data_6TTC # _entry.id 6TTC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.339 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6TTC WWPDB D_1292106014 BMRB 34472 # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Haddock model of NDM-1/myricetin complex' _pdbx_database_related.db_id 34472 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6TTC _pdbx_database_status.recvd_initial_deposition_date 2019-12-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Riviere, G.' 1 ? 'Oueslati, S.' 2 ? 'Gayral, M.' 3 ? 'Crechet, J.B.' 4 ? 'Nhiri, N.' 5 ? 'Jacquet, E.' 6 ? 'Cintrat, J.C.' 7 ? 'Giraud, F.' 8 ? 'van Heijenoort, C.' 9 ? 'Lescop, E.' 10 ? 'Pethe, S.' 11 ? 'Iorga, B.I.' 12 ? 'Naas, T.' 13 ? 'Guittet, E.' 14 ? 'Morellet, N.' 15 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Omega' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2470-1343 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 5 _citation.language ? _citation.page_first 10466 _citation.page_last 10480 _citation.title ;NMR Characterization of the Influence of Zinc(II) Ions on the Structural and Dynamic Behavior of the New Delhi Metallo-beta-Lactamase-1 and on the Binding with Flavonols as Inhibitors. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsomega.0c00590 _citation.pdbx_database_id_PubMed 32426604 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Riviere, G.' 1 ? primary 'Oueslati, S.' 2 ? primary 'Gayral, M.' 3 ? primary 'Crechet, J.B.' 4 ? primary 'Nhiri, N.' 5 ? primary 'Jacquet, E.' 6 ? primary 'Cintrat, J.C.' 7 ? primary 'Giraud, F.' 8 ? primary 'van Heijenoort, C.' 9 ? primary 'Lescop, E.' 10 ? primary 'Pethe, S.' 11 ? primary 'Iorga, B.I.' 12 ? primary 'Naas, T.' 13 ? primary 'Guittet, E.' 14 ? primary 'Morellet, N.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Metallo beta lactamase NDM-1' 24032.010 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 non-polymer syn '3,5,7-TRIHYDROXY-2-(3,4,5-TRIHYDROXYPHENYL)-4H-CHROMEN-4-ONE' 318.235 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Metallo beta-lactamase,Metallo-beta-lactamase,NDM-1,NDM carbapenemase,NDM-1 metallo-beta-lactamase,NDM1 metallo-beta-lactamase,New Delhi Metallo carbapenemase-1,New Delhi metallo-beta-lactamse 1,Subclass B1 metallo-beta-lactamase NDM-1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHA HQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGT DIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKL ; _entity_poly.pdbx_seq_one_letter_code_can ;GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHA HQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGT DIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASP n 1 3 GLN n 1 4 ARG n 1 5 PHE n 1 6 GLY n 1 7 ASP n 1 8 LEU n 1 9 VAL n 1 10 PHE n 1 11 ARG n 1 12 GLN n 1 13 LEU n 1 14 ALA n 1 15 PRO n 1 16 ASN n 1 17 VAL n 1 18 