data_6TID # _entry.id 6TID # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6TID pdb_00006tid 10.2210/pdb6tid/pdb WWPDB D_1292105532 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-01-22 2 'Structure model' 1 1 2020-01-29 3 'Structure model' 2 0 2020-07-29 4 'Structure model' 2 1 2024-01-24 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Structure summary' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 4 'Structure model' 'Derived calculations' 9 4 'Structure model' 'Refinement description' 10 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' atom_site 4 3 'Structure model' chem_comp 5 3 'Structure model' entity 6 3 'Structure model' entity_name_com 7 3 'Structure model' pdbx_branch_scheme 8 3 'Structure model' pdbx_chem_comp_identifier 9 3 'Structure model' pdbx_entity_branch 10 3 'Structure model' pdbx_entity_branch_descriptor 11 3 'Structure model' pdbx_entity_branch_link 12 3 'Structure model' pdbx_entity_branch_list 13 3 'Structure model' pdbx_entity_nonpoly 14 3 'Structure model' pdbx_molecule_features 15 3 'Structure model' pdbx_nonpoly_scheme 16 3 'Structure model' pdbx_struct_assembly_gen 17 3 'Structure model' pdbx_struct_special_symmetry 18 3 'Structure model' struct_asym 19 3 'Structure model' struct_conn 20 4 'Structure model' atom_type 21 4 'Structure model' chem_comp 22 4 'Structure model' chem_comp_atom 23 4 'Structure model' chem_comp_bond 24 4 'Structure model' database_2 25 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.identifier_ORCID' 11 2 'Structure model' '_citation_author.name' 12 3 'Structure model' '_atom_site.B_iso_or_equiv' 13 3 'Structure model' '_atom_site.Cartn_x' 14 3 'Structure model' '_atom_site.Cartn_y' 15 3 'Structure model' '_atom_site.Cartn_z' 16 3 'Structure model' '_atom_site.auth_asym_id' 17 3 'Structure model' '_atom_site.auth_atom_id' 18 3 'Structure model' '_atom_site.auth_comp_id' 19 3 'Structure model' '_atom_site.auth_seq_id' 20 3 'Structure model' '_atom_site.label_asym_id' 21 3 'Structure model' '_atom_site.label_atom_id' 22 3 'Structure model' '_atom_site.label_comp_id' 23 3 'Structure model' '_atom_site.label_entity_id' 24 3 'Structure model' '_atom_site.occupancy' 25 3 'Structure model' '_atom_site.type_symbol' 26 3 'Structure model' '_chem_comp.name' 27 3 'Structure model' '_chem_comp.type' 28 3 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 29 3 'Structure model' '_pdbx_struct_special_symmetry.label_asym_id' 30 3 'Structure model' '_struct_conn.pdbx_dist_value' 31 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 32 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 33 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 34 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 35 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 36 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 37 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 38 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 39 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 40 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 41 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 42 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 43 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 44 4 'Structure model' '_atom_type.pdbx_N_electrons' 45 4 'Structure model' '_atom_type.pdbx_scat_Z' 46 4 'Structure model' '_chem_comp.pdbx_synonyms' 47 4 'Structure model' '_database_2.pdbx_DOI' 48 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6TID _pdbx_database_status.recvd_initial_deposition_date 2019-11-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Varrot, A.' 1 0000-0001-6667-8162 'Bermeo, R.' 2 0000-0002-4451-878X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Molecules _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1420-3049 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 25 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'BC2L-C N-Terminal Lectin Domain Complexed with Histo Blood Group Oligosaccharides Provides New Structural Information.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/molecules25020248 _citation.pdbx_database_id_PubMed 31936166 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bermeo, R.' 1 ? primary 'Bernardi, A.' 2 ? primary 'Varrot, A.' 3 0000-0001-6667-8162 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Lectin 14010.936 1 ? ? ? ? 2 branched man 'alpha-L-fucopyranose-(1-2)-beta-D-galactopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose' 529.490 1 ? ? ? ? 3 water nat water 18.015 132 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name 'H type 1 antigen, beta anomer' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSS KVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSS KVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA ; _entity_poly.pdbx_strand_id AAA _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 PRO n 1 5 LEU n 1 6 LEU n 1 7 SER n 1 8 ALA n 1 9 SER n 1 10 ILE n 1 11 VAL n 1 12 SER n 1 13 ALA n 1 14 PRO n 1 15 VAL n 1 16 VAL n 1 17 THR n 1 18 SER n 1 19 GLU n 1 20 THR n 1 21 TYR n 1 22 VAL n 1 23 ASP n 1 24 ILE n 1 25 PRO n 1 26 GLY n 1 27 LEU n 1 28 TYR n 1 29 LEU n 1 30 ASP n 1 31 VAL n 1 32 ALA n 1 33 LYS n 1 34 ALA n 1 35 GLY n 1 36 ILE n 1 37 ARG n 1 38 ASP n 1 39 GLY n 1 40 LYS n 1 41 LEU n 1 42 GLN n 1 43 VAL n 1 44 ILE n 1 45 LEU n 1 46 ASN n 1 47 VAL n 1 48 PRO n 1 49 THR n 1 50 PRO n 1 51 TYR n 1 52 ALA n 1 53 THR n 1 54 GLY n 1 55 ASN n 1 56 ASN n 1 57 PHE n 1 58 PRO n 1 59 GLY n 1 60 ILE n 1 61 TYR n 1 62 PHE n 1 63 ALA n 1 64 ILE n 1 65 ALA n 1 66 THR n 1 67 ASN n 1 68 GLN