data_6TDD # _entry.id 6TDD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6TDD pdb_00006tdd 10.2210/pdb6tdd/pdb WWPDB D_1292105302 ? ? BMRB 34446 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Bam_5924 docking domain' _pdbx_database_related.db_id 34446 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6TDD _pdbx_database_status.recvd_initial_deposition_date 2019-11-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Risser, F.' 1 ? 'Chagot, B.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Struct.Biol. _citation.journal_id_ASTM JSBIEM _citation.journal_id_CSD 0803 _citation.journal_id_ISSN 1095-8657 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 212 _citation.language ? _citation.page_first 107581 _citation.page_last 107581 _citation.title ;Towards improved understanding of intersubunit interactions in modular polyketide biosynthesis: Docking in the enacyloxin IIa polyketide synthase. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jsb.2020.107581 _citation.pdbx_database_id_PubMed 32717326 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Risser, F.' 1 ? primary 'Collin, S.' 2 ? primary 'Dos Santos-Morais, R.' 3 ? primary 'Gruez, A.' 4 ? primary 'Chagot, B.' 5 ? primary 'Weissman, K.J.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Beta-ketoacyl synthase' _entity.formula_weight 5026.728 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'Dimeric protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPGSMNKPTSSDGWKDDYLSRLSRLSKNQLMALALKLKQQQLEQG _entity_poly.pdbx_seq_one_letter_code_can GPGSMNKPTSSDGWKDDYLSRLSRLSKNQLMALALKLKQQQLEQG _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 MET n 1 6 ASN n 1 7 LYS n 1 8 PRO n 1 9 THR n 1 10 SER n 1 11 SER n 1 12 ASP n 1 13 GLY n 1 14 TRP n 1 15 LYS n 1 16 ASP n 1 17 ASP n 1 18 TYR n 1 19 LEU n 1 20 SER n 1 21 ARG n 1 22 LEU n 1 23 SER n 1 24 ARG n 1 25 LEU n 1 26 SER n 1 27 LYS n 1 28 ASN n 1 29 GLN n 1 30 LEU n 1 31 MET n 1 32 ALA n 1 33 LEU n 1 34 ALA n 1 35 LEU n 1 36 LYS n 1 37 LEU n 1 38 LYS n 1 39 GLN n 1 40 GLN n 1 41 GLN n 1 42 LEU n 1 43 GLU n 1 44 GLN n 1 45 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 45 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Bamb_5924 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Burkholderia ambifaria AMMD' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 339670 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pBG102 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q0B304_BURCM _struct_ref.pdbx_db_accession Q0B304 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MNKPTSSDGWKDDYLSRLSRLSKNQLMALALKLKQQQLEQG _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6TDD A 5 ? 45 ? Q0B304 1 ? 41 ? 5 45 2 1 6TDD B 5 ? 45 ? Q0B304 1 ? 41 ? 105 145 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6TDD GLY A 1 ? UNP Q0B304 ? ? 'expression tag' 1 1 1 6TDD PRO A 2 ? UNP Q0B304 ? ? 'expression tag' 2 2 1 6TDD GLY A 3 ? UNP Q0B304 ? ? 'expression tag' 3 3 1 6TDD SER A 4 ? UNP Q0B304 ? ? 'expression tag' 4 4 2 6TDD GLY B 1 ? UNP Q0B304 ? ? 'expression tag' 101 5 2 6TDD PRO B 2 ? UNP Q0B304 ? ? 