data_6TEY # _entry.id 6TEY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6TEY pdb_00006tey 10.2210/pdb6tey/pdb WWPDB D_1292103360 ? ? BMRB 34449 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution Structure of the DNA-binding TubR fragment from Clostridium Botulinum' _pdbx_database_related.db_id 34449 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6TEY _pdbx_database_status.recvd_initial_deposition_date 2019-11-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Valverde, P.' 1 0000-0002-0398-5883 'Canada, F.J.' 2 0000-0003-4462-1469 'Jimenez-Barbero, J.' 3 0000-0001-5421-8513 'Oliva, M.A.' 4 0000-0002-2215-4639 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Structure of TubR protein fragment from Clostridium Botulinum's phage c-st ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Valverde, P.' 1 0000-0002-0398-5883 primary 'Canada, F.J.' 2 0000-0003-4462-1469 primary 'Jimenez-Barbero, J.' 3 0000-0001-5421-8513 primary 'Oliva, M.A.' 4 0000-0002-2215-4639 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DNA-binding protein TubR' _entity.formula_weight 9434.286 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Centromere-binding protein,CBP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAVNKNEYKILIMLKENQCTTELKSFTYTKLCNISKLSMSTVRRSIKKFLELQYVKEGCKQGISKTFYITPNGIEKLKSI M ; _entity_poly.pdbx_seq_one_letter_code_can ;MAVNKNEYKILIMLKENQCTTELKSFTYTKLCNISKLSMSTVRRSIKKFLELQYVKEGCKQGISKTFYITPNGIEKLKSI M ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 VAL n 1 4 ASN n 1 5 LYS n 1 6 ASN n 1 7 GLU n 1 8 TYR n 1 9 LYS n 1 10 ILE n 1 11 LEU n 1 12 ILE n 1 13 MET n 1 14 LEU n 1 15 LYS n 1 16 GLU n 1 17 ASN n 1 18 GLN n 1 19 CYS n 1 20 THR n 1 21 THR n 1 22 GLU n 1 23 LEU n 1 24 LYS n 1 25 SER n 1 26 PHE n 1 27 THR n 1 28 TYR n 1 29 THR n 1 30 LYS n 1 31 LEU n 1 32 CYS n 1 33 ASN n 1 34 ILE n 1 35 SER n 1 36 LYS n 1 37 LEU n 1 38 SER n 1 39 MET n 1 40 SER n 1 41 THR n 1 42 VAL n 1 43 ARG n 1 44 ARG n 1 45 SER n 1 46 ILE n 1 47 LYS n 1 48 LYS n 1 49 PHE n 1 50 LEU n 1 51 GLU n 1 52 LEU n 1 53 GLN n 1 54 TYR n 1 55 VAL n 1 56 LYS n 1 57 GLU n 1 58 GLY n 1 59 CYS n 1 60 LYS n 1 61 GLN n 1 62 GLY n 1 63 ILE n 1 64 SER n 1 65 LYS n 1 66 THR n 1 67 PHE n 1 68 TYR n 1 69 ILE n 1 70 THR n 1 71 PRO n 1 72 ASN n 1 73 GLY n 1 74 ILE n 1 75 GLU n 1 76 LYS n 1 77 LEU n 1 78 LYS n 1 79 SER n 1 80 ILE n 1 81 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 81 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'tubR, CST190' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Clostridium botulinum C phage' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 12336 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TUBR_CBCP _struct_ref.pdbx_db_accession Q331T6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAVNKNEYKILIMLKENQCTTELKSFTYTKLCNISKLSMSTVRRSIKKFLELQYVKEGCKQGISKTFYITPNGIEKLKSI M ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6TEY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 81 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q331T6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 81 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 81 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCO' 1 isotropic 2 1 1 '3D HN(CO)CA' 1 isotropic 3 1 1 '3D HNCA' 1 isotropic 4 1 1 '3D CBCA(CO)NH' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 6 1 1 '3D H(CCO)NH' 2 isotropic 7 1 2 '2D 1H-1H NOESY' 2 isotropic 9 1 1 '2D 1H-15N HSQC' 1 isotropic 8 1 1 '2D 1H-13C HSQC' 2 isotropic 10 1 1 '2D 1H-13C HSQC aromatic' 2 isotropic 11 1 1 '3D C(CO)NH' 2 isotropic 12 1 1 '3D HCCH-TOCSY' 2 isotropic 13 1 1 '3D HCCH-TOCSY' 2 isotropic 14 1 2 '3D 1H-15N NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 80.13 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err 0.05 _pdbx_nmr_exptl_sample_conditions.temperature_err 0.1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 2 _pdbx_nmr_sample_details.contents '225 uM [U-15N] TubR, 25 mM potassium phosphate, 50 mM potassium chloride, 2 mM D-10 DTT, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 15N_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 600 crioprobe 2 AVANCE ? Bruker 600 'PATXI probe' # loop_ _pdbx_nmr_refine.entry_id _pdbx_nmr_refine.method _pdbx_nmr_refine.details _pdbx_nmr_refine.software_ordinal 6TEY 'torsion angle dynamics' ? 