TRP n 1 19 GLN n 1 20 HIS n 1 21 THR n 1 22 SER n 1 23 TYR n 1 24 LEU n 1 25 ASP n 1 26 MET n 1 27 PRO n 1 28 GLY n 1 29 PHE n 1 30 GLY n 1 31 ALA n 1 32 VAL n 1 33 ALA n 1 34 SER n 1 35 ASN n 1 36 GLY n 1 37 LEU n 1 38 ILE n 1 39 VAL n 1 40 ARG n 1 41 ASP n 1 42 GLY n 1 43 GLY n 1 44 ARG n 1 45 VAL n 1 46 LEU n 1 47 VAL n 1 48 VAL n 1 49 ASP n 1 50 THR n 1 51 ALA n 1 52 TRP n 1 53 THR n 1 54 ASP n 1 55 ASP n 1 56 GLN n 1 57 THR n 1 58 ALA n 1 59 GLN n 1 60 ILE n 1 61 LEU n 1 62 ASN n 1 63 TRP n 1 64 ILE n 1 65 LYS n 1 66 GLN n 1 67 GLU n 1 68 ILE n 1 69 ASN n 1 70 LEU n 1 71 PRO n 1 72 VAL n 1 73 ALA n 1 74 LEU n 1 75 ALA n 1 76 VAL n 1 77 VAL n 1 78 THR n 1 79 HIS n 1 80 ALA n 1 81 HIS n 1 82 GLN n 1 83 ASP n 1 84 LYS n 1 85 MET n 1 86 GLY n 1 87 GLY n 1 88 MET n 1 89 ASP n 1 90 ALA n 1 91 LEU n 1 92 HIS n 1 93 ALA n 1 94 ALA n 1 95 GLY n 1 96 ILE n 1 97 ALA n 1 98 THR n 1 99 TYR n 1 100 ALA n 1 101 ASN n 1 102 ALA n 1 103 LEU n 1 104 SER n 1 105 ASN n 1 106 GLN n 1 107 LEU n 1 108 ALA n 1 109 PRO n 1 110 GLN n 1 111 GLU n 1 112 GLY n 1 113 MET n 1 114 VAL n 1 115 ALA n 1 116 ALA n 1 117 GLN n 1 118 HIS n 1 119 SER n 1 120 LEU n 1 121 THR n 1 122 PHE n 1 123 ALA n 1 124 ALA n 1 125 ASN n 1 126 GLY n 1 127 TRP n 1 128 VAL n 1 129 GLU n 1 130 PRO n 1 131 ALA n 1 132 THR n 1 133 ALA n 1 134 PRO n 1 135 ASN n 1 136 PHE n 1 137 GLY n 1 138 PRO n 1 139 LEU n 1 140 LYS n 1 141 VAL n 1 142 PHE n 1 143 TYR n 1 144 PRO n 1 145 GLY n 1 146 PRO n 1 147 GLY n 1 148 HIS n 1 149 THR n 1 150 SER n 1 151 ASP n 1 152 ASN n 1 153 ILE n 1 154 THR n 1 155 VAL n 1 156 GLY n 1 157 ILE n 1 158 ASP n 1 159 GLY n 1 160 THR n 1 161 ASP n 1 162 ILE n 1 163 ALA n 1 164 PHE n 1 165 GLY n 1 166 GLY n 1 167 CYS n 1 168 LEU n 1 169 ILE n 1 170 LYS n 1 171 ASP n 1 172 SER n 1 173 LYS n 1 174 ALA n 1 175 LYS n 1 176 SER n 1 177 LEU n 1 178 GLY n 1 179 ASN n 1 180 LEU n 1 181 GLY n 1 182 ASP n 1 183 ALA n 1 184 ASP n 1 185 THR n 1 186 GLU n 1 187 HIS n 1 188 TYR n 1 189 ALA n 1 190 ALA n 1 191 SER n 1 192 ALA n 1 193 ARG n 1 194 ALA n 1 195 PHE n 1 196 GLY n 1 197 ALA n 1 198 ALA n 1 199 PHE n 1 200 PRO n 1 201 LYS n 1 202 ALA n 1 203 SER n 1 204 MET n 1 205 ILE n 1 206 VAL n 1 207 MET n 1 208 SER n 1 209 HIS n 1 210 SER n 1 211 ALA n 1 212 PRO n 1 213 ASP n 1 214 SER n 1 215 ARG n 1 216 ALA n 1 217 ALA n 1 218 ILE n 1 219 THR n 1 220 HIS n 1 221 THR n 1 222 ALA n 1 223 ARG n 1 224 MET n 1 225 ALA n 1 226 ASP n 1 227 LYS n 1 228 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 228 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ;blaNDM-1, bla NDM-1, blaNDM-1_1, blaNDM-1_2, blaNDM-1_3, blaNDM1, NDM-1, BANRA_05884, C3483_29595, C7V41_28630, D647_p47098, EC13450_007, FAQ72_26810, FAQ97_27095, FAS39_27275, NCTC13443_00040, p2146_00143, pCRE380_21, PMK1_ndm00067, PMK1_ndm00076, PMK1_ndm00085, pN11x00042NDM_090, pNDM-SX04_5, pNDM10469_138, SAMEA3531848_05178, TR3_031, TR4_031 ; _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Klebsiella pneumoniae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 573 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code E9NWK5_KLEPN _struct_ref.pdbx_db_accession E9NWK5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHA HQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGT DIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKL ; _struct_ref.pdbx_align_begin 42 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6TTC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 228 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession E9NWK5 _struct_ref_seq.db_align_beg 42 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 269 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 42 _struct_ref_seq.pdbx_auth_seq_align_end 269 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MYC non-polymer . '3,5,7-TRIHYDROXY-2-(3,4,5-TRIHYDROXYPHENYL)-4H-CHROMEN-4-ONE' ;2-(3,4,5-TRIHYDROXYPHENYL)-3,5,7-TRIHYDROXY-4H-1-BENZOPYRAN-4-ONE; 3,3',4',5,5',7-HEXAHYDROXYFLAVONE; MYRICETIN; CANNABISCETIN ; 'C15 H10 O8' 318.235 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-15N HSQC' 2 isotropic 3 1 1 '3D HNCO' 1 isotropic 4 1 1 '3D HNCA' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 8 1 1 HNCOCA 1 isotropic 7 1 1 HNCOCACB 1 isotropic 6 1 1 HNCACO 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '320 uM [U-13C; U-15N] NDM-1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label '15N 13C_sample' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE II' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 800 ? # _pdbx_nmr_refine.entry_id 6TTC _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # _pdbx_nmr_ensemble.entry_id 6TTC _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 4 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6TTC _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin 3.5 'Bruker Biospin' 2 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 3 'peak picking' 'CcpNmr Analysis' ? CCPN 4 'structure calculation' HADDOCK ? Bonvin # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6TTC _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6TTC _struct.title 'Haddock model of NDM-1/myricetin complex' _struct.pdbx_descriptor 'Metallo beta lactamase NDM-1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6TTC _struct_keywords.text 'complex, inhibitor, Myricetin, New-Delhi Metallo-beta-lactamase-1, Haddock, antimicrobial resistance, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 53 ? ILE A 68 ? THR A 94 ILE A 109 1 ? 16 HELX_P HELX_P2 AA2 GLY A 87 ? ALA A 94 ? GLY A 128 ALA A 135 1 ? 8 HELX_P HELX_P3 AA3 ALA A 102 ? GLY A 112 ? ALA A 143 GLY A 153 1 ? 11 HELX_P HELX_P4 AA4 HIS A 187 ? PHE A 199 ? HIS A 228 PHE A 240 1 ? 