'expression tag' 102 6 2 6TDD GLY B 3 ? UNP Q0B304 ? ? 'expression tag' 103 7 2 6TDD SER B 4 ? UNP Q0B304 ? ? 'expression tag' 104 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 4 1 1 '3D CBCA(CO)NH' 1 isotropic 5 1 1 '3D HNCO' 1 isotropic 13 1 1 '3D HNCACB' 1 isotropic 12 1 1 '3D H(CCO)NH' 1 isotropic 11 1 1 '3D HCCH-TOCSY' 1 isotropic 10 1 1 '3D C(CO)NH' 1 isotropic 9 1 1 '3D 1H-15N NOESY' 1 isotropic 8 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 7 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '100 mM U- sodium phosphate, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 13C_15N_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6TDD _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # _pdbx_nmr_ensemble.entry_id 6TDD _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6TDD _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' Sparky ? Goddard 4 'peak picking' Sparky ? Goddard 5 refinement Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6TDD _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6TDD _struct.title 'Bam_5924 docking domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6TDD _struct_keywords.text 'docking domain, polyketide synthase, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 13 ? SER A 23 ? GLY A 13 SER A 23 1 ? 11 HELX_P HELX_P2 AA2 SER A 26 ? GLN A 44 ? SER A 26 GLN A 44 1 ? 19 HELX_P HELX_P3 AA3 GLY B 13 ? SER B 23 ? GLY B 113 SER B 123 1 ? 11 HELX_P HELX_P4 AA4 SER B 26 ? GLN B 44 ? SER B 126 GLN B 144 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 4 A . ? SER 4 A MET 5 A ? MET 5 A 1 -13.91 2 MET 5 B . ? MET 105 B ASN 6 B ? ASN 106 B 3 -6.79 3 PRO 2 B . ? PRO 102 B GLY 3 B ? GLY 103 B 4 -0.17 4 SER 4 A . ? SER 4 A MET 5 A ? MET 5 A 6 2.69 5 MET 5 A . ? MET 5 A ASN 6 A ? ASN 6 A 8 5.55 6 MET 5 B . ? MET 105 B ASN 6 B ? ASN 106 B 9 -7.80 7 THR 9 B . ? THR 109 B SER 10 B ? SER 110 B 11 -7.22 8 SER 10 A . ? SER 10 A SER 11 A ? SER 11 A 17 5.57 9 GLY 1 A . ? GLY 1 A PRO 2 A ? PRO 2 A 22 -0.55 10 SER 4 B . ? SER 104 B MET 5 B ? MET 105 B 25 -5.37 # _atom_sites.entry_id 6TDD _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 GLY 45 45 45 GLY GLY A . n B 1 1 GLY 1 101 101 GLY GLY B . n B 1 2 PRO 2 102 102 PRO PRO B . n B 1 3 GLY 3 103 103 GLY GLY B . n B 1 4 SER 4 104 104 SER SER B . n B 1 5 MET 5 105 105 MET MET B . n B 1 6 ASN 6 106 106 ASN ASN B . n B 1 7 LYS 7 107 107 LYS LYS B . n B 1 8 PRO 8 108 108 PRO PRO B . n B 1 9 THR 9 109 109 THR THR B . n B 1 10 SER 10 110 110 SER SER B . n B 1 11 SER 11 111 111 SER SER B . n B 1 12 ASP 12 112 112 ASP ASP B . n B 1 13 GLY 13 113 113 GLY GLY B . n B 1 14 TRP 14 114 114 TRP TRP B . n B 1 15 LYS 15 115 115 LYS LYS B . n B 1 16 ASP 16 116 116 ASP ASP B . n B 1 17 ASP 17 117 117 ASP ASP B . n B 1 18 TYR 18 118 118 TYR TYR B . n B 1 19 LEU 19 119 119 LEU LEU B . n B 1 20 SER 20 120 120 SER SER B . n B 1 21 ARG 21 121 121 ARG ARG B . n B 1 22 LEU 22 122 122 LEU LEU B . n B 1 23 SER 23 123 123 SER SER B . n B 1 24 ARG 24 124 124 ARG ARG B . n B 1 25 LEU 25 125 125 LEU LEU B . n B 1 26 SER 26 126 126 SER SER B . n B 1 27 LYS 27 127 