n 1 69 GLY n 1 70 VAL n 1 71 VAL n 1 72 ALA n 1 73 ASP n 1 74 GLY n 1 75 CYS n 1 76 PHE n 1 77 THR n 1 78 TYR n 1 79 SER n 1 80 SER n 1 81 LYS n 1 82 VAL n 1 83 PRO n 1 84 GLU n 1 85 SER n 1 86 THR n 1 87 GLY n 1 88 ARG n 1 89 MET n 1 90 PRO n 1 91 PHE n 1 92 THR n 1 93 LEU n 1 94 VAL n 1 95 ALA n 1 96 THR n 1 97 ILE n 1 98 ASP n 1 99 VAL n 1 100 GLY n 1 101 SER n 1 102 GLY n 1 103 VAL n 1 104 THR n 1 105 PHE n 1 106 VAL n 1 107 LYS n 1 108 GLY n 1 109 GLN n 1 110 TRP n 1 111 LYS n 1 112 SER n 1 113 VAL n 1 114 ARG n 1 115 GLY n 1 116 SER n 1 117 ALA n 1 118 MET n 1 119 HIS n 1 120 ILE n 1 121 ASP n 1 122 SER n 1 123 TYR n 1 124 ALA n 1 125 SER n 1 126 LEU n 1 127 SER n 1 128 ALA n 1 129 ILE n 1 130 TRP n 1 131 GLY n 1 132 THR n 1 133 ALA n 1 134 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 134 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BCAM0185 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 216591 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant Star _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PcoldTF-TEV _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 LFucpa1-2DGalpb1-3DGlcpNAcb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/3,3,2/[a2122h-1b_1-5_2*NCC/3=O][a2112h-1b_1-5][a1221m-1a_1-5]/1-2-3/a3-b1_b2-c1' WURCS PDB2Glycan 1.1.0 3 2 '[][b-D-GlcpNAc]{[(3+1)][b-D-Galp]{[(2+1)][a-L-Fucp]{}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 GAL C1 O1 1 NAG O3 HO3 sing ? 2 2 3 FUC C1 O1 2 GAL O2 HO2 sing ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose 'alpha-L-fucose; 6-deoxy-alpha-L-galactopyranose; L-fucose; fucose' 'C6 H12 O5' 164.156 GAL 'D-saccharide, beta linking' . beta-D-galactopyranose 'beta-D-galactose; D-galactose; galactose' 'C6 H12 O6' 180.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 LFucpa FUC 'COMMON NAME' GMML 1.0 a-L-fucopyranose FUC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-L-Fucp FUC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Fuc GAL 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGalpb GAL 'COMMON NAME' GMML 1.0 b-D-galactopyranose GAL 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Galp GAL 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Gal NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 -2 GLY GLY AAA . n A 1 2 HIS 2 -1 -1 HIS HIS AAA . n A 1 3 MET 3 0 0 MET MET AAA . n A 1 4 PRO 4 1 1 PRO PRO AAA . n A 1 5 LEU 5 2 2 LEU LEU AAA . n A 1 6 LEU 6 3 3 LEU LEU AAA . n A 1 7 SER 7 4 4 SER SER AAA . n A 1 8 ALA 8 5 5 ALA ALA AAA . n A 1 9 SER 9 6 6 SER SER AAA . n A 1 10 ILE 10 7 7 ILE ILE AAA . n A 1 11 VAL 11 8 8 VAL VAL AAA . n A 1 12 SER 12 9 9 SER SER AAA . n A 1 13 ALA 13 10 10 ALA ALA AAA . n A 1 14 PRO 14 11 11 PRO PRO AAA . n A 1 15 VAL 15 12 12 VAL VAL AAA . n A 1 16 VAL 16 13 13 VAL VAL AAA . n A 1 17 THR 17 14 14 THR THR AAA . n A 1 18 SER 18 15 15 SER SER AAA . n A 1 19 GLU 19 16 16 GLU GLU AAA . n A 1 20 THR 20 17 17 THR THR AAA . n A 1 21 TYR 21 18 18 TYR TYR AAA . n A 1 22 VAL 22 19 19 VAL VAL AAA . n A 1 23 ASP 23 20 20 ASP ASP AAA . n A 1 24 ILE 24 21 21 ILE ILE AAA . n A 1 25 PRO 25 22 22 PRO PRO AAA . n A 1 26 GLY 26 23 23 GLY GLY AAA . n A 1 27 LEU 27 24 24 LEU LEU AAA . n A 1 28 TYR 28 25 25 TYR TYR AAA . n A 1 29 LEU 29 26 26 LEU LEU AAA . n A 1 30 ASP 30 27 27 ASP ASP AAA . n A 1 31 VAL 31 28 28 VAL VAL AAA . n A 1 32 ALA 32 29 29 ALA ALA AAA . n A 1 33 LYS 33 30 30 LYS LYS AAA . n A 1 34 ALA 34 31 ? ? ? AAA . n A 1 35 GLY 35 32 ? ? ? AAA . n A 1 36 ILE 36 33 33 ILE ILE AAA . n A 1 37 ARG 37 34 34 ARG ARG AAA . n A 1 38 ASP 38 35 35 ASP ASP AAA . n A 1 39 GLY 39 36 36 GLY GLY AAA . n A 1 40 LYS 40 37 37 LYS LYS AAA . n A 1 41 LEU 41 38 38 LEU LEU AAA . n A 1 42 GLN 42 39 39 GLN GLN AAA . n A 1 43 VAL 43 40 40 VAL VAL AAA . n A 1 44 ILE 44 41 41 ILE ILE AAA . n A 1 45 LEU 45 42 42 LEU LEU AAA . n A 1 46 ASN 46 43 43 ASN ASN AAA . n A 1 47 VAL 47 44 44 VAL VAL AAA . n A 1 48 PRO 48 45 45 PRO PRO AAA . n A 1 49 THR 49 46 46 THR THR AAA . n A 1 50 PRO 50 47 47 PRO PRO AAA . n A 1 51 TYR 51 48 48 TYR TYR AAA . n A 1 52 ALA 52 49 49 ALA ALA AAA . n A 1 53 THR 53 50 50 THR THR AAA . n A 1 54 GLY 54 51 51 GLY GLY AAA . n A 1 55 ASN 55 52 52 ASN ASN AAA . n A 1 56 ASN 56 53 53 ASN ASN AAA . n A 1 57 PHE 57 54 54 PHE PHE AAA . n A 1 58 PRO 58 55 55 PRO PRO AAA . n A 1 59 GLY 59 56 56 GLY GLY AAA . n A 1 60 ILE 60 57 57 ILE ILE AAA . n A 1 61 TYR 61 58 58 TYR TYR AAA . n A 1 62 PHE 62 59 59 PHE PHE AAA . n A 1 63 ALA 63 60 60 ALA ALA AAA . n A 1 64 ILE 64 61 61 ILE ILE AAA . n A 1 65 ALA 65 62 62 ALA ALA AAA . n A 1 66 THR 66 63 63 THR THR AAA . n A 1 67 ASN 67 64 64 ASN ASN AAA . n A 1 68 GLN 68 65 65 GLN GLN AAA . n A 1 69 GLY 69 66 66 GLY GLY AAA . n A 1 70 VAL 70 67 67 VAL VAL AAA . n A 1 71 VAL 71 68 68 VAL VAL AAA . n A 1 72 ALA 72 69 69 ALA ALA AAA . n A 1 73 ASP 73 70 70 ASP ASP AAA . n A 1 74 GLY 74 71 71 GLY GLY AAA . n A 1 75 CYS 75 72 72 CYS CYS AAA . n A 1 76 PHE 76 73 73 PHE PHE AAA . n A 1 77 THR 77 74 74 THR THR AAA . n A 1 78 TYR 78 75 75 TYR TYR AAA . n A 1 79 SER 79 76 76 SER SER AAA . n A 1 80 SER 80 77 77 SER SER AAA . n A 1 81 LYS 81 78 78 LYS LYS AAA . n A 1 82 VAL 82 79 79 VAL VAL AAA . n A 1 83 PRO 83 80 80 PRO PRO AAA . n A 1 84 GLU 84 81 81 GLU GLU AAA . n A 1 85 SER 85 82 82 SER SER AAA . n A 1 86 THR 86 83 83 THR THR AAA . n A 1 87 GLY 87 84 84 GLY GLY AAA . n A 1 88 ARG 88 85 85 ARG ARG AAA . n A 1 89 MET 89 86 86 MET MET AAA . n A 1 90 PRO 90 87 87 PRO PRO AAA . n A 1 91 PHE 91 88 88 PHE PHE AAA . n A 1 92 THR 92 89 89 THR THR AAA . n A 1 93 LEU 93 90 90 LEU LEU AAA . n A 1 94 VAL 94 91 91 VAL VAL AAA . n