13 HELX_P HELX_P5 AA5 ARG A 215 ? LYS A 227 ? ARG A 256 LYS A 268 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 79 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 120 A ZN 302 1_555 ? ? ? ? ? ? ? 1.951 ? ? metalc2 metalc ? ? A HIS 81 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 122 A ZN 302 1_555 ? ? ? ? ? ? ? 1.993 ? ? metalc3 metalc ? ? A ASP 83 OD1 ? ? ? 1_555 C ZN . ZN ? ? A ASP 124 A ZN 302 1_555 ? ? ? ? ? ? ? 1.721 ? ? metalc4 metalc ? ? A HIS 209 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 250 A ZN 301 1_555 ? ? ? ? ? ? ? 1.919 ? ? metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 D MYC . O30 ? ? A ZN 302 A MYC 303 1_555 ? ? ? ? ? ? ? 2.162 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 2 ? PHE A 5 ? ASP A 43 PHE A 46 AA1 2 LEU A 8 ? ALA A 14 ? LEU A 49 ALA A 55 AA1 3 VAL A 17 ? MET A 26 ? VAL A 58 MET A 67 AA1 4 GLY A 30 ? ASP A 41 ? GLY A 71 ASP A 82 AA1 5 ARG A 44 ? VAL A 48 ? ARG A 85 VAL A 89 AA1 6 VAL A 72 ? VAL A 76 ? VAL A 113 VAL A 117 AA1 7 ALA A 97 ? ASN A 101 ? ALA A 138 ASN A 142 AA1 8 HIS A 118 ? LEU A 120 ? HIS A 159 LEU A 161 AA2 1 LEU A 139 ? PHE A 142 ? LEU A 180 PHE A 183 AA2 2 THR A 154 ? ILE A 157 ? THR A 195 ILE A 198 AA2 3 ILE A 162 ? GLY A 166 ? ILE A 203 GLY A 207 AA2 4 MET A 204 ? MET A 207 ? MET A 245 MET A 248 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 3 ? N GLN A 44 O PHE A 10 ? O PHE A 51 AA1 2 3 N ARG A 11 ? N ARG A 52 O GLN A 19 ? O GLN A 60 AA1 3 4 N SER A 22 ? N SER A 63 O SER A 34 ? O SER A 75 AA1 4 5 N VAL A 39 ? N VAL A 80 O LEU A 46 ? O LEU A 87 AA1 5 6 N VAL A 45 ? N VAL A 86 O ALA A 73 ? O ALA A 114 AA1 6 7 N ALA A 75 ? N ALA A 116 O TYR A 99 ? O TYR A 140 AA1 7 8 N ALA A 100 ? N ALA A 141 O LEU A 120 ? O LEU A 161 AA2 1 2 N PHE A 142 ? N PHE A 183 O THR A 154 ? O THR A 195 AA2 2 3 N VAL A 155 ? N VAL A 196 O PHE A 164 ? O PHE A 205 AA2 3 4 N ALA A 163 ? N ALA A 204 O MET A 204 ? O MET A 245 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 301 ? 4 'binding site for residue ZN A 301' AC2 Software A ZN 302 ? 5 'binding site for residue ZN A 302' AC3 Software A MYC 303 ? 7 'binding site for residue MYC A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ASP A 83 ? ASP A 124 . ? 1_555 ? 2 AC1 4 CYS A 167 ? CYS A 208 . ? 1_555 ? 3 AC1 4 HIS A 209 ? HIS A 250 . ? 1_555 ? 4 AC1 4 MYC D . ? MYC A 303 . ? 1_555 ? 5 AC2 5 HIS A 79 ? HIS A 120 . ? 1_555 ? 6 AC2 5 HIS A 81 ? HIS A 122 . ? 1_555 ? 7 AC2 5 ASP A 83 ? ASP A 124 . ? 1_555 ? 8 AC2 5 HIS A 148 ? HIS A 189 . ? 1_555 ? 9 AC2 5 MYC D . ? MYC A 303 . ? 1_555 ? 10 AC3 7 PHE A 29 ? PHE A 70 . ? 1_555 ? 11 AC3 7 HIS A 81 ? HIS A 122 . ? 1_555 ? 12 AC3 7 ASP A 83 ? ASP A 124 . ? 1_555 ? 13 AC3 7 HIS A 148 ? HIS A 189 . ? 1_555 ? 14 AC3 7 HIS A 209 ? HIS A 250 . ? 1_555 ? 15 AC3 7 ZN B . ? ZN A 301 . ? 