N N 452 TYR CB HB3 sing N N 453 TYR CG CD1 doub Y N 454 TYR CG CD2 sing Y N 455 TYR CD1 CE1 sing Y N 456 TYR CD1 HD1 sing N N 457 TYR CD2 CE2 doub Y N 458 TYR CD2 HD2 sing N N 459 TYR CE1 CZ doub Y N 460 TYR CE1 HE1 sing N N 461 TYR CE2 CZ sing Y N 462 TYR CE2 HE2 sing N N 463 TYR CZ OH sing N N 464 TYR OH HH sing N N 465 TYR OXT HXT sing N N 466 VAL N CA sing N N 467 VAL N H sing N N 468 VAL N H2 sing N N 469 VAL CA C sing N N 470 VAL CA CB sing N N 471 VAL CA HA sing N N 472 VAL C O doub N N 473 VAL C OXT sing N N 474 VAL CB CG1 sing N N 475 VAL CB CG2 sing N N 476 VAL CB HB sing N N 477 VAL CG1 HG11 sing N N 478 VAL CG1 HG12 sing N N 479 VAL CG1 HG13 sing N N 480 VAL CG2 HG21 sing N N 481 VAL CG2 HG22 sing N N 482 VAL CG2 HG23 sing N N 483 VAL OXT HXT sing N N 484 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id L2Q _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id L2Q _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3O5Q _pdbx_initial_refinement_model.details 'pdbid 3O5Q' # _atom_sites.entry_id 6SAF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.023499 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019867 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015930 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_