data_6TH8 # _entry.id 6TH8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6TH8 pdb_00006th8 10.2210/pdb6th8/pdb WWPDB D_1292105435 ? ? BMRB 34452 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Reconstructing the Origins of the HemD-like fold' _pdbx_database_related.db_id 34452 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6TH8 _pdbx_database_status.recvd_initial_deposition_date 2019-11-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Coles, M.' 1 0000-0001-6716-6150 'Toledo-Patino, S.' 2 ? 'Chaubey, M.' 3 ? 'Hocker, B.' 4 0000-0002-8250-9462 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 58 _citation.language ? _citation.page_first 4790 _citation.page_last 4793 _citation.title 'Reconstructing the Remote Origins of a Fold Singleton from a Flavodoxin-Like Ancestor.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.9b00900 _citation.pdbx_database_id_PubMed 31724394 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Toledo-Patino, S.' 1 ? primary 'Chaubey, M.' 2 ? primary 'Coles, M.' 3 ? primary 'Hocker, B.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description cU3Sd _entity.formula_weight 13651.649 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDPKVLIMRGEGGREFLAERLRGQGVQVDYLPLDYPAGELLARVRAERLNGLVVSSGQGLQNLYQLAAADWPEIGRLPLF VPSPRVAEMARELGAQRVIDCRGASAPALLAALTSAALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDPKVLIMRGEGGREFLAERLRGQGVQVDYLPLDYPAGELLARVRAERLNGLVVSSGQGLQNLYQLAAADWPEIGRLPLF VPSPRVAEMARELGAQRVIDCRGASAPALLAALTSAALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 PRO n 1 4 LYS n 1 5 VAL n 1 6 LEU n 1 7 ILE n 1 8 MET n 1 9 ARG n 1 10 GLY n 1 11 GLU n 1 12 GLY n 1 13 GLY n 1 14 ARG n 1 15 GLU n 1 16 PHE n 1 17 LEU n 1 18 ALA n 1 19 GLU n 1 20 ARG n 1 21 LEU n 1 22 ARG n 1 23 GLY n 1 24 GLN n 1 25 GLY n 1 26 VAL n 1 27 GLN n 1 28 VAL n 1 29 ASP n 1 30 TYR n 1 31 LEU n 1 32 PRO n 1 33 LEU n 1 34 ASP n 1 35 TYR n 1 36 PRO n 1 37 ALA n 1 38 GLY n 1 39 GLU n 1 40 LEU n 1 41 LEU n 1 42 ALA n 1 43 ARG n 1 44 VAL n 1 45 ARG n 1 46 ALA n 1 47 GLU n 1 48 ARG n 1 49 LEU n 1 50 ASN n 1 51 GLY n 1 52 LEU n 1 53 VAL n 1 54 VAL n 1 55 SER n 1 56 SER n 1 57 GLY n 1 58 GLN n 1 59 GLY n 1 60 LEU n 1 61 GLN n 1 62 ASN n 1 63 LEU n 1 64 TYR n 1 65 GLN n 1 66 LEU n 1 67 ALA n 1 68 ALA n 1 69 ALA n 1 70 ASP n 1 71 TRP n 1 72 PRO n 1 73 GLU n 1 74 ILE n 1 75 GLY n 1 76 ARG n 1 77 LEU n 1 78 PRO n 1 79 LEU n 1 80 PHE n 1 81 VAL n 1 82 PRO n 1 83 SER n 1 84 PRO n 1 85 ARG n 1 86 VAL n 1 87 ALA n 1 88 GLU n 1 89 MET n 1 90 ALA n 1 91 ARG n 1 92 GLU n 1 93 LEU n 1 94 GLY n 1 95 ALA n 1 96 GLN n 1 97 ARG n 1 98 VAL n 1 99 ILE n 1 100 ASP n 1 101 CYS n 1 102 ARG n 1 103 GLY n 1 104 ALA n 1 105 SER n 1 106 ALA n 1 107 PRO n 1 108 ALA n 1 109 LEU n 1 110 LEU n 1 111 ALA n 1 112 ALA n 1 113 LEU n 1 114 THR n 1 115 SER n 1 116 ALA n 1 117 ALA n 1 118 LEU n 1 119 GLU n 1 120 HIS n 1 121 HIS n 1 122 HIS n 1 123 HIS n 1 124 HIS n 1 125 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 125 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6TH8 _struct_ref.pdbx_db_accession 6TH8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6TH8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 125 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6TH8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 125 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 125 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCO' 1 isotropic 2 1 1 '3D HNCA' 2 isotropic 3 1 1 '3D H(CCO)NH' 1 isotropic 4 1 1 '3D HCCH-TOCSY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 1 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '29 