127 LYS LYS B . n B 1 28 ASN 28 128 128 ASN ASN B . n B 1 29 GLN 29 129 129 GLN GLN B . n B 1 30 LEU 30 130 130 LEU LEU B . n B 1 31 MET 31 131 131 MET MET B . n B 1 32 ALA 32 132 132 ALA ALA B . n B 1 33 LEU 33 133 133 LEU LEU B . n B 1 34 ALA 34 134 134 ALA ALA B . n B 1 35 LEU 35 135 135 LEU LEU B . n B 1 36 LYS 36 136 136 LYS LYS B . n B 1 37 LEU 37 137 137 LEU LEU B . n B 1 38 LYS 38 138 138 LYS LYS B . n B 1 39 GLN 39 139 139 GLN GLN B . n B 1 40 GLN 40 140 140 GLN GLN B . n B 1 41 GLN 41 141 141 GLN GLN B . n B 1 42 LEU 42 142 142 LEU LEU B . n B 1 43 GLU 43 143 143 GLU GLU B . n B 1 44 GLN 44 144 144 GLN GLN B . n B 1 45 GLY 45 145 145 GLY GLY B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2130 ? 1 MORE -19 ? 1 'SSA (A^2)' 6950 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-08-12 2 'Structure model' 1 1 2020-10-07 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' database_2 3 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' 5 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'sodium phosphate' _pdbx_nmr_exptl_sample.concentration 100 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling U- # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.30 120.30 3.00 0.50 N 2 6 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.82 120.30 3.52 0.50 N 3 9 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.59 120.30 3.29 0.50 N 4 9 NE B ARG 121 ? ? CZ B ARG 121 ? ? NH1 B ARG 121 ? ? 123.57 120.30 3.27 0.50 N 5 11 NE B ARG 121 ? ? CZ B ARG 121 ? ? NH1 B ARG 121 ? ? 123.85 120.30 3.55 0.50 N 6 18 NE B ARG 121 ? ? CZ B ARG 121 ? ? NH1 B ARG 121 ? ? 123.76 120.30 3.46 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER B 110 ? ? 61.02 -0.96 2 2 ASN A 6 ? ? -76.30 42.19 3 3 ASN A 6 ? ? 59.69 -40.85 4 3 SER A 11 ? ? 58.31 -160.76 5 4 PRO B 108 ? ? -63.67 -177.59 6 4 SER B 111 ? ? 51.10 -157.24 7 7 MET A 5 ? ? 58.69 4.75 8 7 SER A 11 ? ? 48.44 -119.76 9 7 LYS B 107 ? ? -151.88 71.55 10 8 SER A 11 ? ? -155.43 10.38 11 8 ASP A 12 ? ? 59.16 -71.91 12 9 ASP B 112 ? ? 57.07 18.52 13 10 THR A 9 ? ? 63.21 -52.05 14 10 ASP A 12 ? ? -79.68 37.20 15 12 MET A 5 ? ? 60.41 178.23 16 12 THR A 9 ? ? -73.42 38.04 17 13 SER A 4 ? ? -74.51 28.76 18 15 ASN A 6 ? ? 59.69 -174.30 19 15 SER A 11 ? ? 55.92 -152.76 20 15 SER B 111 ? ? 54.77 19.34 21 15 ASP B 112 ? ? 58.12 8.50 22 16 ASN A 6 ? ? 56.99 -167.66 23 16 SER A 10 ? ? 58.72 -174.03 24 16 ASP A 12 ? ? -82.35 30.44 25 16 SER B 110 ? ? 58.25 10.37 26 16 ASP B 112 ? ? 60.41 -0.69 27 19 MET A 5 ? ? 60.56 -60.37 28 20 LYS A 7 ? ? 66.70 148.93 29 21 SER A 4 ? ? 61.71 -16.94 30 21 ASN A 6 ? ? -150.78 10.61 31 21 THR A 9 ? ? 60.62 -65.11 32 21 ASP A 12 ? ? -145.96 10.58 33 21 MET B 105 ? ? 58.96 164.31 34 22 MET B 105 ? ? 63.49 157.89 35 22 SER B 110 ? ? 61.30 159.06 36 23 SER B 104 ? ? 61.76 175.32 37 25 MET A 5 ? ? 52.21 -89.76 38 25 SER A 10 ? ? 57.18 -159.45 39 25 THR B 109 ? ? 65.44 146.23 40 25 ASP B 112 ? ? -77.35 43.75 # _pdbx_audit_support.funding_organization 'French National Research Agency' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 SAXS ? 2 1 'light scattering' ? #