1_555 ? 16 AC3 7 ZN C . ? ZN A 302 . ? 1_555 ? # _atom_sites.entry_id 6TTC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 42 42 GLY GLY A . n A 1 2 ASP 2 43 43 ASP ASP A . n A 1 3 GLN 3 44 44 GLN GLN A . n A 1 4 ARG 4 45 45 ARG ARG A . n A 1 5 PHE 5 46 46 PHE PHE A . n A 1 6 GLY 6 47 47 GLY GLY A . n A 1 7 ASP 7 48 48 ASP ASP A . n A 1 8 LEU 8 49 49 LEU LEU A . n A 1 9 VAL 9 50 50 VAL VAL A . n A 1 10 PHE 10 51 51 PHE PHE A . n A 1 11 ARG 11 52 52 ARG ARG A . n A 1 12 GLN 12 53 53 GLN GLN A . n A 1 13 LEU 13 54 54 LEU LEU A . n A 1 14 ALA 14 55 55 ALA ALA A . n A 1 15 PRO 15 56 56 PRO PRO A . n A 1 16 ASN 16 57 57 ASN ASN A . n A 1 17 VAL 17 58 58 VAL VAL A . n A 1 18 TRP 18 59 59 TRP TRP A . n A 1 19 GLN 19 60 60 GLN GLN A . n A 1 20 HIS 20 61 61 HIS HIS A . n A 1 21 THR 21 62 62 THR THR A . n A 1 22 SER 22 63 63 SER SER A . n A 1 23 TYR 23 64 64 TYR TYR A . n A 1 24 LEU 24 65 65 LEU LEU A . n A 1 25 ASP 25 66 66 ASP ASP A . n A 1 26 MET 26 67 67 MET MET A . n A 1 27 PRO 27 68 68 PRO PRO A . n A 1 28 GLY 28 69 69 GLY GLY A . n A 1 29 PHE 29 70 70 PHE PHE A . n A 1 30 GLY 30 71 71 GLY GLY A . n A 1 31 ALA 31 72 72 ALA ALA A . n A 1 32 VAL 32 73 73 VAL VAL A . n A 1 33 ALA 33 74 74 ALA ALA A . n A 1 34 SER 34 75 75 SER SER A . n A 1 35 ASN 35 76 76 ASN ASN A . n A 1 36 GLY 36 77 77 GLY GLY A . n A 1 37 LEU 37 78 78 LEU LEU A . n A 1 38 ILE 38 79 79 ILE ILE A . n A 1 39 VAL 39 80 80 VAL VAL A . n A 1 40 ARG 40 81 81 ARG ARG A . n A 1 41 ASP 41 82 82 ASP ASP A . n A 1 42 GLY 42 83 83 GLY GLY A . n A 1 43 GLY 43 84 84 GLY GLY A . n A 1 44 ARG 44 85 85 ARG ARG A . n A 1 45 VAL 45 86 86 VAL VAL A . n A 1 46 LEU 46 87 87 LEU LEU A . n A 1 47 VAL 47 88 88 VAL VAL A . n A 1 48 VAL 48 89 89 VAL VAL A . n A 1 49 ASP 49 90 90 ASP ASP A . n A 1 50 THR 50 91 91 THR THR A . n A 1 51 ALA 51 92 92 ALA ALA A . n A 1 52 TRP 52 93 93 TRP TRP A . n A 1 53 THR 53 94 94 THR THR A . n A 1 54 ASP 54 95 95 ASP ASP A . n A 1 55 ASP 55 96 96 ASP ASP A . n A 1 56 GLN 56 97 97 GLN GLN A . n A 1 57 THR 57 98 98 THR THR A . n A 1 58 ALA 58 99 99 ALA ALA A . n A 1 59 GLN 59 100 100 GLN GLN A . n A 1 60 ILE 60 101 101 ILE ILE A . n A 1 61 LEU 61 102 102 LEU LEU A . n A 1 62 ASN 62 103 103 ASN ASN A . n A 1 63 TRP 63 104 104 TRP TRP A . n A 1 64 ILE 64 105 105 ILE ILE A . n A 1 65 LYS 65 106 106 LYS LYS A . n A 1 66 GLN 66 107 107 GLN GLN A . n A 1 67 GLU 67 108 108 GLU GLU A . n A 1 68 ILE 68 109 109 ILE ILE A . n A 1 69 ASN 69 110 110 ASN ASN A . n A 1 70 LEU 70 111 111 LEU LEU A . n A 1 71 PRO 71 112 112 PRO PRO A . n A 1 72 VAL 72 113 113 VAL VAL A . n A 1 73 ALA 73 114 114 ALA ALA A . n A 1 74 LEU 74 115 115 LEU LEU A . n A 1 75 ALA 75 116 116 ALA ALA A . n A 1 76 VAL 76 117 117 VAL VAL A . n A 1 77 VAL 77 118 118 VAL VAL A . n A 1 78 THR 78 119 119 THR THR A . n A 1 79 HIS 79 120 120 HIS HIS A . n