A 1 95 ALA 95 92 92 ALA ALA AAA . n A 1 96 THR 96 93 93 THR THR AAA . n A 1 97 ILE 97 94 94 ILE ILE AAA . n A 1 98 ASP 98 95 95 ASP ASP AAA . n A 1 99 VAL 99 96 96 VAL VAL AAA . n A 1 100 GLY 100 97 97 GLY GLY AAA . n A 1 101 SER 101 98 ? ? ? AAA . n A 1 102 GLY 102 99 99 GLY GLY AAA . n A 1 103 VAL 103 100 100 VAL VAL AAA . n A 1 104 THR 104 101 101 THR THR AAA . n A 1 105 PHE 105 102 102 PHE PHE AAA . n A 1 106 VAL 106 103 103 VAL VAL AAA . n A 1 107 LYS 107 104 104 LYS LYS AAA . n A 1 108 GLY 108 105 105 GLY GLY AAA . n A 1 109 GLN 109 106 106 GLN GLN AAA . n A 1 110 TRP 110 107 107 TRP TRP AAA . n A 1 111 LYS 111 108 108 LYS LYS AAA . n A 1 112 SER 112 109 109 SER SER AAA . n A 1 113 VAL 113 110 110 VAL VAL AAA . n A 1 114 ARG 114 111 111 ARG ARG AAA . n A 1 115 GLY 115 112 112 GLY GLY AAA . n A 1 116 SER 116 113 113 SER SER AAA . n A 1 117 ALA 117 114 114 ALA ALA AAA . n A 1 118 MET 118 115 115 MET MET AAA . n A 1 119 HIS 119 116 116 HIS HIS AAA . n A 1 120 ILE 120 117 117 ILE ILE AAA . n A 1 121 ASP 121 118 118 ASP ASP AAA . n A 1 122 SER 122 119 119 SER SER AAA . n A 1 123 TYR 123 120 120 TYR TYR AAA . n A 1 124 ALA 124 121 121 ALA ALA AAA . n A 1 125 SER 125 122 122 SER SER AAA . n A 1 126 LEU 126 123 123 LEU LEU AAA . n A 1 127 SER 127 124 124 SER SER AAA . n A 1 128 ALA 128 125 125 ALA ALA AAA . n A 1 129 ILE 129 126 126 ILE ILE AAA . n A 1 130 TRP 130 127 127 TRP TRP AAA . n A 1 131 GLY 131 128 128 GLY GLY AAA . n A 1 132 THR 132 129 129 THR THR AAA . n A 1 133 ALA 133 130 130 ALA ALA AAA . n A 1 134 ALA 134 131 131 ALA ALA AAA . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 A NAG 1 AcA NAG 203 n B 2 GAL 2 A GAL 2 AbA GAL 202 n B 2 FUC 3 A FUC 3 AaA FUC 201 n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 301 15 HOH HOH AAA . C 3 HOH 2 302 111 HOH HOH AAA . C 3 HOH 3 303 69 HOH HOH AAA . C 3 HOH 4 304 88 HOH HOH AAA . C 3 HOH 5 305 58 HOH HOH AAA . C 3 HOH 6 306 132 HOH HOH AAA . C 3 HOH 7 307 63 HOH HOH AAA . C 3 HOH 8 308 115 HOH HOH AAA . C 3 HOH 9 309 82 HOH HOH AAA . C 3 HOH 10 310 100 HOH HOH AAA . C 3 HOH 11 311 101 HOH HOH AAA . C 3 HOH 12 312 61 HOH HOH AAA . C 3 HOH 13 313 24 HOH HOH AAA . C 3 HOH 14 314 90 HOH HOH AAA . C 3 HOH 15 315 16 HOH HOH AAA . C 3 HOH 16 316 71 HOH HOH AAA . C 3 HOH 17 317 37 HOH HOH AAA . C 3 HOH 18 318 29 HOH HOH AAA . C 3 HOH 19 319 91 HOH HOH AAA . C 3 HOH 20 320 9 HOH HOH AAA . C 3 HOH 21 321 70 HOH HOH AAA . C 3 HOH 22 322 98 HOH HOH AAA . C 3 HOH 23 323 17 HOH HOH AAA . C 3 HOH 24 324 5 HOH HOH AAA . C 3 HOH 25 325 26 HOH HOH AAA . C 3 HOH 26 326 27 HOH HOH AAA . C 3 HOH 27 327 92 HOH HOH AAA . C 3 HOH 28 328 12 HOH HOH AAA . C 3 HOH 29 329 51 HOH HOH AAA . C 3 HOH 30 330 23 HOH HOH AAA . C 3 HOH 31 331 47 HOH HOH AAA . C 3 HOH 32 332 8 HOH HOH AAA . C 3 HOH 33 333 36 HOH HOH AAA . C 3 HOH 34 334 40 HOH HOH AAA . C 3 HOH 35 335 19 HOH HOH AAA . C 3 HOH 36 336 10 HOH HOH AAA . C 3 HOH 37 337 33 HOH HOH AAA . C 3 HOH 38 338 43 HOH HOH AAA . C 3 HOH 39 339 124 HOH HOH AAA . C 3 HOH 40 340 114 HOH HOH AAA . C 3 HOH 41 341 64 HOH HOH AAA . C 3 HOH 42 342 60 HOH HOH AAA . C 3 HOH 43 343 56 HOH HOH AAA . C 3 HOH 44 344 3 HOH HOH AAA . C 3 HOH 45 345 106 HOH HOH AAA . C 3 HOH 46 346 80 HOH HOH AAA . C 3 HOH 47 347 7 HOH HOH AAA . C 3 HOH 48 348 20 HOH HOH AAA . C 3 HOH 49 349 46 HOH HOH AAA . C 3 HOH 50 350 126 HOH HOH AAA . C 3 HOH 51 351 35 HOH HOH AAA . C 3 HOH 52 352 83 HOH HOH AAA . C 3 HOH 53 353 110 HOH HOH AAA . C 3 HOH 54 354 32 HOH HOH AAA . C 3 HOH 55 355 6 HOH HOH AAA . C 3 HOH 56 356 4 HOH HOH AAA . C 3 HOH 57 357 11 HOH HOH AAA . C 3 HOH 58 358 78 HOH HOH AAA . C 3 HOH 59 359 14 HOH HOH AAA . C 3 HOH 60 360 65 HOH HOH AAA . C 3 HOH 61 361 53 HOH HOH AAA . C 3 HOH 62 362 50 HOH HOH AAA . C 3 HOH 63 363 45 HOH HOH AAA . C 3 HOH 64 364 84 HOH HOH AAA . C 3 HOH 65 365 21 HOH HOH AAA . C 3 HOH 66 366 72 HOH HOH AAA . C 3 HOH 67 367 62 HOH HOH AAA . C 3 HOH 68 368 85 HOH HOH AAA . C 3 HOH 69 369 52 HOH HOH AAA . C 3 HOH 70 370 28 HOH HOH AAA . C 3 HOH 71 371 54 HOH HOH AAA . C 3 HOH 72 372 86 HOH HOH AAA . C 3 HOH 73 373 57 HOH HOH AAA . C 3 HOH 74 374 105 HOH HOH AAA . C 3 HOH 75 375 128 HOH HOH AAA . C 3 HOH 76 376 55 HOH HOH AAA . C 3 HOH 77 377 125 HOH HOH AAA . C 3 HOH 78 378 18 HOH HOH AAA . C 3 HOH 79 379 67 HOH HOH AAA . C 3 HOH 80 380 2 HOH HOH AAA . C 3 HOH 81 381 42 HOH HOH AAA . C 3 HOH 82 382 44 HOH HOH AAA . C 3 HOH 83 383 68 HOH HOH AAA . C 3 HOH 84 384 1 HOH HOH AAA . C 3 HOH 85 385 39 HOH HOH AAA . C 3 HOH 86 386 48 HOH HOH AAA . C 3 HOH 87 387 74 HOH HOH AAA . C 3 HOH 88 388 87 HOH HOH AAA . C 3 HOH 89 389 38 HOH HOH AAA . C 3 HOH 90 390 30 HOH HOH AAA . C 3 HOH 91 391 31 HOH HOH AAA . C 3 HOH 92 392 117 HOH HOH AAA . C 3 HOH 93 393 89 HOH HOH AAA . C 3 HOH 94 394 73 HOH HOH AAA . C 3 HOH 95 395 25 HOH HOH AAA . C 3 HOH 96 396 49 HOH HOH AAA . C 3 HOH 97 397 41 HOH HOH AAA . C 3 HOH 98 398 99 HOH HOH AAA . C 3 HOH 99 399 129 HOH HOH AAA . C 3 HOH 100 400 13 HOH HOH AAA . C 3 HOH 101 401 79 HOH HOH AAA . C 3 HOH 102 402 22 HOH HOH AAA . C 3 HOH 103 403 77 HOH HOH AAA . C 3 HOH 104 404 59 HOH HOH AAA . C 3 HOH 105 405 66 HOH HOH AAA . C 3 HOH 106 406 76 HOH HOH AAA . C 3 HOH 107 407 75 HOH HOH AAA . C 3 HOH 108 408 118 HOH HOH AAA . C 3 HOH 109 409 95 HOH HOH AAA . C 3 HOH 110 410 34 HOH HOH AAA . C 3 HOH 111 411 97 HOH HOH AAA . C 3 HOH 112 412 131 HOH HOH AAA . C 3 HOH 113 413 112 HOH HOH AAA . C 3 HOH 114 414 93 HOH HOH AAA . C 3 HOH 115 415 123 HOH HOH AAA . C 3 HOH 116 416 81 HOH HOH AAA . C 3 HOH 117 417 120 HOH HOH AAA . C 3 HOH 118 418 116 HOH HOH AAA . C 3 HOH 119 419 113 HOH HOH AAA . C 3 HOH 120 420 119 HOH HOH AAA . C 3 HOH 121 421 121 HOH HOH AAA . C 3 HOH 122 422 127 HOH HOH AAA . C 3 HOH 123 423 107 HOH HOH AAA . C 3 HOH 124 424 94 HOH HOH AAA . C 3 HOH 125 425 109 HOH HOH AAA . C 3 HOH 126 426 130 HOH HOH AAA . C 3 HOH 127 427 102 HOH HOH AAA . C 3 HOH 128 428 96 HOH HOH AAA . C 3 HOH 129 429 103 HOH HOH AAA . C 3 HOH 130 430 104 HOH HOH AAA . C 3 HOH 131 431 122 HOH HOH AAA . C 3 HOH 132 432 108 HOH HOH AAA . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 AAA LYS 30 ? CG ? A LYS 33 CG 2 1 Y 1 AAA LYS 30 ? CD ? A LYS 33 CD 3 1 Y 1 AAA LYS 30 ? CE ? A LYS 33 CE 4 1 Y 1 AAA LYS 30 ? NZ ? A LYS 33 NZ 5 1 Y 1 AAA ASN 52 ? ND2 ? A ASN 55 ND2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0257 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.3 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.2 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6TID _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.696 _cell.length_a_esd ? _cell.length_b 42.696 _cell.length_b_esd ? _cell.length_c 308.584 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6TID _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6TID _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.97 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 37.45 _exptl_crystal.description 'Thick square' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;1.2 M Na citrate pH 7.0 cryoprotected in 2.5 M sodium malonate ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-10-26 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98096 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE BM30A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98096 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BM30A _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 18.4 _reflns.entry_id 6TID _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.61 _reflns.d_resolution_low 36.71 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14606 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.8 _reflns.pdbx_Rmerge_I_obs 0.049 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.056 _reflns.pdbx_Rpim_I_all 0.027 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.61 _reflns_shell.d_res_low 1.64 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 712 _reflns_shell.percent_possible_all 97.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.588 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.643 _reflns_shell.pdbx_Rpim_I_all 0.320 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.874 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.186 _refine.aniso_B[1][2] -0.093 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -0.186 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 0.603 _refine.B_iso_max ? _refine.B_iso_mean 18.654 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.970 _refine.correlation_coeff_Fo_to_Fc_free 0.955 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6TID _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.614 _refine.ls_d_res_low 36.71 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14605 _refine.ls_number_reflns_R_free 751 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.652 _refine.ls_percent_reflns_R_free 5.142 _refine.ls_R_factor_all 0.161 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2027 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1583 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2wq4 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.093 _refine.pdbx_overall_ESU_R_Free 0.097 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.606 _refine.overall_SU_ML 0.057 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 967 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 36 _refine_hist.number_atoms_solvent 132 _refine_hist.number_atoms_total 1135 _refine_hist.d_res_high 1.614 _refine_hist.d_res_low 36.71 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 0.013 1056 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 971 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.779 1.691 1454 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.555 1.612 2257 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 8.033 5.000 134 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.225 22.500 36 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.052 15.000 146 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 13.944 15.000 3 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.099 0.200 159 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 1158 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 208 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.208 0.200 148 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.196 0.200 859 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.179 0.200 517 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.092 0.200 488 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.163 0.200 87 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.151 0.200 13 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.173 0.200 84 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.196 0.200 37 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 1.789 1.842 537 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.782 1.836 536 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.526 2.732 672 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.526 2.739 673 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.285 2.024 519 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.283 2.024 520 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 3.389 2.976 782 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.387 2.976 783 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.047 22.799 1113 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 4.897 22.238 1091 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.614 1.656 1060 . 