data_6TOB # _entry.id 6TOB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6TOB pdb_00006tob 10.2210/pdb6tob/pdb WWPDB D_1292105796 ? ? BMRB 34463 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Structural and DNA Binding Properties of Mycobacterial Integration Host Factor mIHF' _pdbx_database_related.db_id 34463 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6TOB _pdbx_database_status.recvd_initial_deposition_date 2019-12-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Herrmann, T.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0003-2115-4781 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Struct.Biol. _citation.journal_id_ASTM JSBIEM _citation.journal_id_CSD 0803 _citation.journal_id_ISSN 1095-8657 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 209 _citation.language ? _citation.page_first 107434 _citation.page_last 107434 _citation.title 'Structural and DNA binding properties of mycobacterial integration host factor mIHF.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jsb.2019.107434 _citation.pdbx_database_id_PubMed 31846718 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Odermatt, N.T.' 1 ? primary 'Lelli, M.' 2 ? primary 'Herrmann, T.' 3 ? primary 'Abriata, L.A.' 4 ? primary 'Japaridze, A.' 5 ? primary 'Voilquin, H.' 6 ? primary 'Singh, R.' 7 ? primary 'Piton, J.' 8 ? primary 'Emsley, L.' 9 ? primary 'Dietler, G.' 10 ? primary 'Cole, S.T.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Integration host factor MIHF' _entity.formula_weight 11909.892 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMVALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDEVLGKMKVSALLEALPKVGKVKAQEIM TELEIAPTRRLRGLGDRQRKALLEKFGSA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMVALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDEVLGKMKVSALLEALPKVGKVKAQEIM TELEIAPTRRLRGLGDRQRKALLEKFGSA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 VAL n 1 6 ALA n 1 7 LEU n 1 8 PRO n 1 9 GLN n 1 10 LEU n 1 11 THR n 1 12 ASP n 1 13 GLU n 1 14 GLN n 1 15 ARG n 1 16 ALA n 1 17 ALA n 1 18 ALA n 1 19 LEU n 1 20 GLU n 1 21 LYS n 1 22 ALA n 1 23 ALA n 1 24 ALA n 1 25 ALA n 1 26 ARG n 1 27 ARG n 1 28 ALA n 1 29 ARG n 1 30 ALA n 1 31 GLU n 1 32 LEU n 1 33 LYS n 1 34 ASP n 1 35 ARG n 1 36 LEU n 1 37 LYS n 1 38 ARG n 1 39 GLY n 1 40 GLY n 1 41 THR n 1 42 ASN n 1 43 LEU n 1 44 THR n 1 45 GLN n 1 46 VAL n 1 47 LEU n 1 48 LYS n 1 49 ASP n 1 50 ALA n 1 51 GLU n 1 52 SER n 1 53 ASP n 1 54 GLU n 1 55 VAL n 1 56 LEU n 1 57 GLY n 1 58 LYS n 1 59 MET n 1 60 LYS n 1 61 VAL n 1 62 SER n 1 63 ALA n 1 64 LEU n 1 65 LEU n 1 66 GLU n 1 67 ALA n 1 68 LEU n 1 69 PRO n 1 70 LYS n 1 71 VAL n 1 72 GLY n 1 73 LYS n 1 74 VAL n 1 75 LYS n 1 76 ALA n 1 77 GLN n 1 78 GLU n 1 79 ILE n 1 80 MET n 1 81 THR n 1 82 GLU n 1 83 LEU n 1 84 GLU n 1 85 ILE n 1 86 ALA n 1 87 PRO n 1 88 THR n 1 89 ARG n 1 90 ARG n 1 91 LEU n 1 92 ARG n 1 93 GLY n 1 94 LEU n 1 95 GLY n 1 96 ASP n 1 97 ARG n 1 98 GLN n 1 99 ARG n 1 100 LYS n 1 101 ALA n 1 102 LEU n 1 103 LEU n 1 104 GLU n 1 105 LYS n 1 106 PHE n 1 107 GLY n 1 108 SER n 1 109 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 109 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'mihF, ERS007672_05099, ERS007703_04035' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0U0SDY2_MYCTX _struct_ref.pdbx_db_accession A0A0U0SDY2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDEVLGKMKVSALLEALPKVGKVKAQEIMTELE IAPTRRLRGLGDRQRKALLEKFGSA ; _struct_ref.pdbx_align_begin 53 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6TOB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 109 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0U0SDY2 _struct_ref_seq.db_align_beg 53 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 157 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 109 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6TOB GLY A 1 ? UNP A0A0U0SDY2 ? ? 'expression tag' 1 1 1 6TOB SER A 2 ? UNP A0A0U0SDY2 ? ? 'expression tag' 2 2 1 6TOB HIS A 3 ? UNP A0A0U0SDY2 ? ? 'expression tag' 3 3 1 6TOB MET A 4 ? UNP A0A0U0SDY2 ? ? 'expression tag' 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 CBCACONH 3 isotropic 2 1 1 HACACONH 3 isotropic 3 1 1 HACANH 3 isotropic 4 1 1 '1H-13C 3D HSQC NOESY' 1 isotropic 5 1 1 '1H-15N 3D HSQC NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.34 mM [U-13C; U-15N] Mycobacterial integration host factor (mIHF), 50 mM sodium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 13C_15N_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ;1.34 mM uniformly 13C- and 15N-labelled mIHF samples i in 90% H2O (50 mM phosphate buffer pH 7.5, 100 mM NaCl) and 10% 2H2O. 0.2% sodium azide. ; # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 1000 ? 3 'AVANCE III' ? Bruker 600 ? # _pdbx_nmr_refine.entry_id 6TOB _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6TOB _pdbx_nmr_ensemble.conformers_calculated_total_number 80 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6TOB _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger A. T. et.al.' 2 'structure calculation' CYANA 3.98 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' UNIO 2.9 'Herrmann, T. et al.' 4 'peak picking' UNIO 2.9 'UNIO-ATNOS module' 5 'data analysis' UNIO 2.9 'UNIO-ATNOS/CANDID for automated NOE assignment' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6TOB _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6TOB _struct.title 'Structural and DNA Binding Properties of Mycobacterial Integration Host Factor mIHF' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6TOB _struct_keywords.text ;- transcriptional control. Mycobacterial integration host factor - mIHF is an alpha-helical protein with two DNA-binding sites, DNA BINDING PROTEIN ; _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 11 ? ARG A 15 ? THR A 11 ARG A 15 5 ? 5 HELX_P HELX_P2 AA2 GLU A 20 ? ALA A 28 ? GLU A 20 ALA A 28 1 ? 9 HELX_P HELX_P3 AA3 ARG A 29 ? GLY A 39 ? ARG A 29 GLY A 39 1 ? 11 HELX_P HELX_P4 AA4 ASN A 42 ? ALA A 50 ? ASN A 42 ALA A 50 1 ? 9 HELX_P HELX_P5 AA5 VAL A 55 ? MET A 59 ? VAL A 55 MET A 59 5 ? 5 HELX_P HELX_P6 AA6 LYS A 60 ? ALA A 67 ? LYS A 60 ALA A 67 1 ? 8 HELX_P HELX_P7 AA7 GLY A 72 ? GLU A 84 ? GLY A 72 GLU A 84 1 ? 