mM [U-13C; U-15N] cU3Sd, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 15N,13C _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 800 ? # _pdbx_nmr_refine.entry_id 6TH8 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # _pdbx_nmr_ensemble.entry_id 6TH8 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 21 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6TH8 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 'chemical shift assignment' Sparky ? Goddard 3 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6TH8 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6TH8 _struct.title 'Reconstructing the Origins of the HemD-like fold' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6TH8 _struct_keywords.text 'protein design, HemD-like fold, flavodoxin-like fold, FLAVOPROTEIN' _struct_keywords.pdbx_keywords FLAVOPROTEIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 13 ? GLN A 24 ? GLY A 13 GLN A 24 1 ? 12 HELX_P HELX_P2 AA2 GLY A 38 ? ARG A 48 ? GLY A 38 ARG A 48 1 ? 11 HELX_P HELX_P3 AA3 SER A 56 ? ALA A 68 ? SER A 56 ALA A 68 1 ? 13 HELX_P HELX_P4 AA4 ASP A 70 ? GLY A 75 ? ASP A 70 GLY A 75 1 ? 6 HELX_P HELX_P5 AA5 SER A 83 ? GLY A 94 ? SER A 83 GLY A 94 1 ? 12 HELX_P HELX_P6 AA6 SER A 105 ? HIS A 124 ? SER A 105 HIS A 124 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 27 ? LEU A 31 ? GLN A 27 LEU A 31 AA1 2 LYS A 4 ? MET A 8 ? LYS A 4 MET A 8 AA1 3 GLY A 51 ? VAL A 53 ? GLY A 51 VAL A 53 AA1 4 LEU A 79 ? VAL A 81 ? LEU A 79 VAL A 81 AA1 5 VAL A 98 ? ASP A 100 ? VAL A 98 ASP A 100 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 31 ? O LEU A 31 N ILE A 7 ? N ILE A 7 AA1 2 3 N LEU A 6 ? N LEU A 6 O VAL A 53 ? O VAL A 53 AA1 3 4 N LEU A 52 ? N LEU A 52 O PHE A 80 ? O PHE A 80 AA1 4 5 N LEU A 79 ? N LEU A 79 O ILE A 99 ? O ILE A 99 # _atom_sites.entry_id 6TH8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 TRP 71 71 71 TRP TRP A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 HIS 125 125 125 HIS HIS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7680 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-11-27 2 'Structure model' 1 1 2019-12-11 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 2 'Structure model' '_citation_author.name' 7 3 'Structure model' '_database_2.pdbx_DOI' 8 3 'Structure model' '_database_2.pdbx_database_accession' 9 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component cU3Sd _pdbx_nmr_exptl_sample.concentration 29 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 68 ? ? 59.07 -143.74 2 2 ALA A 68 ? ? 59.51 -144.19 3 3 LEU A 33 ? ? -59.38 -9.35 4 3 ALA A 68 ? ? 59.51 -144.43 5 4 ALA A 68 ? ? 59.72 -144.16 6 5 ALA A 68 ? ? 59.37 -144.63 7 6 LEU A 33 ? ? -59.90 -9.31 8 6 ALA A 68 ? ? 58.96 -142.53 9 7 ALA A 68 ? ? 59.14 -143.85 10 8 PRO A 3 ? ? -49.98 151.51 11 8 ALA A 68 ? ? 59.45 -143.56 12 9 ALA A 68 ? ? 59.20 -143.93 13 9 HIS A 120 ? ? -160.03 -61.39 14 10 ALA A 68 ? ? 59.11 -143.72 15 10 HIS A 120 ? ? -143.05 -57.96 16 11 ALA A 68 ? ? 59.16 -143.30 17 12 PRO A 3 ? ? -49.87 152.31 18 12 ALA A 68 ? ? 59.28 -144.09 19 13 ALA A 68 ? ? 59.40 -143.99 20 14 ALA A 68 ? ? 58.83 -143.15 21 15 ALA A 68 ? ? 59.21 -143.54 22 16 ALA A 68 ? ? 59.13 -143.15 23 17 ALA A 68 ? ? 59.09 -142.81 24 18 ALA A 68 ? ? 58.88 -142.18 25 19 ALA A 68 ? ? 59.02 -142.89 26 20 ALA A 68 ? ? 58.95 -142.79 27 21 ALA A 68 ? ? 59.43 -143.25 # _pdbx_audit_support.funding_organization 'European Research Council' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 647548 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details ? #