5 6TEY 'molecular dynamics' ? 9 6TEY 'distance geometry' ? 6 # _pdbx_nmr_ensemble.entry_id 6TEY _pdbx_nmr_ensemble.conformers_calculated_total_number 150 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6TEY _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria medoid # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 'data analysis' CARA ? 'Keller and Wuthrich' 3 'chemical shift assignment' CARA ? 'Keller and Wuthrich' 4 'peak picking' CARA ? 'Keller and Wuthrich' 5 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 6 refinement MolProbity ? Richardson 7 'geometry optimization' MolProbity ? Richardson 8 processing TopSpin ? 'Bruker Biospin' 9 refinement Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6TEY _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6TEY _struct.title 'Solution Structure of the DNA-binding TubR fragment from Clostridium Botulinum' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6TEY _struct_keywords.text 'DNA segregation, partition systems, TubR, winged helix-turn-helix, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 4 ? GLN A 18 ? ASN A 4 GLN A 18 1 ? 15 HELX_P HELX_P2 AA2 THR A 27 ? SER A 35 ? THR A 27 SER A 35 1 ? 9 HELX_P HELX_P3 AA3 SER A 38 ? LEU A 52 ? SER A 38 LEU A 52 1 ? 15 HELX_P HELX_P4 AA4 THR A 70 ? ILE A 80 ? THR A 70 ILE A 80 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 55 ? GLU A 57 ? VAL A 55 GLU A 57 AA1 2 PHE A 67 ? ILE A 69 ? PHE A 67 ILE A 69 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 56 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 56 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 68 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 68 # _atom_sites.entry_id 6TEY _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 MET 81 81 81 MET MET A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5800 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-11-18 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 2 TubR 225 ? uM '[U-15N]' 2 'potassium phosphate' 25 ? mM 'natural abundance' 2 'potassium chloride' 50 ? mM 'natural abundance' 2 DTT 2 ? mM D-10 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 5 CYS A 19 ? ? -102.84 57.92 2 8 THR A 21 ? ? 179.67 164.91 3 8 LEU A 52 ? ? -68.39 5.71 4 8 GLN A 53 ? ? 66.76 -21.20 5 9 ASN A 6 ? ? 73.32 -48.90 6 9 CYS A 19 ? ? -85.21 44.15 7 9 GLN A 53 ? ? 98.19 -3.42 8 10 GLN A 53 ? ? 59.61 11.76 9 11 GLN A 53 ? ? 89.19 -6.58 10 12 ASN A 6 ? ? -101.76 -74.64 11 12 GLN A 53 ? ? 59.55 12.05 12 14 CYS A 19 ? ? -118.09 68.82 13 14 GLN A 53 ? ? 63.00 -11.58 14 15 LYS A 5 ? ? -66.15 3.06 15 15 ASN A 6 ? ? -80.72 -76.17 16 15 LYS A 36 ? ? 58.78 15.48 17 15 GLN A 53 ? ? 93.96 0.83 18 17 VAL A 3 ? ? 35.39 47.19 19 17 LYS A 5 ? ? -64.18 8.62 20 17 CYS A 19 ? ? -88.30 47.69 21 17 GLN A 53 ? ? 69.75 -4.19 22 19 ASN A 6 ? ? 70.16 -39.22 23 20 ASN A 6 ? ? -102.97 -61.76 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Spanish Ministry of Economy and Competitiveness' Spain FPU14/06147 1 'Spanish Ministry of Economy and Competitiveness' Spain 'CTQ2015- 64597-C2' 2 'Spanish Ministry of Economy and Competitiveness' Spain RTI2018-094751-B-C2 3 'Spanish Ministry of Economy and Competitiveness' Spain BFU2013-47014-P 4 'Spanish Ministry of Science, Innovation, and Universities' Spain RYC-2011-07900 5 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'native gel electrophoresis' _pdbx_struct_assembly_auth_evidence.details 'Also checked by 2D-DOSY NMR' #