A 1 80 ALA 80 121 121 ALA ALA A . n A 1 81 HIS 81 122 122 HIS HIS A . n A 1 82 GLN 82 123 123 GLN GLN A . n A 1 83 ASP 83 124 124 ASP ASP A . n A 1 84 LYS 84 125 125 LYS LYS A . n A 1 85 MET 85 126 126 MET MET A . n A 1 86 GLY 86 127 127 GLY GLY A . n A 1 87 GLY 87 128 128 GLY GLY A . n A 1 88 MET 88 129 129 MET MET A . n A 1 89 ASP 89 130 130 ASP ASP A . n A 1 90 ALA 90 131 131 ALA ALA A . n A 1 91 LEU 91 132 132 LEU LEU A . n A 1 92 HIS 92 133 133 HIS HIS A . n A 1 93 ALA 93 134 134 ALA ALA A . n A 1 94 ALA 94 135 135 ALA ALA A . n A 1 95 GLY 95 136 136 GLY GLY A . n A 1 96 ILE 96 137 137 ILE ILE A . n A 1 97 ALA 97 138 138 ALA ALA A . n A 1 98 THR 98 139 139 THR THR A . n A 1 99 TYR 99 140 140 TYR TYR A . n A 1 100 ALA 100 141 141 ALA ALA A . n A 1 101 ASN 101 142 142 ASN ASN A . n A 1 102 ALA 102 143 143 ALA ALA A . n A 1 103 LEU 103 144 144 LEU LEU A . n A 1 104 SER 104 145 145 SER SER A . n A 1 105 ASN 105 146 146 ASN ASN A . n A 1 106 GLN 106 147 147 GLN GLN A . n A 1 107 LEU 107 148 148 LEU LEU A . n A 1 108 ALA 108 149 149 ALA ALA A . n A 1 109 PRO 109 150 150 PRO PRO A . n A 1 110 GLN 110 151 151 GLN GLN A . n A 1 111 GLU 111 152 152 GLU GLU A . n A 1 112 GLY 112 153 153 GLY GLY A . n A 1 113 MET 113 154 154 MET MET A . n A 1 114 VAL 114 155 155 VAL VAL A . n A 1 115 ALA 115 156 156 ALA ALA A . n A 1 116 ALA 116 157 157 ALA ALA A . n A 1 117 GLN 117 158 158 GLN GLN A . n A 1 118 HIS 118 159 159 HIS HIS A . n A 1 119 SER 119 160 160 SER SER A . n A 1 120 LEU 120 161 161 LEU LEU A . n A 1 121 THR 121 162 162 THR THR A . n A 1 122 PHE 122 163 163 PHE PHE A . n A 1 123 ALA 123 164 164 ALA ALA A . n A 1 124 ALA 124 165 165 ALA ALA A . n A 1 125 ASN 125 166 166 ASN ASN A . n A 1 126 GLY 126 167 167 GLY GLY A . n A 1 127 TRP 127 168 168 TRP TRP A . n A 1 128 VAL 128 169 169 VAL VAL A . n A 1 129 GLU 129 170 170 GLU GLU A . n A 1 130 PRO 130 171 171 PRO PRO A . n A 1 131 ALA 131 172 172 ALA ALA A . n A 1 132 THR 132 173 173 THR THR A . n A 1 133 ALA 133 174 174 ALA ALA A . n A 1 134 PRO 134 175 175 PRO PRO A . n A 1 135 ASN 135 176 176 ASN ASN A . n A 1 136 PHE 136 177 177 PHE PHE A . n A 1 137 GLY 137 178 178 GLY GLY A . n A 1 138 PRO 138 179 179 PRO PRO A . n A 1 139 LEU 139 180 180 LEU LEU A . n A 1 140 LYS 140 181 181 LYS LYS A . n A 1 141 VAL 141 182 182 VAL VAL A . n A 1 142 PHE 142 183 183 PHE PHE A . n A 1 143 TYR 143 184 184 TYR TYR A . n A 1 144 PRO 144 185 185 PRO PRO A . n A 1 145 GLY 145 186 186 GLY GLY A . n A 1 146 PRO 146 187 187 PRO PRO A . n A 1 147 GLY 147 188 188 GLY GLY A . n A 1 148 HIS 148 189 189 HIS HIS A . n A 1 149 THR 149 190 190 THR THR A . n A 1 150 SER 150 191 191 SER SER A . n A 1 151 ASP 151 192 192 ASP ASP A . n A 1 152 ASN 152 193 193 ASN ASN A . n A 1 153 ILE 153 194 194 ILE ILE A . n A 1 154 THR 154 195 195 THR THR A . n A 1 155 VAL 155 