13 HELX_P HELX_P8 AA8 ASP A 96 ? GLY A 107 ? ASP A 96 GLY A 107 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 6TOB _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 ALA 109 109 109 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8570 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-12-25 2 'Structure model' 1 1 2020-03-04 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' database_2 3 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_citation.year' 4 3 'Structure model' '_database_2.pdbx_DOI' 5 3 'Structure model' '_database_2.pdbx_database_accession' 6 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Mycobacterial integration host factor (mIHF)' 1.34 ? mM '[U-13C; U-15N]' 1 'sodium phosphate' 50 ? mM 'natural abundance' 1 'sodium chloride' 100 ? mM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? 58.46 84.28 2 1 HIS A 3 ? ? 58.38 179.47 3 1 ALA A 28 ? ? -66.54 92.73 4 1 ARG A 29 ? ? -147.20 -45.66 5 1 LEU A 94 ? ? -49.32 158.14 6 1 ASP A 96 ? ? -174.70 -168.66 7 2 HIS A 3 ? ? -172.84 -170.62 8 2 ALA A 28 ? ? -51.72 103.73 9 2 ARG A 29 ? ? -151.55 -47.99 10 3 SER A 2 ? ? -173.48 87.70 11 3 ALA A 28 ? ? 64.07 -169.81 12 3 THR A 88 ? ? -99.45 34.08 13 3 LEU A 94 ? ? -56.58 178.94 14 3 ASP A 96 ? ? -148.23 20.99 15 4 SER A 2 ? ? 60.99 63.04 16 4 HIS A 3 ? ? -173.13 -171.24 17 4 ALA A 28 ? ? -51.76 103.42 18 4 ARG A 29 ? ? -153.93 -42.04 19 4 ASP A 96 ? ? -170.17 29.66 20 5 THR A 11 ? ? -63.37 -173.14 21 5 ALA A 28 ? ? -97.44 30.40 22 5 THR A 88 ? ? -94.80 33.97 23 5 LEU A 94 ? ? -114.36 -169.25 24 6 THR A 11 ? ? -63.18 -173.16 25 6 ARG A 29 ? ? -141.15 -48.54 26 6 ASP A 96 ? ? -60.89 -166.82 27 7 HIS A 3 ? ? 57.62 179.33 28 7 THR A 11 ? ? -57.08 176.53 29 7 ALA A 28 ? ? -77.24 -83.14 30 7 ARG A 29 ? ? 66.71 -77.02 31 8 SER A 2 ? ? -178.93 120.66 32 8 HIS A 3 ? ? -179.21 146.35 33 8 THR A 11 ? ? -59.10 -172.95 34 8 ARG A 29 ? ? -179.68 -49.55 35 8 THR A 88 ? ? -97.74 33.63 36 8 ASP A 96 ? ? 63.69 -167.72 37 9 SER A 2 ? ? -132.80 -65.45 38 9 HIS A 3 ? ? 57.97 -179.39 39 9 ALA A 28 ? ? -60.65 96.40 40 9 ARG A 29 ? ? -153.65 -48.53 41 10 HIS A 3 ? ? -177.39 -173.62 42 10 MET A 4 ? ? -55.08 172.11 43 10 ARG A 29 ? ? -179.57 -58.57 44 10 THR A 88 ? ? -96.14 31.20 45 10 ASP A 96 ? ? -113.64 -74.48 46 11 ARG A 29 ? ? -147.49 -48.88 47 11 THR A 88 ? ? -94.38 32.27 48 11 LEU A 94 ? ? -60.38 -169.49 49 11 ASP A 96 ? ? -179.87 -34.09 50 12 ALA A 6 ? ? -69.63 84.78 51 12 ARG A 29 ? ? -153.68 -52.31 52 12 LEU A 94 ? ? -49.26 167.22 53 12 ASP A 96 ? ? -179.20 34.35 54 13 SER A 2 ? ? -166.51 -65.34 55 13 HIS A 3 ? ? -67.00 -174.85 56 13 ARG A 29 ? ? -176.37 -44.50 57 13 ARG A 92 ? ? -122.73 -54.54 58 13 ASP A 96 ? ? -179.73 -169.73 59 14 SER A 2 ? ? -171.31 -174.37 60 14 LEU A 94 ? ? 18.19 71.59 61 14 ASP A 96 ? ? 65.14 -83.77 62 15 ALA A 28 ? ? -68.03 -79.95 63 15 ARG A 29 ? ? 71.03 -68.82 64 15 THR A 88 ? ? -96.42 33.24 65 16 SER A 2 ? ? 60.08 -176.79 66 16 ARG A 29 ? ? -170.48 -48.78 67 16 THR A 88 ? ? -95.16 33.57 68 16 ASP A 96 ? ? 51.45 -168.68 69 17 ARG A 29 ? ? -146.62 -46.91 70 17 THR A 88 ? ? -94.90 33.37 71 17 ASP A 96 ? ? 68.70 -76.74 72 18 HIS A 3 ? ? -54.76 170.76 73 18 ARG A 29 ? ? -179.31 -41.92 74 19 SER A 2 ? ? -179.09 141.19 75 19 ARG A 29 ? ? -174.07 -40.23 76 19 ASP A 96 ? ? 53.96 -169.71 77 20 HIS A 3 ? ? -174.06 -67.76 78 20 ALA A 28 ? ? -51.32 -77.55 79 20 ARG A 29 ? ? 68.33 -76.19 80 20 LEU A 64 ? ? -92.21 -64.37 81 20 ARG A 90 ? ? -115.72 -163.40 # _pdbx_audit_support.funding_organization 'Swiss National Science Foundation' _pdbx_audit_support.country Switzerland _pdbx_audit_support.grant_number 31003A-162641 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? #