51 999 99.0566 . 0.237 . 0.344 . 0.231 . . . . . 0.231 . 20 . 0.929 0.900 'X-RAY DIFFRACTION' 1.656 1.701 1030 . 46 983 99.9029 . 0.196 . 0.265 . 0.193 . . . . . 0.193 . 20 . 0.949 0.928 'X-RAY DIFFRACTION' 1.701 1.751 988 . 68 920 100.0000 . 0.179 . 0.230 . 0.176 . . . . . 0.176 . 20 . 0.956 0.944 'X-RAY DIFFRACTION' 1.751 1.804 985 . 55 929 99.8985 . 0.177 . 0.258 . 0.172 . . . . . 0.172 . 20 . 0.951 0.925 'X-RAY DIFFRACTION' 1.804 1.863 950 . 49 900 99.8947 . 0.171 . 0.234 . 0.167 . . . . . 0.167 . 20 . 0.955 0.940 'X-RAY DIFFRACTION' 1.863 1.929 912 . 44 868 100.0000 . 0.169 . 0.238 . 0.166 . . . . . 0.166 . 20 . 0.958 0.943 'X-RAY DIFFRACTION' 1.929 2.001 895 . 37 858 100.0000 . 0.176 . 0.198 . 0.175 . . . . . 0.175 . 20 . 0.957 0.946 'X-RAY DIFFRACTION' 2.001 2.083 842 . 48 791 99.6437 . 0.167 . 0.225 . 0.164 . . . . . 0.164 . 20 . 0.965 0.949 'X-RAY DIFFRACTION' 2.083 2.175 832 . 36 794 99.7596 . 0.161 . 0.167 . 0.161 . . . . . 0.161 . 20 . 0.966 0.964 'X-RAY DIFFRACTION' 2.175 2.281 778 . 31 747 100.0000 . 0.147 . 0.194 . 0.145 . . . . . 0.145 . 20 . 0.972 0.960 'X-RAY DIFFRACTION' 2.281 2.404 768 . 41 725 99.7396 . 0.153 . 0.171 . 0.152 . . . . . 0.152 . 20 . 0.970 0.971 'X-RAY DIFFRACTION' 2.404 2.549 716 . 42 673 99.8603 . 0.160 . 0.223 . 0.156 . . . . . 0.156 . 20 . 0.964 0.949 'X-RAY DIFFRACTION' 2.549 2.724 671 . 47 623 99.8510 . 0.168 . 0.199 . 0.166 . . . . . 0.166 . 20 . 0.963 0.959 'X-RAY DIFFRACTION' 2.724 2.941 631 . 37 591 99.5246 . 0.153 . 0.185 . 0.151 . . . . . 0.151 . 20 . 0.967 0.958 'X-RAY DIFFRACTION' 2.941 3.219 597 . 28 568 99.8325 . 0.154 . 0.194 . 0.151 . . . . . 0.151 . 20 . 0.964 0.956 'X-RAY DIFFRACTION' 3.219 3.596 538 . 26 506 98.8848 . 0.150 . 0.231 . 0.146 . . . . . 0.146 . 20 . 0.971 0.955 'X-RAY DIFFRACTION' 3.596 4.146 481 . 22 457 99.5842 . 0.128 . 0.124 . 0.128 . . . . . 0.128 . 20 . 0.977 0.982 'X-RAY DIFFRACTION' 4.146 5.061 415 . 20 394 99.7590 . 0.107 . 0.110 . 0.107 . . . . . 0.107 . 20 . 0.988 0.986 'X-RAY DIFFRACTION' 5.061 7.090 345 . 15 329 99.7101 . 0.176 . 0.276 . 0.172 . . . . . 0.172 . 20 . 0.975 0.973 'X-RAY DIFFRACTION' 7.090 36.713 217 . 8 198 94.9309 . 0.275 . 0.293 . 0.274 . . . . . 0.274 . 20 . 0.931 0.940 # _struct.entry_id 6TID _struct.title 'Structure of the N terminal domain of Bc2L-C lectin (1-131) in complex with H-type 1 antigen' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6TID _struct_keywords.text 'Lectin, TNF-like, fucosylated antigen, SUGAR BINDING PROTEIN' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B4EH86_BURCJ _struct_ref.pdbx_db_accession B4EH86 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKV PESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6TID _struct_ref_seq.pdbx_strand_id AAA _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 134 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B4EH86 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 132 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 131 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6TID GLY AAA 1 ? UNP B4EH86 ? ? 'expression tag' -2 1 1 6TID HIS AAA 2 ? UNP B4EH86 ? ? 'expression tag' -1 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9340 ? 1 MORE 3 ? 1 'SSA (A^2)' 13700 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 21.3480000000 0.8660254038 -0.5000000000 0.0000000000 36.9758206400 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_565 -x+y,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -21.3480000000 -0.8660254038 -0.5000000000 0.0000000000 36.9758206400 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B NAG . O3 ? ? ? 1_555 B GAL . C1 ? ? A NAG 1 A GAL 2 1_555 ? ? ? ? ? ? ? 1.365 ? ? covale2 covale both ? B GAL . O2 ? ? ? 1_555 B FUC . C1 ? ? A GAL 2 A FUC 3 1_555 ? ? ? ? ? ? ? 1.437 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 5 ? ILE A 10 ? LEU AAA 2 ILE AAA 7 AA1 2 ALA A 124 ? GLY A 131 ? ALA AAA 121 GLY AAA 128 AA1 3 LYS A 40 ? VAL A 47 ? LYS AAA 37 VAL AAA 44 AA1 4 PHE A 91 ? ASP A 98 ? PHE AAA 88 ASP AAA 95 AA2 1 VAL A 22 ? ASP A 30 ? VAL AAA 19 ASP AAA 27 AA2 2 PHE A 105 ? VAL A 113 ? PHE AAA 102 VAL AAA 110 AA2 3 GLY A 59 ? THR A 66 ? GLY AAA 56 THR AAA 63 AA2 4 GLY A 69 ? THR A 77 ? GLY AAA 66 THR AAA 74 AA3 1 TYR A 51 ? THR A 53 ? TYR AAA 48 THR AAA 50 AA3 2 ALA A 117 ? HIS A 119 ? ALA AAA 114 HIS AAA 116 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 6 ? N LEU AAA 3 O ALA A 128 ? O ALA AAA 125 AA1 2 3 O SER A 125 ? O SER AAA 122 N ASN A 46 ? N ASN AAA 43 AA1 3 4 N VAL A 43 ? N VAL AAA 40 O ALA A 95 ? O ALA AAA 92 AA2 1 2 N LEU A 29 ? N LEU AAA 26 O VAL A 106 ? O VAL AAA 103 AA2 2 3 O LYS A 111 ? O LYS AAA 108 N TYR A 61 ? N TYR AAA 58 AA2 3 4 N PHE A 62 ? N PHE AAA 59 O GLY A 74 ? O GLY AAA 71 AA3 1 2 N THR A 53 ? N THR AAA 50 O ALA A 117 ? O ALA AAA 114 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 ND2 _pdbx_validate_close_contact.auth_asym_id_1 AAA _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 64 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OG1 _pdbx_validate_close_contact.auth_asym_id_2 AAA _pdbx_validate_close_contact.auth_comp_id_2 THR _pdbx_validate_close_contact.auth_seq_id_2 101 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # _pdbx_molecule_features.prd_id PRD_900049 _pdbx_molecule_features.name 'H type 1 antigen, beta anomer' _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class Antigen _pdbx_molecule_features.details oligosaccharide # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_900049 _pdbx_molecule.asym_id B # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 AAA HOH 301 ? C HOH . 2 1 AAA HOH 313 ? C HOH . 3 1 AAA HOH 395 ? C HOH . 4 1 AAA HOH 416 ? C HOH . 5 1 AAA HOH 418 ? C HOH . 6 1 AAA HOH 425 ? C HOH . # _pdbx_entry_details.entry_id 6TID _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AAA ALA 31 ? A ALA 34 2 1 Y 1 AAA GLY 32 ? A GLY 35 3 1 Y 1 AAA SER 98 ? A SER 101 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FUC C1 C N R 88 FUC C2 C N S 89 FUC C3 C N R 90 FUC C4 C N S 91 FUC C5 C N S 92 FUC C6 C N N 93 FUC O1 O N N 94 FUC O2 O N N 95 FUC O3 O N N 96 FUC O4 O N N 97 FUC O5 O N N 98 FUC H1 H N N 99 FUC H2 H N N 100 FUC H3 H N N 101 FUC H4 H N N 102 FUC H5 H N N 103 FUC H61 H N N 104 FUC H62 H N N 105 FUC H63 H N N 106 FUC HO1 H N N 107 FUC HO2 H N N 108 FUC HO3 H N N 109 FUC HO4 H N N 110 GAL C1 C N R 111 GAL C2 C N R 112 GAL C3 C N S 113 GAL C4 C N R 114 GAL C5 C N R 115 GAL C6 C N N 116 GAL O1 O N N 117 GAL O2 O N N 118 GAL O3 O N N 119 GAL O4 O N N 120 GAL O5 O N N 121 GAL O6 O N N 122 GAL H1 H N N 123 GAL H2 H N N 124 GAL H3 H N N 125 GAL H4 H N N 126 GAL H5 H N N 127 GAL H61 H N N 128 GAL H62 H N N 129 GAL HO1 H N N 130 GAL HO2 H N N 131 GAL HO3 H N N 132 GAL HO4 H N N 133 GAL HO6 H N N 134 GLN N N N N 135 GLN CA C N S 136 GLN C C N N 137 GLN O O N N 138 GLN CB C N N 139 GLN CG C N N 140 GLN CD C N N 141 GLN OE1 O N N 142 GLN NE2 N N N 143 GLN OXT O N N 144 GLN H H N N 145 GLN H2 H N N 146 GLN HA H N N 147 GLN HB2 H N N 148 GLN HB3 H N N 149 GLN HG2 H N N 150 GLN HG3 H N N 151 GLN HE21 H N N 152 GLN HE22 H N N 153 GLN HXT H N N 154 GLU N N N N 155 GLU CA C N S 156 GLU C C N N 157 GLU O O N N 158 GLU CB C N N 159 GLU CG C N N 160 GLU CD C N N 161 GLU OE1 O N N 162 GLU OE2 O N N 163 GLU OXT O N N 164 GLU H H N N 165 GLU H2 H N N 166 GLU HA H N N 167 GLU HB2 H N N 168 GLU HB3 H N N 169 GLU HG2 H N N 170 GLU HG3 H N N 171 GLU HE2 H N N 172 GLU HXT H N N 173 GLY N N N N 174 GLY CA C N N 175 GLY C C N N 176 GLY O O N N 177 GLY OXT O N N 178 GLY H H N N 179 GLY H2 H N N 180 GLY HA2 H N N 181 GLY HA3 H N N 182 GLY HXT H N N 183 HIS N N N N 184 HIS CA C N S 185 HIS C C N N 186 HIS O O N N 187 HIS CB C N N 188 HIS CG C Y N 189 HIS ND1 N Y N 190 HIS CD2 C Y N 191 HIS CE1 C Y N 192 HIS NE2 N Y N 193 HIS OXT O N N 194 HIS H H N N 195 HIS H2 H N N 196 HIS HA H N N 197 HIS HB2 H N N 198 HIS HB3 H N N 199 HIS HD1 H N N 200 HIS HD2 H N N 201 HIS HE1 H N N 202 HIS HE2 H N N 203 HIS HXT H N N 204 HOH O O N N 205 HOH H1 H N N 206 HOH H2 H N N 207 ILE N N N N 208 ILE CA C N S 209 ILE C C N N 210 ILE O O N N 211 ILE CB C N S 212 ILE CG1 C N N 213 ILE CG2 C N N 214 ILE CD1 C N N 215 ILE OXT O N N 216 ILE H H N N 217 ILE H2 H N N 218 ILE HA H N N 219 ILE HB H N N 220 ILE HG12 H N N 221 ILE HG13 H N N 222 ILE HG21 H N N 223 ILE HG22 H N N 224 ILE HG23 H N N 225 ILE HD11 H N N 226 ILE HD12 H N N 227 ILE HD13 H N N 228 ILE HXT H N N 229 LEU N N N N 230 LEU CA C N S 231 LEU C C N N 232 LEU O O N N 233 LEU CB C N N 234 LEU CG C N N 235 LEU CD1 C N N 236 LEU CD2 C N N 237 LEU OXT O N N 238 LEU H H N N 239 LEU H2 H N N 240 LEU HA H N N 241 LEU HB2 H N N 242 LEU HB3 H N N 243 LEU HG H N N 244 LEU HD11 H N N 245 LEU HD12 H N N 246 LEU HD13 H N N 247 LEU HD21 H N N 248 LEU HD22 H N N 249 LEU HD23 H N N 250 LEU HXT H N N 251 LYS N N N N 252 LYS CA C N S 253 LYS C C N N 254 LYS O O N N 255 LYS CB C N N 256 LYS CG C N N 257 LYS CD C N N 258 LYS CE C N N 259 LYS NZ N N N 260 LYS OXT O N N 261 LYS H H N N 262 LYS H2 H N N 263 LYS HA H N N 264 LYS HB2 H N N 265 LYS HB3 H N N 266 LYS HG2 H N N 267 LYS HG3 H N N 268 LYS HD2 H N N 269 LYS HD3 H N N 270 LYS HE2 H N N 271 LYS HE3 H N N 272 LYS HZ1 H N N 273 LYS HZ2 H N N 274 LYS HZ3 H N N 275 LYS HXT H N N 276 MET N N N N 277 MET CA C N S 278 MET C C N N 279 MET O O N N 280 MET CB C N N 281 MET CG C N N 282 MET SD S N N 283 MET CE C N N 284 MET OXT O N N 285 MET H H N N 286 MET H2 H N N 287 MET HA H N N 288 MET HB2 H N N 289 MET HB3 H N N 290 MET HG2 H N N 291 MET HG3 H N N 292 MET HE1 H N N 293 MET HE2 H N N 294 MET HE3 H N N 295 MET HXT H N N 296 NAG C1 C N R 297 NAG C2 C N R 298 NAG C3 C N R 299 NAG C4 C N S 300 NAG C5 C N R 301 NAG C6 C N N 302 NAG C7 C N N 303 NAG C8 C N N 304 NAG N2 N N N 305 NAG O1 O N N 306 NAG O3 O N N 307 NAG O4 O N N 308 NAG O5 O N N 309 NAG O6 O N N 310 NAG O7 O N N 311 NAG H1 H N N 312 NAG H2 H N N 313 NAG H3 H N N 314 NAG H4 H N N 315 NAG H5 H N N 316 NAG H61 H N N 317 NAG H62 H N N 318 NAG H81 H N N 319 NAG H82 H N N 320 NAG H83 H N N 321 NAG HN2 H N N 322 NAG HO1 H N N 323 NAG HO3 H N N 324 NAG HO4 H N N 325 NAG HO6 H N N 326 PHE N N N N 327 PHE CA C N S 328 PHE C C N N 329 PHE O O N N 330 PHE CB C N N 331 PHE CG C Y N 332 PHE CD1 C Y N 333 PHE CD2 C Y N 334 PHE CE1 C Y N 335 PHE CE2 C Y N 336 PHE CZ C Y N 337 PHE OXT O N N 338 PHE H H N N 339 PHE H2 H N N 340 PHE HA H N N 341 PHE HB2 H N N 342 PHE HB3 H N N 343 PHE HD1 H N N 344 PHE HD2 H N N 345 PHE HE1 H N N 346 PHE HE2 H N N 347 PHE HZ H N N 348 PHE HXT H N N 349 PRO N N N N 350 PRO CA C N S 351 PRO C C N N 352 PRO O O N N 353 PRO CB C N N 354 PRO CG C N N 355 PRO CD C N N 356 PRO OXT O N N 357 PRO H H N N 358 PRO HA H N N 359 PRO HB2 H N N 360 PRO HB3 H N N 361 PRO HG2 H N N 362 PRO HG3 H N N 363 PRO HD2 H N N 364 PRO HD3 H N N 365 PRO HXT H N N 366 SER N N N N 367 SER CA C N S 368 SER C C N N 369 SER O O N N 370 SER CB C N N 371 SER OG O N N 372 SER OXT O N N 373 SER H H N N 374 SER H2 H N N 375 SER HA H N N 376 SER HB2 H N N 377 SER HB3 H N N 378 SER HG H N N 379 SER HXT H N N 380 THR N N N N 381 THR CA C N S 382 THR C C N N 383 THR O O N N 384 THR CB C N R 385 THR OG1 O N N 386 THR CG2 C N N 387 THR OXT O N N 388 THR H H N N 389 THR H2 H N N 390 THR HA H N N 391 THR HB H N N 392 THR HG1 H N N 393 THR HG21 H N N 394 THR HG22 H N N 395 THR HG23 H N N 396 THR HXT H N N 397 TRP N N N N 398 TRP CA C N S 399 TRP C C N N 400 TRP O O N N 401 TRP CB C N N 402 TRP CG C Y N 403 TRP CD1 C Y N 404 TRP CD2 C Y N 405 TRP NE1 N Y N 406 TRP CE2 C Y N 407 TRP CE3 C Y N 408 TRP CZ2 C Y N 409 TRP CZ3 C Y N 410 TRP CH2 C Y N 411 TRP OXT O N N 412 TRP H H N N 413 TRP H2 H N N 414 TRP HA H N N 415 TRP HB2 H N N 416 TRP HB3 H N N 417 TRP HD1 H N N 418 TRP HE1 H N N 419 TRP HE3 H N N 420 TRP HZ2 H N N 421 TRP HZ3 H N N 422 TRP HH2 H N N 423 TRP HXT H N N 424 TYR N N N N 425 TYR CA C N S 426 TYR C C N N 427 TYR O O N N 428 TYR CB C N N 429 TYR CG C Y N 430 TYR CD1 C Y N 431 TYR CD2 C Y N 432 TYR CE1 C Y N 433 TYR CE2 C Y N 434 TYR CZ C Y N 435 TYR OH O N N 436 TYR OXT O N N 437 TYR H H N N 438 TYR H2 H N N 439 TYR HA H N N 440 TYR HB2 H N N 441 TYR HB3 H N N 442 TYR HD1 H N N 443 TYR HD2 H N N 444 TYR HE1 H N N 445 TYR HE2 H N N 446 TYR HH H N N 447 TYR HXT H N N 448 VAL N N N N 449 VAL CA C N S 450 VAL C C N N 451 VAL O O N N 452 VAL CB C N N 453 VAL CG1 C N N 454 VAL CG2 C N N 455 VAL OXT O N N 456 VAL H H N N 457 VAL H2 H N N 458 VAL HA H N N 459 VAL HB H N N 460 VAL HG11 H N N 461 VAL HG12 H N N 462 VAL HG13 H N N 463 VAL HG21 H N N 464 VAL HG22 H N N 465 VAL HG23 H N N 466 VAL HXT H N N 467 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FUC C1 C2 sing N N 83 FUC C1 O1 sing N N 84 FUC C1 O5 sing N N 85 FUC C1 H1 sing N N 86 FUC C2 C3 sing N N 87 FUC C2 O2 sing N N 88 FUC C2 H2 sing N N 89 FUC C3 C4 sing N N 90 FUC C3 O3 sing N N 91 FUC C3 H3 sing N N 92 FUC C4 C5 sing N N 93 FUC C4 O4 sing N N 94 FUC C4 H4 sing N N 95 FUC C5 C6 sing N N 96 FUC C5 O5 sing N N 97 FUC C5 H5 sing N N 98 FUC C6 H61 sing N N 99 FUC C6 H62 sing N N 100 FUC C6 H63 sing N N 101 FUC O1 HO1 sing N N 102 FUC O2 HO2 sing N N 103 FUC O3 HO3 sing N N 104 FUC O4 HO4 sing N N 105 GAL C1 C2 sing N N 106 GAL C1 O1 sing N N 107 GAL C1 O5 sing N N 108 GAL C1 H1 sing N N 109 GAL C2 C3 sing N N 110 GAL C2 O2 sing N N 111 GAL C2 H2 sing N N 112 GAL C3 C4 sing N N 113 GAL C3 O3 sing N N 114 GAL C3 H3 sing N N 115 GAL C4 C5 sing N N 116 GAL C4 O4 sing N N 117 GAL C4 H4 sing N N 118 GAL C5 C6 sing N N 119 GAL C5 O5 sing N N 120 GAL C5 H5 sing N N 121 GAL C6 O6 sing N N 122 GAL C6 H61 sing N N 123 GAL C6 H62 sing N N 124 GAL O1 HO1 sing N N 125 GAL O2 HO2 sing N N 126 GAL O3 HO3 sing N N 127 GAL O4 HO4 sing N N 128 GAL O6 HO6 sing N N 129 GLN N CA sing N N 130 GLN N H sing N N 131 GLN N H2 sing N N 132 GLN CA C sing N N 133 GLN CA CB sing N N 134 GLN CA HA sing N N 135 GLN C O doub N N 136 GLN C OXT sing N N 137 GLN CB CG sing N N 138 GLN CB HB2 sing N N 139 GLN CB HB3 sing N N 140 GLN CG CD sing N N 141 GLN CG HG2 sing N N 142 GLN CG HG3 sing N N 143 GLN CD OE1 doub N N 144 GLN CD NE2 sing N N 145 GLN NE2 HE21 sing N N 146 GLN NE2 HE22 sing N N 147 GLN OXT HXT sing N N 148 GLU N CA sing N N 149 GLU N H sing N N 150 GLU N H2 sing N N 151 GLU CA C sing N N 152 GLU CA CB sing N N 153 GLU CA HA sing N N 154 GLU C O doub N N 155 GLU C OXT sing N N 156 GLU CB CG sing N N 157 GLU CB HB2 sing N N 158 GLU CB HB3 sing N N 159 GLU CG CD sing N N 160 GLU CG HG2 sing N N 161 GLU CG HG3 sing N N 162 GLU CD OE1 doub N N 163 GLU CD OE2 sing N N 164 GLU OE2 HE2 sing N N 165 GLU OXT HXT sing N N 166 GLY N CA sing N N 167 GLY N H sing N N 168 GLY N H2 sing N N 169 GLY CA C sing N N 170 GLY CA HA2 sing N N 171 GLY CA HA3 sing N N 172 GLY C O doub N N 173 GLY C OXT sing N N 174 GLY OXT HXT sing N N 175 HIS N CA sing N N 176 HIS N H sing N N 177 HIS N H2 sing N N 178 HIS CA C sing N N 179 HIS CA CB sing N N 180 HIS CA HA sing N N 181 HIS C O doub N N 182 HIS C OXT sing N N 183 HIS CB CG sing N N 184 HIS CB HB2 sing N N 185 HIS CB HB3 sing N N 186 HIS CG ND1 sing Y N 187 HIS CG CD2 doub Y N 188 HIS ND1 CE1 doub Y N 189 HIS ND1 HD1 sing N N 190 HIS CD2 NE2 sing Y N 191 HIS CD2 HD2 sing N N 192 HIS CE1 NE2 sing Y N 193 HIS CE1 HE1 sing N N 194 HIS NE2 HE2 sing N N 195 HIS OXT HXT sing N N 196 HOH O H1 sing N N 197 HOH O H2 sing N N 198 ILE N CA sing N N 199 ILE N H sing N N 200 ILE N H2 sing N N 201 ILE CA C sing N N 202 ILE CA CB sing N N 203 ILE CA HA sing N N 204 ILE C O doub N N 205 ILE C OXT sing N N 206 ILE CB CG1 sing N N 207 ILE CB CG2 sing N N 208 ILE CB HB sing N N 209 ILE CG1 CD1 sing N N 210 ILE CG1 HG12 sing N N 211 ILE CG1 HG13 sing N N 212 ILE CG2 HG21 sing N N 213 ILE CG2 HG22 sing N N 214 ILE CG2 HG23 sing N N 215 ILE CD1 HD11 sing N N 216 ILE CD1 HD12 sing N N 217 ILE CD1 HD13 sing N N 218 ILE OXT HXT sing N N 219 LEU N CA sing N N 220 LEU N H sing N N 221 LEU N H2 sing N N 222 LEU CA C sing N N 223 LEU CA CB sing N N 224 LEU CA HA sing N N 225 LEU C O doub N N 226 LEU C OXT sing N N 227 LEU CB CG sing N N 228 LEU CB HB2 sing N N 229 LEU CB HB3 sing N N 230 LEU CG CD1 sing N N 231 LEU CG CD2 sing N N 232 LEU CG HG sing N N 233 LEU CD1 HD11 sing N N 234 LEU CD1 HD12 sing N N 235 LEU CD1 HD13 sing N N 236 LEU CD2 HD21 sing N N 237 LEU CD2 HD22 sing N N 238 LEU CD2 HD23 sing N N 239 LEU OXT HXT sing N N 240 LYS N CA sing N N 241 LYS N H sing N N 242 LYS N H2 sing N N 243 LYS CA C sing N N 244 LYS CA CB sing N N 245 LYS CA HA sing N N 246 LYS C O doub N N 247 LYS C OXT sing N N 248 LYS CB CG sing N N 249 LYS CB HB2 sing N N 250 LYS CB HB3 sing N N 251 LYS CG CD sing N N 252 LYS CG HG2 sing N N 253 LYS CG HG3 sing N N 254 LYS CD CE sing N N 255 LYS CD HD2 sing N N 256 LYS CD HD3 sing N N 257 LYS CE NZ sing N N 258 LYS CE HE2 sing N N 259 LYS CE HE3 sing N N 260 LYS NZ HZ1 sing N N 261 LYS NZ HZ2 sing N N 262 LYS NZ HZ3 sing N N 263 LYS OXT HXT sing N N 264 MET N CA sing N N 265 MET N H sing N N 266 MET N H2 sing N N 267 MET CA C sing N N 268 MET CA CB sing N N 269 MET CA HA sing N N 270 MET C O doub N N 271 MET C OXT sing N N 272 MET CB CG sing N N 273 MET CB HB2 sing N N 274 MET CB HB3 sing N N 275 MET CG SD sing N N 276 MET CG HG2 sing N N 277 MET CG HG3 sing N N 278 MET SD CE sing N N 279 MET CE HE1 sing N N 280 MET CE HE2 sing N N 281 MET CE HE3 sing N N 282 MET OXT HXT sing N N 283 NAG C1 C2 sing N N 284 NAG C1 O1 sing N N 285 NAG C1 O5 sing N N 286 NAG C1 H1 sing N N 287 NAG C2 C3 sing N N 288 NAG C2 N2 sing N N 289 NAG C2 H2 sing N N 290 NAG C3 C4 sing N N 291 NAG C3 O3 sing N N 292 NAG C3 H3 sing N N 293 NAG C4 C5 sing N N 294 NAG C4 O4 sing N N 295 NAG C4 H4 sing N N 296 NAG C5 C6 sing N N 297 NAG C5 O5 sing N N 298 NAG C5 H5 sing N N 299 NAG C6 O6 sing N N 300 NAG C6 H61 sing N N 301 NAG C6 H62 sing N N 302 NAG C7 C8 sing N N 303 NAG C7 N2 sing N N 304 NAG C7 O7 doub N N 305 NAG C8 H81 sing N N 306 NAG C8 H82 sing N N 307 NAG C8 H83 sing N N 308 NAG N2 HN2 sing N N 309 NAG O1 HO1 sing N N 310 NAG O3 HO3 sing N N 311 NAG O4 HO4 sing N N 312 NAG O6 HO6 sing N N 313 PHE N CA sing N N 314 PHE N H sing N N 315 PHE N H2 sing N N 316 PHE CA C sing N N 317 PHE CA CB sing N N 318 PHE CA HA sing N N 319 PHE C O doub N N 320 PHE C OXT sing N N 321 PHE CB CG sing N N 322 PHE CB HB2 sing N N 323 PHE CB HB3 sing N N 324 PHE CG CD1 doub Y N 325 PHE CG CD2 sing Y N 326 PHE CD1 CE1 sing Y N 327 PHE CD1 HD1 sing N N 328 PHE CD2 CE2 doub Y N 329 PHE CD2 HD2 sing N N 330 PHE CE1 CZ doub Y N 331 PHE CE1 HE1 sing N N 332 PHE CE2 CZ sing Y N 333 PHE CE2 HE2 sing N N 334 PHE CZ HZ sing N N 335 PHE OXT HXT sing N N 336 PRO N CA sing N N 337 PRO N CD sing N N 338 PRO N H sing N N 339 PRO CA C sing N N 340 PRO CA CB sing N N 341 PRO CA HA sing N N 342 PRO C O doub N N 343 PRO C OXT sing N N 344 PRO CB CG sing N N 345 PRO CB HB2 sing N N 346 PRO CB HB3 sing N N 347 PRO CG CD sing N N 348 PRO CG HG2 sing N N 349 PRO CG HG3 sing N N 350 PRO CD HD2 sing N N 351 PRO CD HD3 sing N N 352 PRO OXT HXT sing N N 353 SER N CA sing N N 354 SER N H sing N N 355 SER N H2 sing N N 356 SER CA C sing N N 357 SER CA CB sing N N 358 SER CA HA sing N N 359 SER C O doub N N 360 SER C OXT sing N N 361 SER CB OG sing N N 362 SER CB HB2 sing N N 363 SER CB HB3 sing N N 364 SER OG HG sing N N 365 SER OXT HXT sing N N 366 THR N CA sing N N 367 THR N H sing N N 368 THR N H2 sing N N 369 THR CA C sing N N 370 THR CA CB sing N N 371 THR CA HA sing N N 372 THR C O doub N N 373 THR C OXT sing N N 374 THR CB OG1 sing N N 375 THR CB CG2 sing N N 376 THR CB HB sing N N 377 THR OG1 HG1 sing N N 378 THR CG2 HG21 sing N N 379 THR CG2 HG22 sing N N 380 THR CG2 HG23 sing N N 381 THR OXT HXT sing N N 382 TRP N CA sing N N 383 TRP N H sing N N 384 TRP N H2 sing N N 385 TRP CA C sing N N 386 TRP CA CB sing N N 387 TRP CA HA sing N N 388 TRP C O doub N N 389 TRP C OXT sing N N 390 TRP CB CG sing N N 391 TRP CB HB2 sing N N 392 TRP CB HB3 sing N N 393 TRP CG CD1 doub Y N 394 TRP CG CD2 sing Y N 395 TRP CD1 NE1 sing Y N 396 TRP CD1 HD1 sing N N 397 TRP CD2 CE2 doub Y N 398 TRP CD2 CE3 sing Y N 399 TRP NE1 CE2 sing Y N 400 TRP NE1 HE1 sing N N 401 TRP CE2 CZ2 sing Y N 402 TRP CE3 CZ3 doub Y N 403 TRP CE3 HE3 sing N N 404 TRP CZ2 CH2 doub Y N 405 TRP CZ2 HZ2 sing N N 406 TRP CZ3 CH2 sing Y N 407 TRP CZ3 HZ3 sing N N 408 TRP CH2 HH2 sing N N 409 TRP OXT HXT sing N N 410 TYR N CA sing N N 411 TYR N H sing N N 412 TYR N H2 sing N N 413 TYR CA C sing N N 414 TYR CA CB sing N N 415 TYR CA HA sing N N 416 TYR C O doub N N 417 TYR C OXT sing N N 418 TYR CB CG sing N N 419 TYR CB HB2 sing N N 420 TYR CB HB3 sing N N 421 TYR CG CD1 doub Y N 422 TYR CG CD2 sing Y N 423 TYR CD1 CE1 sing Y N 424 TYR CD1 HD1 sing N N 425 TYR CD2 CE2 doub Y N 426 TYR CD2 HD2 sing N N 427 TYR CE1 CZ doub Y N 428 TYR CE1 HE1 sing N N 429 TYR CE2 CZ sing Y N 430 TYR CE2 HE2 sing N N 431 TYR CZ OH sing N N 432 TYR OH HH sing N N 433 TYR OXT HXT sing N N 434 VAL N CA sing N N 435 VAL N H sing N N 436 VAL N H2 sing N N 437 VAL CA C sing N N 438 VAL CA CB sing N N 439 VAL CA HA sing N N 440 VAL C O doub N N 441 VAL C OXT sing N N 442 VAL CB CG1 sing N N 443 VAL CB CG2 sing N N 444 VAL CB HB sing N N 445 VAL CG1 HG11 sing N N 446 VAL CG1 HG12 sing N N 447 VAL CG1 HG13 sing N N 448 VAL CG2 HG21 sing N N 449 VAL CG2 HG22 sing N N 450 VAL CG2 HG23 sing N N 451 VAL OXT HXT sing N N 452 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'European Union' France 765581 1 'French National Research Agency' France ANR-15-IDEX-02 2 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 GAL 2 n 2 FUC 3 n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 FUC ? ? FUC ? ? 'SUBJECT OF INVESTIGATION' ? 2 GAL ? ? GAL ? ? 'SUBJECT OF INVESTIGATION' ? 3 NAG ? ? NAG ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2WQ4 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6TID _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.023421 _atom_sites.fract_transf_matrix[1][2] 0.013522 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027045 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003241 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.050 # loop_