196 196 VAL VAL A . n A 1 156 GLY 156 197 197 GLY GLY A . n A 1 157 ILE 157 198 198 ILE ILE A . n A 1 158 ASP 158 199 199 ASP ASP A . n A 1 159 GLY 159 200 200 GLY GLY A . n A 1 160 THR 160 201 201 THR THR A . n A 1 161 ASP 161 202 202 ASP ASP A . n A 1 162 ILE 162 203 203 ILE ILE A . n A 1 163 ALA 163 204 204 ALA ALA A . n A 1 164 PHE 164 205 205 PHE PHE A . n A 1 165 GLY 165 206 206 GLY GLY A . n A 1 166 GLY 166 207 207 GLY GLY A . n A 1 167 CYS 167 208 208 CYS CYS A . n A 1 168 LEU 168 209 209 LEU LEU A . n A 1 169 ILE 169 210 210 ILE ILE A . n A 1 170 LYS 170 211 211 LYS LYS A . n A 1 171 ASP 171 212 212 ASP ASP A . n A 1 172 SER 172 213 213 SER SER A . n A 1 173 LYS 173 214 214 LYS LYS A . n A 1 174 ALA 174 215 215 ALA ALA A . n A 1 175 LYS 175 216 216 LYS LYS A . n A 1 176 SER 176 217 217 SER SER A . n A 1 177 LEU 177 218 218 LEU LEU A . n A 1 178 GLY 178 219 219 GLY GLY A . n A 1 179 ASN 179 220 220 ASN ASN A . n A 1 180 LEU 180 221 221 LEU LEU A . n A 1 181 GLY 181 222 222 GLY GLY A . n A 1 182 ASP 182 223 223 ASP ASP A . n A 1 183 ALA 183 224 224 ALA ALA A . n A 1 184 ASP 184 225 225 ASP ASP A . n A 1 185 THR 185 226 226 THR THR A . n A 1 186 GLU 186 227 227 GLU GLU A . n A 1 187 HIS 187 228 228 HIS HIS A . n A 1 188 TYR 188 229 229 TYR TYR A . n A 1 189 ALA 189 230 230 ALA ALA A . n A 1 190 ALA 190 231 231 ALA ALA A . n A 1 191 SER 191 232 232 SER SER A . n A 1 192 ALA 192 233 233 ALA ALA A . n A 1 193 ARG 193 234 234 ARG ARG A . n A 1 194 ALA 194 235 235 ALA ALA A . n A 1 195 PHE 195 236 236 PHE PHE A . n A 1 196 GLY 196 237 237 GLY GLY A . n A 1 197 ALA 197 238 238 ALA ALA A . n A 1 198 ALA 198 239 239 ALA ALA A . n A 1 199 PHE 199 240 240 PHE PHE A . n A 1 200 PRO 200 241 241 PRO PRO A . n A 1 201 LYS 201 242 242 LYS LYS A . n A 1 202 ALA 202 243 243 ALA ALA A . n A 1 203 SER 203 244 244 SER SER A . n A 1 204 MET 204 245 245 MET MET A . n A 1 205 ILE 205 246 246 ILE ILE A . n A 1 206 VAL 206 247 247 VAL VAL A . n A 1 207 MET 207 248 248 MET MET A . n A 1 208 SER 208 249 249 SER SER A . n A 1 209 HIS 209 250 250 HIS HIS A . n A 1 210 SER 210 251 251 SER SER A . n A 1 211 ALA 211 252 252 ALA ALA A . n A 1 212 PRO 212 253 253 PRO PRO A . n A 1 213 ASP 213 254 254 ASP ASP A . n A 1 214 SER 214 255 255 SER SER A . n A 1 215 ARG 215 256 256 ARG ARG A . n A 1 216 ALA 216 257 257 ALA ALA A . n A 1 217 ALA 217 258 258 ALA ALA A . n A 1 218 ILE 218 259 259 ILE ILE A . n A 1 219 THR 219 260 260 THR THR A . n A 1 220 HIS 220 261 261 HIS HIS A . n A 1 221 THR 221 262 262 THR THR A . n A 1 222 ALA 222 263 263 ALA ALA A . n A 1 223 ARG 223 264 264 ARG ARG A . n A 1 224 MET 224 265 265 MET MET A . n A 1 225 ALA 225 266 266 ALA ALA A . n A 1 226 ASP 226 267 267 ASP ASP A . n A 1 227 LYS 227 268 268 LYS LYS A . n A 1 228 LEU 228 269 269 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 301 ZN ZN2 A . C 2 ZN 1 302 302 ZN ZN2 A . D 3 MYC 1 303 501 MYC MYC A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 700 ? 1 MORE -60 ? 1 'SSA (A^2)' 9610 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 79 ? A HIS 120 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 ND1 ? A HIS 81 ? A HIS 122 ? 1_555 108.0 ? 2 NE2 ? A HIS 79 ? A HIS 120 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 OD1 ? A ASP 83 ? A ASP 124 ? 1_555 114.2 ? 3 ND1 ? A HIS 81 ? A HIS 122 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 OD1 ? A ASP 83 ? A ASP 124 ? 1_555 133.1 ? 4 NE2 ? A HIS 79 ? A HIS 120 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O30 ? D MYC . ? A MYC 303 ? 1_555 134.9 ? 5 ND1 ? A HIS 81 ? A HIS 122 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O30 ? D MYC . ? A MYC 303 ? 1_555 77.9 ? 6 OD1 ? A ASP 83 ? A ASP 124 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O30 ? D MYC . ? A MYC 303 ? 1_555 86.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-01-13 2 'Structure model' 1 1 2021-03-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' # _pdbx_entry_details.entry_id 6TTC _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component NDM-1 _pdbx_nmr_exptl_sample.concentration 320 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units uM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 ZN A ZN 301 ? ? O13 A MYC 303 ? ? 1.48 2 1 OD2 A ASP 124 ? ? ZN A ZN 301 ? ? 1.68 3 2 ZN A ZN 301 ? ? O13 A MYC 303 ? ? 1.47 4 2 OD2 A ASP 90 ? ? HZ3 A LYS 125 ? ? 1.58 5 2 OD2 A ASP 124 ? ? ZN A ZN 301 ? ? 1.64 6 3 ZN A ZN 301 ? ? O13 A MYC 303 ? ? 1.47 7 3 OD2 A ASP 124 ? ? ZN A ZN 301 ? ? 1.65 8 4 ZN A ZN 301 ? ? O13 A MYC 303 ? ? 1.50 9 4 ZN A ZN 302 ? ? O13 A MYC 303 ? ? 1.51 10 4 OD2 A ASP 90 ? ? HZ3 A LYS 125 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 68 ? ? -57.80 106.70 2 1 ASP A 90 ? ? 71.27 164.33 3 1 LYS A 125 ? ? -142.82 -29.16 4 1 ASP A 202 ? ? -106.57 40.90 5 2 PHE A 70 ? ? -163.20 -62.15 6 2 ASP A 90 ? ? 74.15 131.82 7 2 THR A 226 ? ? -78.19 31.70 8 2 GLU A 227 ? ? -135.05 -49.55 9 3 PHE A 70 ? ? -136.92 -52.65 10 3 ASP A 90 ? ? 71.68 144.98 11 3 THR A 91 ? ? -107.12 -168.24 12 3 THR A 226 ? ? -88.81 37.64 13 3 GLU A 227 ? ? -146.35 -52.14 14 3 HIS A 250 ? ? -141.11 -70.33 15 4 PHE A 70 ? ? -152.18 -63.52 16 4 ASP A 90 ? ? 71.79 159.54 17 4 THR A 119 ? ? -79.42 -79.17 18 4 ALA A 174 ? ? -117.00 79.00 # _pdbx_audit_support.funding_organization 'French National Research Agency' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ANR-10-LABX-33 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 MYC ? ? MYC ? ? 'SUBJECT OF INVESTIGATION' ? 2 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 '3,5,7-TRIHYDROXY-2-(3,4,5-TRIHYDROXYPHENYL)-4H-CHROMEN-4-ONE' MYC # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #