data_6UAU # _entry.id 6UAU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6UAU pdb_00006uau 10.2210/pdb6uau/pdb WWPDB D_1000242890 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-05-20 2 'Structure model' 1 1 2020-06-10 3 'Structure model' 2 0 2020-07-29 4 'Structure model' 2 1 2020-08-05 5 'Structure model' 2 2 2024-03-13 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Structure summary' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' atom_site 4 3 'Structure model' chem_comp 5 3 'Structure model' entity 6 3 'Structure model' entity_name_com 7 3 'Structure model' pdbx_branch_scheme 8 3 'Structure model' pdbx_chem_comp_identifier 9 3 'Structure model' pdbx_entity_branch 10 3 'Structure model' pdbx_entity_branch_descriptor 11 3 'Structure model' pdbx_entity_branch_link 12 3 'Structure model' pdbx_entity_branch_list 13 3 'Structure model' pdbx_entity_nonpoly 14 3 'Structure model' pdbx_molecule_features 15 3 'Structure model' pdbx_nonpoly_scheme 16 3 'Structure model' pdbx_struct_assembly_gen 17 3 'Structure model' pdbx_struct_conn_angle 18 3 'Structure model' struct_asym 19 3 'Structure model' struct_conn 20 3 'Structure model' struct_conn_type 21 3 'Structure model' struct_site 22 3 'Structure model' struct_site_gen 23 4 'Structure model' citation 24 4 'Structure model' struct_conn 25 5 'Structure model' chem_comp 26 5 'Structure model' chem_comp_atom 27 5 'Structure model' chem_comp_bond 28 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_atom_site.auth_asym_id' 4 3 'Structure model' '_atom_site.auth_seq_id' 5 3 'Structure model' '_atom_site.label_asym_id' 6 3 'Structure model' '_atom_site.label_entity_id' 7 3 'Structure model' '_chem_comp.name' 8 3 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 16 3 'Structure model' '_pdbx_struct_conn_angle.value' 17 3 'Structure model' '_struct_conn.conn_type_id' 18 3 'Structure model' '_struct_conn.id' 19 3 'Structure model' '_struct_conn.pdbx_dist_value' 20 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 21 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 22 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 23 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 24 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 25 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 26 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 27 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 28 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 29 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 30 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 31 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 32 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 33 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 34 3 'Structure model' '_struct_conn.ptnr2_symmetry' 35 3 'Structure model' '_struct_conn_type.id' 36 4 'Structure model' '_citation.journal_volume' 37 4 'Structure model' '_citation.page_first' 38 4 'Structure model' '_citation.page_last' 39 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 40 5 'Structure model' '_chem_comp.pdbx_synonyms' 41 5 'Structure model' '_database_2.pdbx_DOI' 42 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6UAU _pdbx_database_status.recvd_initial_deposition_date 2019-09-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Vieira, P.S.' 1 ? 'Cabral, L.' 2 ? 'Costa, P.A.C.R.' 3 ? 'Santos, C.R.' 4 ? 'Murakami, M.T.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Chem.Biol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1552-4469 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 920 _citation.page_last 929 _citation.title 'Structural insights into beta-1,3-glucan cleavage by a glycoside hydrolase family.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41589-020-0554-5 _citation.pdbx_database_id_PubMed 32451508 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Santos, C.R.' 1 ? primary 'Costa, P.A.C.R.' 2 ? primary 'Vieira, P.S.' 3 ? primary 'Gonzalez, S.E.T.' 4 ? primary 'Correa, T.L.R.' 5 ? primary 'Lima, E.A.' 6 ? primary 'Mandelli, F.' 7 ? primary 'Pirolla, R.A.S.' 8 ? primary 'Domingues, M.N.' 9 ? primary 'Cabral, L.' 10 ? primary 'Martins, M.P.' 11 ? primary 'Cordeiro, R.L.' 12 ? primary 'Junior, A.T.' 13 ? primary 'Souza, B.P.' 14 ? primary 'Prates, E.T.' 15 ? primary 'Gozzo, F.C.' 16 ? primary 'Persinoti, G.F.' 17 ? primary 'Skaf, M.S.' 18 ? primary 'Murakami, M.T.' 19 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Glyco_hydro_cc domain-containing protein' 27859.891 1 ? E102A ? ? 2 branched man 'beta-D-glucopyranose-(1-3)-beta-D-glucopyranose' 342.297 1 ? ? ? ? 3 branched man 'beta-D-glucopyranose-(1-3)-beta-D-glucopyranose-(1-3)-beta-D-glucopyranose' 504.438 1 ? ? ? ? 4 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 5 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 1 ? ? ? ? 6 water nat water 18.015 258 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name beta-laminaribiose # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPAGSHMAGTKKGVSAAAFSGVTAALGDVGARWFYTWAADPQGITAPAGTEFVPMIWGRDSVTADQ LQRAKAAGSTLLAFNAPDLAGQANMSVETALDLWPQLQATGMRLGAPAVAYGGDTPGGWLDRFMSGAAARGYRVDFIPLH WYGGDFSAAATGQLQSYLQAVYNRYHRPIWLTEYALTDFSGSTPRYPSAAEQADFVSRSTAMLNGLSFVERYAWFSLSTS TTPTGLYTGTTPNSSGVAYRAAG ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPAGSHMAGTKKGVSAAAFSGVTAALGDVGARWFYTWAADPQGITAPAGTEFVPMIWGRDSVTADQ LQRAKAAGSTLLAFNAPDLAGQANMSVETALDLWPQLQATGMRLGAPAVAYGGDTPGGWLDRFMSGAAARGYRVDFIPLH WYGGDFSAAATGQLQSYLQAVYNRYHRPIWLTEYALTDFSGSTPRYPSAAEQADFVSRSTAMLNGLSFVERYAWFSLSTS TTPTGLYTGTTPNSSGVAYRAAG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 4 'ZINC ION' ZN 5 'DI(HYDROXYETHYL)ETHER' PEG 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ALA n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ALA n 1 23 GLY n 1 24 THR n 1 25 LYS n 1 26 LYS n 1 27 GLY n 1 28 VAL n 1 29 SER n 1 30 ALA n 1 31 ALA n 1 32 ALA n 1 33 PHE n 1 34 SER n 1 35 GLY n 1 36 VAL n 1 37 THR n 1 38 ALA n 1 39 ALA n 1 40 LEU n 1 41 GLY n 1 42 ASP n 1 43 VAL n 1 44 GLY n 1 45 ALA n 1 46 ARG n 1 47 TRP n 1 48 PHE n 1 49 TYR n 1 50 THR n 1 51 TRP n 1 52 ALA n 1 53 ALA n 1 54 ASP n 1 55 PRO n 1 56 GLN n 1 57 GLY n 1 58 ILE n 1 59 THR n 1 60 ALA n 1 61 PRO n 1 62 ALA n 1 63 GLY n 1 64 THR n 1 65 GLU n 1 66 PHE n 1 67 VAL n 1 68 PRO n 1 69 MET n 1 70 ILE n 1 71 TRP n 1 72 GLY n 1 73 ARG n 1 74 ASP n 1 75 SER n 1 76 VAL n 1 77 THR n 1 78 ALA n 1 79 ASP n 1 80 GLN n 1 81 LEU n 1 82 GLN n 1 83 ARG n 1 84 ALA n 1 85 LYS n 1 86 ALA n 1 87 ALA n 1 88 GLY n 1 89 SER n 1 90 THR n 1 91 LEU n 1 92 LEU n 1 93 ALA n 1 94 PHE n 1 95 ASN n 1 96 ALA n 1 97 PRO n 1 98 ASP n 1 99 LEU n 1 100 ALA n 1 101 GLY n 1 102 GLN n 1 103 ALA n 1 104 ASN n 1 105 MET n 1 106 SER n 1 107 VAL n 1 108 GLU n 1 109 THR n 1 110 ALA n 1 111 LEU n 1 112 ASP n 1 113 LEU n 1 114 TRP n 1 115 PRO n 1 116 GLN n 1 117 LEU n 1 118 GLN n 1 119 ALA n 1 120 THR n 1 121 GLY n 1 122 MET n 1 123 ARG n 1 124 LEU n 1 125 GLY n 1 126 ALA n 1 127 PRO n 1 128 ALA n 1 129 VAL n 1 130 ALA n 1 131 TYR n 1 132 GLY n 1 133 GLY n 1 134 ASP n 1 135 THR n 1 136 PRO n 1 137 GLY n 1 138 GLY n 1 139 TRP n 1 140 LEU n 1 141 ASP n 1 142 ARG n 1 143 PHE n 1 144 MET n 1 145 SER n 1 146 GLY n 1 147 ALA n 1 148 ALA n 1 149 ALA n 1 150 ARG n 1 151 GLY n 1 152 TYR n 1 153 ARG n 1 154 VAL n 1 155 ASP n 1 156 PHE n 1 157 ILE n 1 158 PRO n 1 159 LEU n 1 160 HIS n 1 161 TRP n 1 162 TYR n 1 163 GLY n 1 164 GLY n 1 165 ASP n 1 166 PHE n 1 167 SER n 1 168 ALA n 1 169 ALA n 1 170 ALA n 1 171 THR n 1 172 GLY n 1 173 GLN n 1 174 LEU n 1 175 GLN n 1 176 SER n 1 177 TYR n 1 178 LEU n 1 179 GLN n 1 180 ALA n 1 181 VAL n 1 182 TYR n 1 183 ASN n 1 184 ARG n 1 185 TYR n 1 186 HIS n 1 187 ARG n 1 188 PRO n 1 189 ILE n 1 190 TRP n 1 191 LEU n 1 192 THR n 1 193 GLU n 1 194 TYR n 1 195 ALA n 1 196 LEU n 1 197 THR n 1 198 ASP n 1 199 PHE n 1 200 SER n 1 201 GLY n 1 202 SER n 1 203 THR n 1 204 PRO n 1 205 ARG n 1 206 TYR n 1 207 PRO n 1 208 SER n 1 209 ALA n 1 210 ALA n 1 211 GLU n 1 212 GLN n 1 213 ALA n 1 214 ASP n 1 215 PHE n 1 216 VAL n 1 217 SER n 1 218 ARG n 1 219 SER n 1 220 THR n 1 221 ALA n 1 222 MET n 1 223 LEU n 1 224 ASN n 1 225 GLY n 1 226 LEU n 1 227 SER n 1 228 PHE n 1 229 VAL n 1 230 GLU n 1 231 ARG n 1 232 TYR n 1 233 ALA n 1 234 TRP n 1 235 PHE n 1 236 SER n 1 237 LEU n 1 238 SER n 1 239 THR n 1 240 SER n 1 241 THR n 1 242 THR n 1 243 PRO n 1 244 THR n 1 245 GLY n 1 246 LEU n 1 247 TYR n 1 248 THR n 1 249 GLY n 1 250 THR n 1 251 THR n 1 252 PRO n 1 253 ASN n 1 254 SER n 1 255 SER n 1 256 GLY n 1 257 VAL n 1 258 ALA n 1 259 TYR n 1 260 ARG n 1 261 ALA n 1 262 ALA n 1 263 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 263 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Amycolatopsis mediterranei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 33910 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _pdbx_entity_branch.entity_id _pdbx_entity_branch.type 2 oligosaccharide 3 oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpb1-3DGlcpb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5]/1-1/a3-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][b-D-Glcp]{[(3+1)][b-D-Glcp]{}}' LINUCS PDB-CARE ? 4 3 DGlcpb1-3DGlcpb1-3DGlcpb1-ROH 'Glycam Condensed Sequence' GMML 1.0 5 3 'WURCS=2.0/1,3,2/[a2122h-1b_1-5]/1-1-1/a3-b1_b3-c1' WURCS PDB2Glycan 1.1.0 6 3 '[][b-D-Glcp]{[(3+1)][b-D-Glcp]{[(3+1)][b-D-Glcp]{}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 BGC C1 O1 1 BGC O3 HO3 sing ? 2 3 2 BGC C1 O1 1 BGC O3 HO3 sing ? 3 3 3 BGC C1 O1 2 BGC O3 HO3 sing ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BGC 'D-saccharide, beta linking' . beta-D-glucopyranose 'beta-D-glucose; D-glucose; glucose' 'C6 H12 O6' 180.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BGC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpb BGC 'COMMON NAME' GMML 1.0 b-D-glucopyranose BGC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Glcp BGC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Glc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 7 ? ? ? A . n A 1 2 GLY 2 8 ? ? ? A . n A 1 3 SER 3 9 ? ? ? A . n A 1 4 SER 4 10 ? ? ? A . n A 1 5 HIS 5 11 ? ? ? A . n A 1 6 HIS 6 12 ? ? ? A . n A 1 7 HIS 7 13 ? ? ? A . n A 1 8 HIS 8 14 ? ? ? A . n A 1 9 HIS 9 15 ? ? ? A . n A 1 10 HIS 10 16 ? ? ? A . n A 1 11 SER 11 17 ? ? ? A . n A 1 12 SER 12 18 ? ? ? A . n A 1 13 GLY 13 19 ? ? ? A . n A 1 14 LEU 14 20 ? ? ? A . n A 1 15 VAL 15 21 ? ? ? A . n A 1 16 PRO 16 22 ? ? ? A . n A 1 17 ALA 17 23 ? ? ? A . n A 1 18 GLY 18 24 ? ? ? A . n A 1 19 SER 19 25 ? ? ? A . n A 1 20 HIS 20 26 ? ? ? A . n A 1 21 MET 21 27 ? ? ? A . n A 1 22 ALA 22 28 ? ? ? A . n A 1 23 GLY 23 29 29 GLY GLY A . n A 1 24 THR 24 30 30 THR THR A . n A 1 25 LYS 25 31 31 LYS LYS A . n A 1 26 LYS 26 32 32 LYS LYS A . n A 1 27 GLY 27 33 33 GLY GLY A . n A 1 28 VAL 28 34 34 VAL VAL A . n A 1 29 SER 29 35 35 SER SER A . n A 1 30 ALA 30 36 36 ALA ALA A . n A 1 31 ALA 31 37 37 ALA ALA A . n A 1 32 ALA 32 38 38 ALA ALA A . n A 1 33 PHE 33 39 39 PHE PHE A . n A 1 34 SER 34 40 40 SER SER A . n A 1 35 GLY 35 41 41 GLY GLY A . n A 1 36 VAL 36 42 42 VAL VAL A . n A 1 37 THR 37 43 43 THR THR A . n A 1 38 ALA 38 44 44 ALA ALA A . n A 1 39 ALA 39 45 45 ALA ALA A . n A 1 40 LEU 40 46 46 LEU LEU A . n A 1 41 GLY 41 47 47 GLY GLY A . n A 1 42 ASP 42 48 48 ASP ASP A . n A 1 43 VAL 43 49 49 VAL VAL A . n A 1 44 GLY 44 50 50 GLY GLY A . n A 1 45 ALA 45 51 51 ALA ALA A . n A 1 46 ARG 46 52 52 ARG ARG A . n A 1 47 TRP 47 53 53 TRP TRP A . n A 1 48 PHE 48 54 54 PHE PHE A . n A 1 49 TYR 49 55 55 TYR TYR A . n A 1 50 THR 50 56 56 THR THR A . n A 1 51 TRP 51 57 57 TRP TRP A . n A 1 52 ALA 52 58 58 ALA ALA A . n A 1 53 ALA 53 59 59 ALA ALA A . n A 1 54 ASP 54 60 60 ASP ASP A . n A 1 55 PRO 55 61 61 PRO PRO A . n A 1 56 GLN 56 62 62 GLN GLN A . n A 1 57 GLY 57 63 63 GLY GLY A . n A 1 58 ILE 58 64 64 ILE ILE A . n A 1 59 THR 59 65 65 THR THR A . n A 1 60 ALA 60 66 66 ALA ALA A . n A 1 61 PRO 61 67 67 PRO PRO A . n A 1 62 ALA 62 68 68 ALA ALA A . n A 1 63 GLY 63 69 69 GLY GLY A . n A 1 64 THR 64 70 70 THR THR A . n A 1 65 GLU 65 71 71 GLU GLU A . n A 1 66 PHE 66 72 72 PHE PHE A . n A 1 67 VAL 67 73 73 VAL VAL A . n A 1 68 PRO 68 74 74 PRO PRO A . n A 1 69 MET 69 75 75 MET MET A . n A 1 70 ILE 70 76 76 ILE ILE A . n A 1 71 TRP 71 77 77 TRP TRP A . n A 1 72 GLY 72 78 78 GLY GLY A . n A 1 73 ARG 73 79 79 ARG ARG A . n A 1 74 ASP 74 80 80 ASP ASP A . n A 1 75 SER 75 81 81 SER SER A . n A 1 76 VAL 76 82 82 VAL VAL A . n A 1 77 THR 77 83 83 THR THR A . n A 1 78 ALA 78 84 84 ALA ALA A . n A 1 79 ASP 79 85 85 ASP ASP A . n A 1 80 GLN 80 86 86 GLN GLN A . n A 1 81 LEU 81 87 87 LEU LEU A . n A 1 82 GLN 82 88 88 GLN GLN A . n A 1 83 ARG 83 89 89 ARG ARG A . n A 1 84 ALA 84 90 90 ALA ALA A . n A 1 85 LYS 85 91 91 LYS LYS A . n A 1 86 ALA 86 92 92 ALA ALA A . n A 1 87 ALA 87 93 93 ALA ALA A . n A 1 88 GLY 88 94 94 GLY GLY A . n A 1 89 SER 89 95 95 SER SER A . n A 1 90 THR 90 96 96 THR THR A . n A 1 91 LEU 91 97 97 LEU LEU A . n A 1 92 LEU 92 98 98 LEU LEU A . n A 1 93 ALA 93 99 99 ALA ALA A . n A 1 94 PHE 94 100 100 PHE PHE A . n A 1 95 ASN 95 101 101 ASN ASN A . n A 1 96 ALA 96 102 102 ALA ALA A . n A 1 97 PRO 97 103 103 PRO PRO A . n A 1 98 ASP 98 104 104 ASP ASP A . n A 1 99 LEU 99 105 105 LEU LEU A . n A 1 100 ALA 100 106 106 ALA ALA A . n A 1 101 GLY 101 107 107 GLY GLY A . n A 1 102 GLN 102 108 108 GLN GLN A . n A 1 103 ALA 103 109 109 ALA ALA A . n A 1 104 ASN 104 110 110 ASN ASN A . n A 1 105 MET 105 111 111 MET MET A . n A 1 106 SER 106 112 112 SER SER A . n A 1 107 VAL 107 113 113 VAL VAL A . n A 1 108 GLU 108 114 114 GLU GLU A . n A 1 109 THR 109 115 115 THR THR A . n A 1 110 ALA 110 116 116 ALA ALA A . n A 1 111 LEU 111 117 117 LEU LEU A . n A 1 112 ASP 112 118 118 ASP ASP A . n A 1 113 LEU 113 119 119 LEU LEU A . n A 1 114 TRP 114 120 120 TRP TRP A . n A 1 115 PRO 115 121 121 PRO PRO A . n A 1 116 GLN 116 122 122 GLN GLN A . n A 1 117 LEU 117 123 123 LEU LEU A . n A 1 118 GLN 118 124 124 GLN GLN A . n A 1 119 ALA 119 125 125 ALA ALA A . n A 1 120 THR 120 126 126 THR THR A . n A 1 121 GLY 121 127 127 GLY GLY A . n A 1 122 MET 122 128 128 MET MET A . n A 1 123 ARG 123 129 129 ARG ARG A . n A 1 124 LEU 124 130 130 LEU LEU A . n A 1 125 GLY 125 131 131 GLY GLY A . n A 1 126 ALA 126 132 132 ALA ALA A . n A 1 127 PRO 127 133 133 PRO PRO A . n A 1 128 ALA 128 134 134 ALA ALA A . n A 1 129 VAL 129 135 135 VAL VAL A . n A 1 130 ALA 130 136 136 ALA ALA A . n A 1 131 TYR 131 137 137 TYR TYR A . n A 1 132 GLY 132 138 138 GLY GLY A . n A 1 133 GLY 133 139 139 GLY GLY A . n A 1 134 ASP 134 140 140 ASP ASP A . n A 1 135 THR 135 141 141 THR THR A . n A 1 136 PRO 136 142 142 PRO PRO A . n A 1 137 GLY 137 143 143 GLY GLY A . n A 1 138 GLY 138 144 144 GLY GLY A . n A 1 139 TRP 139 145 145 TRP TRP A . n A 1 140 LEU 140 146 146 LEU LEU A . n A 1 141 ASP 141 147 147 ASP ASP A . n A 1 142 ARG 142 148 148 ARG ARG A . n A 1 143 PHE 143 149 149 PHE PHE A . n A 1 144 MET 144 150 150 MET MET A . n A 1 145 SER 145 151 151 SER SER A . n A 1 146 GLY 146 152 152 GLY GLY A . n A 1 147 ALA 147 153 153 ALA ALA A . n A 1 148 ALA 148 154 154 ALA ALA A . n A 1 149 ALA 149 155 155 ALA ALA A . n A 1 150 ARG 150 156 156 ARG ARG A . n A 1 151 GLY 151 157 157 GLY GLY A . n A 1 152 TYR 152 158 158 TYR TYR A . n A 1 153 ARG 153 159 159 ARG ARG A . n A 1 154 VAL 154 160 160 VAL VAL A . n A 1 155 ASP 155 161 161 ASP ASP A . n A 1 156 PHE 156 162 162 PHE PHE A . n A 1 157 ILE 157 163 163 ILE ILE A . n A 1 158 PRO 158 164 164 PRO PRO A . n A 1 159 LEU 159 165 165 LEU LEU A . n A 1 160 HIS 160 166 166 HIS HIS A . n A 1 161 TRP 161 167 167 TRP TRP A . n A 1 162 TYR 162 168 168 TYR TYR A . n A 1 163 GLY 163 169 169 GLY GLY A . n A 1 164 GLY 164 170 170 GLY GLY A . n A 1 165 ASP 165 171 171 ASP ASP A . n A 1 166 PHE 166 172 172 PHE PHE A . n A 1 167 SER 167 173 173 SER SER A . n A 1 168 ALA 168 174 174 ALA ALA A . n A 1 169 ALA 169 175 175 ALA ALA A . n A 1 170 ALA 170 176 176 ALA ALA A . n A 1 171 THR 171 177 177 THR THR A . n A 1 172 GLY 172 178 178 GLY GLY A . n A 1 173 GLN 173 179 179 GLN GLN A . n A 1 174 LEU 174 180 180 LEU LEU A . n A 1 175 GLN 175 181 181 GLN GLN A . n A 1 176 SER 176 182 182 SER SER A . n A 1 177 TYR 177 183 183 TYR TYR A . n A 1 178 LEU 178 184 184 LEU LEU A . n A 1 179 GLN 179 185 185 GLN GLN A . n A 1 180 ALA 180 186 186 ALA ALA A . n A 1 181 VAL 181 187 187 VAL VAL A . n A 1 182 TYR 182 188 188 TYR TYR A . n A 1 183 ASN 183 189 189 ASN ASN A . n A 1 184 ARG 184 190 190 ARG ARG A . n A 1 185 TYR 185 191 191 TYR TYR A . n A 1 186 HIS 186 192 192 HIS HIS A . n A 1 187 ARG 187 193 193 ARG ARG A . n A 1 188 PRO 188 194 194 PRO PRO A . n A 1 189 ILE 189 195 195 ILE ILE A . n A 1 190 TRP 190 196 196 TRP TRP A . n A 1 191 LEU 191 197 197 LEU LEU A . n A 1 192 THR 192 198 198 THR THR A . n A 1 193 GLU 193 199 199 GLU GLU A . n A 1 194 TYR 194 200 200 TYR TYR A . n A 1 195 ALA 195 201 201 ALA ALA A . n A 1 196 LEU 196 202 202 LEU LEU A . n A 1 197 THR 197 203 203 THR THR A . n A 1 198 ASP 198 204 204 ASP ASP A . n A 1 199 PHE 199 205 205 PHE PHE A . n A 1 200 SER 200 206 206 SER SER A . n A 1 201 GLY 201 207 207 GLY GLY A . n A 1 202 SER 202 208 208 SER SER A . n A 1 203 THR 203 209 209 THR THR A . n A 1 204 PRO 204 210 210 PRO PRO A . n A 1 205 ARG 205 211 211 ARG ARG A . n A 1 206 TYR 206 212 212 TYR TYR A . n A 1 207 PRO 207 213 213 PRO PRO A . n A 1 208 SER 208 214 214 SER SER A . n A 1 209 ALA 209 215 215 ALA ALA A . n A 1 210 ALA 210 216 216 ALA ALA A . n A 1 211 GLU 211 217 217 GLU GLU A . n A 1 212 GLN 212 218 218 GLN GLN A . n A 1 213 ALA 213 219 219 ALA ALA A . n A 1 214 ASP 214 220 220 ASP ASP A . n A 1 215 PHE 215 221 221 PHE PHE A . n A 1 216 VAL 216 222 222 VAL VAL A . n A 1 217 SER 217 223 223 SER SER A . n A 1 218 ARG 218 224 224 ARG ARG A . n A 1 219 SER 219 225 225 SER SER A . n A 1 220 THR 220 226 226 THR THR A . n A 1 221 ALA 221 227 227 ALA ALA A . n A 1 222 MET 222 228 228 MET MET A . n A 1 223 LEU 223 229 229 LEU LEU A . n A 1 224 ASN 224 230 230 ASN ASN A . n A 1 225 GLY 225 231 231 GLY GLY A . n A 1 226 LEU 226 232 232 LEU LEU A . n A 1 227 SER 227 233 233 SER SER A . n A 1 228 PHE 228 234 234 PHE PHE A . n A 1 229 VAL 229 235 235 VAL VAL A . n A 1 230 GLU 230 236 236 GLU GLU A . n A 1 231 ARG 231 237 237 ARG ARG A . n A 1 232 TYR 232 238 238 TYR TYR A . n A 1 233 ALA 233 239 239 ALA ALA A . n A 1 234 TRP 234 240 240 TRP TRP A . n A 1 235 PHE 235 241 241 PHE PHE A . n A 1 236 SER 236 242 242 SER SER A . n A 1 237 LEU 237 243 243 LEU LEU A . n A 1 238 SER 238 244 244 SER SER A . n A 1 239 THR 239 245 245 THR THR A . n A 1 240 SER 240 246 246 SER SER A . n A 1 241 THR 241 247 247 THR THR A . n A 1 242 THR 242 248 248 THR THR A . n A 1 243 PRO 243 249 249 PRO PRO A . n A 1 244 THR 244 250 250 THR THR A . n A 1 245 GLY 245 251 251 GLY GLY A . n A 1 246 LEU 246 252 252 LEU LEU A . n A 1 247 TYR 247 253 253 TYR TYR A . n A 1 248 THR 248 254 254 THR THR A . n A 1 249 GLY 249 255 255 GLY GLY A . n A 1 250 THR 250 256 256 THR THR A . n A 1 251 THR 251 257 257 THR THR A . n A 1 252 PRO 252 258 258 PRO PRO A . n A 1 253 ASN 253 259 259 ASN ASN A . n A 1 254 SER 254 260 260 SER SER A . n A 1 255 SER 255 261 261 SER SER A . n A 1 256 GLY 256 262 262 GLY GLY A . n A 1 257 VAL 257 263 263 VAL VAL A . n A 1 258 ALA 258 264 264 ALA ALA A . n A 1 259 TYR 259 265 265 TYR TYR A . n A 1 260 ARG 260 266 266 ARG ARG A . n A 1 261 ALA 261 267 267 ALA ALA A . n A 1 262 ALA 262 268 268 ALA ALA A . n A 1 263 GLY 263 269 269 GLY GLY A . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 BGC 1 B BGC 1 A BGC 301 n B 2 BGC 2 B BGC 2 A BGC 302 n C 3 BGC 1 C BGC 1 A BGC 303 n C 3 BGC 2 C BGC 2 A BGC 304 n C 3 BGC 3 C BGC 3 A BGC 305 n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 4 ZN 1 306 401 ZN ZN A . E 5 PEG 1 307 501 PEG PEG A . F 6 HOH 1 401 97 HOH HOH A . F 6 HOH 2 402 143 HOH HOH A . F 6 HOH 3 403 107 HOH HOH A . F 6 HOH 4 404 126 HOH HOH A . F 6 HOH 5 405 187 HOH HOH A . F 6 HOH 6 406 157 HOH HOH A . F 6 HOH 7 407 189 HOH HOH A . F 6 HOH 8 408 234 HOH HOH A . F 6 HOH 9 409 82 HOH HOH A . F 6 HOH 10 410 207 HOH HOH A . F 6 HOH 11 411 101 HOH HOH A . F 6 HOH 12 412 3 HOH HOH A . F 6 HOH 13 413 203 HOH HOH A . F 6 HOH 14 414 208 HOH HOH A . F 6 HOH 15 415 238 HOH HOH A . F 6 HOH 16 416 183 HOH HOH A . F 6 HOH 17 417 216 HOH HOH A . F 6 HOH 18 418 246 HOH HOH A . F 6 HOH 19 419 96 HOH HOH A . F 6 HOH 20 420 72 HOH HOH A . F 6 HOH 21 421 91 HOH HOH A . F 6 HOH 22 422 11 HOH HOH A . F 6 HOH 23 423 89 HOH HOH A . F 6 HOH 24 424 70 HOH HOH A . F 6 HOH 25 425 240 HOH HOH A . F 6 HOH 26 426 104 HOH HOH A . F 6 HOH 27 427 118 HOH HOH A . F 6 HOH 28 428 61 HOH HOH A . F 6 HOH 29 429 79 HOH HOH A . F 6 HOH 30 430 49 HOH HOH A . F 6 HOH 31 431 84 HOH HOH A . F 6 HOH 32 432 8 HOH HOH A . F 6 HOH 33 433 16 HOH HOH A . F 6 HOH 34 434 200 HOH HOH A . F 6 HOH 35 435 75 HOH HOH A . F 6 HOH 36 436 62 HOH HOH A . F 6 HOH 37 437 10 HOH HOH A . F 6 HOH 38 438 33 HOH HOH A . F 6 HOH 39 439 102 HOH HOH A . F 6 HOH 40 440 28 HOH HOH A . F 6 HOH 41 441 154 HOH HOH A . F 6 HOH 42 442 66 HOH HOH A . F 6 HOH 43 443 87 HOH HOH A . F 6 HOH 44 444 159 HOH HOH A . F 6 HOH 45 445 26 HOH HOH A . F 6 HOH 46 446 150 HOH HOH A . F 6 HOH 47 447 14 HOH HOH A . F 6 HOH 48 448 156 HOH HOH A . F 6 HOH 49 449 40 HOH HOH A . F 6 HOH 50 450 50 HOH HOH A . F 6 HOH 51 451 230 HOH HOH A . F 6 HOH 52 452 167 HOH HOH A . F 6 HOH 53 453 54 HOH HOH A . F 6 HOH 54 454 56 HOH HOH A . F 6 HOH 55 455 199 HOH HOH A . F 6 HOH 56 456 202 HOH HOH A . F 6 HOH 57 457 172 HOH HOH A . F 6 HOH 58 458 136 HOH HOH A . F 6 HOH 59 459 60 HOH HOH A . F 6 HOH 60 460 37 HOH HOH A . F 6 HOH 61 461 108 HOH HOH A . F 6 HOH 62 462 115 HOH HOH A . F 6 HOH 63 463 214 HOH HOH A . F 6 HOH 64 464 30 HOH HOH A . F 6 HOH 65 465 68 HOH HOH A . F 6 HOH 66 466 148 HOH HOH A . F 6 HOH 67 467 171 HOH HOH A . F 6 HOH 68 468 213 HOH HOH A . F 6 HOH 69 469 21 HOH HOH A . F 6 HOH 70 470 69 HOH HOH A . F 6 HOH 71 471 93 HOH HOH A . F 6 HOH 72 472 111 HOH HOH A . F 6 HOH 73 473 47 HOH HOH A . F 6 HOH 74 474 147 HOH HOH A . F 6 HOH 75 475 163 HOH HOH A . F 6 HOH 76 476 110 HOH HOH A . F 6 HOH 77 477 145 HOH HOH A . F 6 HOH 78 478 137 HOH HOH A . F 6 HOH 79 479 158 HOH HOH A . F 6 HOH 80 480 51 HOH HOH A . F 6 HOH 81 481 31 HOH HOH A . F 6 HOH 82 482 36 HOH HOH A . F 6 HOH 83 483 29 HOH HOH A . F 6 HOH 84 484 135 HOH HOH A . F 6 HOH 85 485 94 HOH HOH A . F 6 HOH 86 486 100 HOH HOH A . F 6 HOH 87 487 7 HOH HOH A . F 6 HOH 88 488 92 HOH HOH A . F 6 HOH 89 489 144 HOH HOH A . F 6 HOH 90 490 20 HOH HOH A . F 6 HOH 91 491 57 HOH HOH A . F 6 HOH 92 492 19 HOH HOH A . F 6 HOH 93 493 184 HOH HOH A . F 6 HOH 94 494 23 HOH HOH A . F 6 HOH 95 495 52 HOH HOH A . F 6 HOH 96 496 162 HOH HOH A . F 6 HOH 97 497 258 HOH HOH A . F 6 HOH 98 498 15 HOH HOH A . F 6 HOH 99 499 12 HOH HOH A . F 6 HOH 100 500 166 HOH HOH A . F 6 HOH 101 501 210 HOH HOH A . F 6 HOH 102 502 125 HOH HOH A . F 6 HOH 103 503 6 HOH HOH A . F 6 HOH 104 504 22 HOH HOH A . F 6 HOH 105 505 65 HOH HOH A . F 6 HOH 106 506 114 HOH HOH A . F 6 HOH 107 507 5 HOH HOH A . F 6 HOH 108 508 55 HOH HOH A . F 6 HOH 109 509 71 HOH HOH A . F 6 HOH 110 510 88 HOH HOH A . F 6 HOH 111 511 155 HOH HOH A . F 6 HOH 112 512 140 HOH HOH A . F 6 HOH 113 513 25 HOH HOH A . F 6 HOH 114 514 119 HOH HOH A . F 6 HOH 115 515 105 HOH HOH A . F 6 HOH 116 516 109 HOH HOH A . F 6 HOH 117 517 188 HOH HOH A . F 6 HOH 118 518 27 HOH HOH A . F 6 HOH 119 519 131 HOH HOH A . F 6 HOH 120 520 128 HOH HOH A . F 6 HOH 121 521 4 HOH HOH A . F 6 HOH 122 522 99 HOH HOH A . F 6 HOH 123 523 83 HOH HOH A . F 6 HOH 124 524 78 HOH HOH A . F 6 HOH 125 525 90 HOH HOH A . F 6 HOH 126 526 41 HOH HOH A . F 6 HOH 127 527 254 HOH HOH A . F 6 HOH 128 528 242 HOH HOH A . F 6 HOH 129 529 241 HOH HOH A . F 6 HOH 130 530 48 HOH HOH A . F 6 HOH 131 531 86 HOH HOH A . F 6 HOH 132 532 85 HOH HOH A . F 6 HOH 133 533 42 HOH HOH A . F 6 HOH 134 534 212 HOH HOH A . F 6 HOH 135 535 190 HOH HOH A . F 6 HOH 136 536 77 HOH HOH A . F 6 HOH 137 537 177 HOH HOH A . F 6 HOH 138 538 24 HOH HOH A . F 6 HOH 139 539 173 HOH HOH A . F 6 HOH 140 540 117 HOH HOH A . F 6 HOH 141 541 38 HOH HOH A . F 6 HOH 142 542 17 HOH HOH A . F 6 HOH 143 543 221 HOH HOH A . F 6 HOH 144 544 35 HOH HOH A . F 6 HOH 145 545 32 HOH HOH A . F 6 HOH 146 546 103 HOH HOH A . F 6 HOH 147 547 164 HOH HOH A . F 6 HOH 148 548 129 HOH HOH A . F 6 HOH 149 549 134 HOH HOH A . F 6 HOH 150 550 98 HOH HOH A . F 6 HOH 151 551 120 HOH HOH A . F 6 HOH 152 552 178 HOH HOH A . F 6 HOH 153 553 18 HOH HOH A . F 6 HOH 154 554 127 HOH HOH A . F 6 HOH 155 555 63 HOH HOH A . F 6 HOH 156 556 257 HOH HOH A . F 6 HOH 157 557 186 HOH HOH A . F 6 HOH 158 558 64 HOH HOH A . F 6 HOH 159 559 160 HOH HOH A . F 6 HOH 160 560 176 HOH HOH A . F 6 HOH 161 561 80 HOH HOH A . F 6 HOH 162 562 222 HOH HOH A . F 6 HOH 163 563 59 HOH HOH A . F 6 HOH 164 564 13 HOH HOH A . F 6 HOH 165 565 67 HOH HOH A . F 6 HOH 166 566 233 HOH HOH A . F 6 HOH 167 567 185 HOH HOH A . F 6 HOH 168 568 9 HOH HOH A . F 6 HOH 169 569 58 HOH HOH A . F 6 HOH 170 570 116 HOH HOH A . F 6 HOH 171 571 151 HOH HOH A . F 6 HOH 172 572 165 HOH HOH A . F 6 HOH 173 573 175 HOH HOH A . F 6 HOH 174 574 217 HOH HOH A . F 6 HOH 175 575 205 HOH HOH A . F 6 HOH 176 576 209 HOH HOH A . F 6 HOH 177 577 182 HOH HOH A . F 6 HOH 178 578 133 HOH HOH A . F 6 HOH 179 579 53 HOH HOH A . F 6 HOH 180 580 2 HOH HOH A . F 6 HOH 181 581 142 HOH HOH A . F 6 HOH 182 582 245 HOH HOH A . F 6 HOH 183 583 197 HOH HOH A . F 6 HOH 184 584 256 HOH HOH A . F 6 HOH 185 585 227 HOH HOH A . F 6 HOH 186 586 228 HOH HOH A . F 6 HOH 187 587 201 HOH HOH A . F 6 HOH 188 588 215 HOH HOH A . F 6 HOH 189 589 45 HOH HOH A . F 6 HOH 190 590 34 HOH HOH A . F 6 HOH 191 591 239 HOH HOH A . F 6 HOH 192 592 237 HOH HOH A . F 6 HOH 193 593 73 HOH HOH A . F 6 HOH 194 594 196 HOH HOH A . F 6 HOH 195 595 192 HOH HOH A . F 6 HOH 196 596 81 HOH HOH A . F 6 HOH 197 597 229 HOH HOH A . F 6 HOH 198 598 46 HOH HOH A . F 6 HOH 199 599 224 HOH HOH A . F 6 HOH 200 600 206 HOH HOH A . F 6 HOH 201 601 179 HOH HOH A . F 6 HOH 202 602 235 HOH HOH A . F 6 HOH 203 603 112 HOH HOH A . F 6 HOH 204 604 232 HOH HOH A . F 6 HOH 205 605 122 HOH HOH A . F 6 HOH 206 606 243 HOH HOH A . F 6 HOH 207 607 74 HOH HOH A . F 6 HOH 208 608 139 HOH HOH A . F 6 HOH 209 609 95 HOH HOH A . F 6 HOH 210 610 1 HOH HOH A . F 6 HOH 211 611 247 HOH HOH A . F 6 HOH 212 612 121 HOH HOH A . F 6 HOH 213 613 152 HOH HOH A . F 6 HOH 214 614 191 HOH HOH A . F 6 HOH 215 615 149 HOH HOH A . F 6 HOH 216 616 225 HOH HOH A . F 6 HOH 217 617 251 HOH HOH A . F 6 HOH 218 618 76 HOH HOH A . F 6 HOH 219 619 123 HOH HOH A . F 6 HOH 220 620 132 HOH HOH A . F 6 HOH 221 621 252 HOH HOH A . F 6 HOH 222 622 248 HOH HOH A . F 6 HOH 223 623 170 HOH HOH A . F 6 HOH 224 624 174 HOH HOH A . F 6 HOH 225 625 161 HOH HOH A . F 6 HOH 226 626 226 HOH HOH A . F 6 HOH 227 627 113 HOH HOH A . F 6 HOH 228 628 255 HOH HOH A . F 6 HOH 229 629 231 HOH HOH A . F 6 HOH 230 630 253 HOH HOH A . F 6 HOH 231 631 153 HOH HOH A . F 6 HOH 232 632 193 HOH HOH A . F 6 HOH 233 633 146 HOH HOH A . F 6 HOH 234 634 219 HOH HOH A . F 6 HOH 235 635 198 HOH HOH A . F 6 HOH 236 636 249 HOH HOH A . F 6 HOH 237 637 181 HOH HOH A . F 6 HOH 238 638 130 HOH HOH A . F 6 HOH 239 639 180 HOH HOH A . F 6 HOH 240 640 43 HOH HOH A . F 6 HOH 241 641 220 HOH HOH A . F 6 HOH 242 642 39 HOH HOH A . F 6 HOH 243 643 250 HOH HOH A . F 6 HOH 244 644 169 HOH HOH A . F 6 HOH 245 645 223 HOH HOH A . F 6 HOH 246 646 204 HOH HOH A . F 6 HOH 247 647 141 HOH HOH A . F 6 HOH 248 648 211 HOH HOH A . F 6 HOH 249 649 106 HOH HOH A . F 6 HOH 250 650 44 HOH HOH A . F 6 HOH 251 651 195 HOH HOH A . F 6 HOH 252 652 236 HOH HOH A . F 6 HOH 253 653 218 HOH HOH A . F 6 HOH 254 654 124 HOH HOH A . F 6 HOH 255 655 168 HOH HOH A . F 6 HOH 256 656 138 HOH HOH A . F 6 HOH 257 657 244 HOH HOH A . F 6 HOH 258 658 194 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 101.770 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6UAU _cell.details ? _cell.formula_units_Z ? _cell.length_a 38.991 _cell.length_a_esd ? _cell.length_b 79.054 _cell.length_b_esd ? _cell.length_c 46.960 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6UAU _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6UAU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.77 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.61 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Zinc Chloride 0.01 M PEG 6000 15% Sodium acetate 0.1 M ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-11-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.458 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'LNLS BEAMLINE W01B-MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.458 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline W01B-MX2 _diffrn_source.pdbx_synchrotron_site LNLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6UAU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.897 _reflns.d_resolution_low 45.98 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21936 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.82 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.54 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_R_split ? _reflns.pdbx_CC_star ? # _reflns_shell.d_res_high 1.897 _reflns_shell.d_res_low 2.01 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3478 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.670 _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_CC_star ? # _refine.aniso_B[1][1] -0.0300 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0100 _refine.aniso_B[2][2] 0.0000 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] 0.0300 _refine.B_iso_max 52.530 _refine.B_iso_mean 20.5630 _refine.B_iso_min 12.700 _refine.correlation_coeff_Fo_to_Fc 0.9490 _refine.correlation_coeff_Fo_to_Fc_free 0.9180 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6UAU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9000 _refine.ls_d_res_low 45.9700 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20722 _refine.ls_number_reflns_R_free 1073 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.4600 _refine.ls_percent_reflns_R_free 4.9000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1998 _refine.ls_R_factor_R_free 0.2318 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1982 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1610 _refine.pdbx_overall_ESU_R_Free 0.1440 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.9000 _refine_hist.d_res_low 45.9700 _refine_hist.number_atoms_solvent 258 _refine_hist.number_atoms_total 2132 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 241 _refine_hist.pdbx_B_iso_mean_ligand 30.71 _refine_hist.pdbx_B_iso_mean_solvent 31.09 _refine_hist.pdbx_number_atoms_protein 1809 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 65 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 0.013 1928 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.036 0.017 1694 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.358 1.689 2639 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 2.400 1.608 3901 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.039 5.000 240 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.542 20.659 91 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.460 15.000 245 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.657 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.055 0.200 265 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 2172 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 447 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.681 2.125 963 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 0.680 2.123 961 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.219 3.183 1202 ? r_mcangle_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.90 _refine_ls_shell.d_res_low 1.9460 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 62 _refine_ls_shell.number_reflns_R_work 1406 _refine_ls_shell.percent_reflns_obs 88.3800 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.7180 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.5610 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6UAU _struct.title ;Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose and laminaribiose ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6UAU _struct_keywords.text 'Glycosyl hydrolase, CARBOHYDRATE, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code G0FQ07_AMYMS _struct_ref.pdbx_db_accession G0FQ07 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AGTKKGVSAAAFSGVTAALGDVGARWFYTWAADPQGITAPAGTEFVPMIWGRDSVTADQLQRAKAAGSTLLAFNEPDLAG QANMSVETALDLWPQLQATGMRLGAPAVAYGGDTPGGWLDRFMSGAAARGYRVDFIPLHWYGGDFSAAATGQLQSYLQAV YNRYHRPIWLTEYALTDFSGSTPRYPSAAEQADFVSRSTAMLNGLSFVERYAWFSLSTSTTPTGLYTGTTPNSSGVAYRA AG ; _struct_ref.pdbx_align_begin 28 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6UAU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 263 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession G0FQ07 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 269 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 28 _struct_ref_seq.pdbx_auth_seq_align_end 269 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6UAU MET A 1 ? UNP G0FQ07 ? ? 'initiating methionine' 7 1 1 6UAU GLY A 2 ? UNP G0FQ07 ? ? 'expression tag' 8 2 1 6UAU SER A 3 ? UNP G0FQ07 ? ? 'expression tag' 9 3 1 6UAU SER A 4 ? UNP G0FQ07 ? ? 'expression tag' 10 4 1 6UAU HIS A 5 ? UNP G0FQ07 ? ? 'expression tag' 11 5 1 6UAU HIS A 6 ? UNP G0FQ07 ? ? 'expression tag' 12 6 1 6UAU HIS A 7 ? UNP G0FQ07 ? ? 'expression tag' 13 7 1 6UAU HIS A 8 ? UNP G0FQ07 ? ? 'expression tag' 14 8 1 6UAU HIS A 9 ? UNP G0FQ07 ? ? 'expression tag' 15 9 1 6UAU HIS A 10 ? UNP G0FQ07 ? ? 'expression tag' 16 10 1 6UAU SER A 11 ? UNP G0FQ07 ? ? 'expression tag' 17 11 1 6UAU SER A 12 ? UNP G0FQ07 ? ? 'expression tag' 18 12 1 6UAU GLY A 13 ? UNP G0FQ07 ? ? 'expression tag' 19 13 1 6UAU LEU A 14 ? UNP G0FQ07 ? ? 'expression tag' 20 14 1 6UAU VAL A 15 ? UNP G0FQ07 ? ? 'expression tag' 21 15 1 6UAU PRO A 16 ? UNP G0FQ07 ? ? 'expression tag' 22 16 1 6UAU ALA A 17 ? UNP G0FQ07 ? ? 'expression tag' 23 17 1 6UAU GLY A 18 ? UNP G0FQ07 ? ? 'expression tag' 24 18 1 6UAU SER A 19 ? UNP G0FQ07 ? ? 'expression tag' 25 19 1 6UAU HIS A 20 ? UNP G0FQ07 ? ? 'expression tag' 26 20 1 6UAU MET A 21 ? UNP G0FQ07 ? ? 'expression tag' 27 21 1 6UAU ALA A 96 ? UNP G0FQ07 GLU 102 'engineered mutation' 102 22 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 35 ? GLY A 44 ? GLY A 41 GLY A 50 1 ? 10 HELX_P HELX_P2 AA2 GLY A 72 ? VAL A 76 ? GLY A 78 VAL A 82 5 ? 5 HELX_P HELX_P3 AA3 THR A 77 ? GLY A 88 ? THR A 83 GLY A 94 1 ? 12 HELX_P HELX_P4 AA4 SER A 106 ? ALA A 119 ? SER A 112 ALA A 125 1 ? 14 HELX_P HELX_P5 AA5 GLY A 138 ? GLY A 151 ? GLY A 144 GLY A 157 1 ? 14 HELX_P HELX_P6 AA6 ALA A 169 ? HIS A 186 ? ALA A 175 HIS A 192 1 ? 18 HELX_P HELX_P7 AA7 SER A 208 ? LEU A 226 ? SER A 214 LEU A 232 1 ? 19 HELX_P HELX_P8 AA8 ASN A 253 ? ALA A 262 ? ASN A 259 ALA A 268 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B BGC . O3 ? ? ? 1_555 B BGC . C1 ? ? B BGC 1 B BGC 2 1_555 ? ? ? ? ? ? ? 1.448 ? ? covale2 covale both ? C BGC . O3 ? ? ? 1_555 C BGC . C1 ? ? C BGC 1 C BGC 2 1_555 ? ? ? ? ? ? ? 1.442 ? ? covale3 covale both ? C BGC . O3 ? ? ? 1_555 C BGC . C1 ? ? C BGC 2 C BGC 3 1_555 ? ? ? ? ? ? ? 1.430 ? ? metalc1 metalc ? ? A GLU 108 OE2 ? ? ? 1_555 D ZN . ZN ? ? A GLU 114 A ZN 306 1_555 ? ? ? ? ? ? ? 2.273 ? ? metalc2 metalc ? ? A ASP 112 OD2 ? ? ? 1_555 D ZN . ZN ? ? A ASP 118 A ZN 306 1_555 ? ? ? ? ? ? ? 2.150 ? ? metalc3 metalc ? ? D ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 306 A HOH 598 1_554 ? ? ? ? ? ? ? 2.371 ? ? metalc4 metalc ? ? D ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 306 A HOH 610 1_555 ? ? ? ? ? ? ? 2.474 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 108 ? A GLU 114 ? 1_555 ZN ? D ZN . ? A ZN 306 ? 1_555 OD2 ? A ASP 112 ? A ASP 118 ? 1_555 105.5 ? 2 OE2 ? A GLU 108 ? A GLU 114 ? 1_555 ZN ? D ZN . ? A ZN 306 ? 1_555 O ? F HOH . ? A HOH 598 ? 1_554 116.6 ? 3 OD2 ? A ASP 112 ? A ASP 118 ? 1_555 ZN ? D ZN . ? A ZN 306 ? 1_555 O ? F HOH . ? A HOH 598 ? 1_554 106.4 ? 4 OE2 ? A GLU 108 ? A GLU 114 ? 1_555 ZN ? D ZN . ? A ZN 306 ? 1_555 O ? F HOH . ? A HOH 610 ? 1_555 113.4 ? 5 OD2 ? A ASP 112 ? A ASP 118 ? 1_555 ZN ? D ZN . ? A ZN 306 ? 1_555 O ? F HOH . ? A HOH 610 ? 1_555 110.2 ? 6 O ? F HOH . ? A HOH 598 ? 1_554 ZN ? D ZN . ? A ZN 306 ? 1_555 O ? F HOH . ? A HOH 610 ? 1_555 104.5 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 235 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 241 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 SER _struct_mon_prot_cis.pdbx_label_seq_id_2 236 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 SER _struct_mon_prot_cis.pdbx_auth_seq_id_2 242 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.21 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA2 1 2 ? parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 65 ? PHE A 66 ? GLU A 71 PHE A 72 AA1 2 TRP A 47 ? TYR A 49 ? TRP A 53 TYR A 55 AA1 3 LYS A 26 ? SER A 29 ? LYS A 32 SER A 35 AA1 4 VAL A 229 ? TRP A 234 ? VAL A 235 TRP A 240 AA1 5 ILE A 189 ? LEU A 196 ? ILE A 195 LEU A 202 AA1 6 ILE A 157 ? GLY A 163 ? ILE A 163 GLY A 169 AA2 1 THR A 90 ? LEU A 92 ? THR A 96 LEU A 98 AA2 2 ARG A 123 ? GLY A 125 ? ARG A 129 GLY A 131 AA3 1 TYR A 247 ? THR A 248 ? TYR A 253 THR A 254 AA3 2 THR A 251 ? PRO A 252 ? THR A 257 PRO A 258 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 65 ? O GLU A 71 N PHE A 48 ? N PHE A 54 AA1 2 3 O TYR A 49 ? O TYR A 55 N VAL A 28 ? N VAL A 34 AA1 3 4 N GLY A 27 ? N GLY A 33 O TYR A 232 ? O TYR A 238 AA1 4 5 O ALA A 233 ? O ALA A 239 N LEU A 191 ? N LEU A 197 AA1 5 6 O TRP A 190 ? O TRP A 196 N LEU A 159 ? N LEU A 165 AA2 1 2 N LEU A 91 ? N LEU A 97 O GLY A 125 ? O GLY A 131 AA3 1 2 N THR A 248 ? N THR A 254 O THR A 251 ? O THR A 257 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 40 ? ? -57.01 99.28 2 1 GLN A 108 ? ? -114.16 -131.92 # _pdbx_molecule_features.prd_id PRD_900024 _pdbx_molecule_features.name beta-laminaribiose _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class Antimicrobial _pdbx_molecule_features.details oligosaccharide # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_900024 _pdbx_molecule.asym_id B # _pdbx_entry_details.entry_id 6UAU _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 658 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.05 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 7 ? A MET 1 2 1 Y 1 A GLY 8 ? A GLY 2 3 1 Y 1 A SER 9 ? A SER 3 4 1 Y 1 A SER 10 ? A SER 4 5 1 Y 1 A HIS 11 ? A HIS 5 6 1 Y 1 A HIS 12 ? A HIS 6 7 1 Y 1 A HIS 13 ? A HIS 7 8 1 Y 1 A HIS 14 ? A HIS 8 9 1 Y 1 A HIS 15 ? A HIS 9 10 1 Y 1 A HIS 16 ? A HIS 10 11 1 Y 1 A SER 17 ? A SER 11 12 1 Y 1 A SER 18 ? A SER 12 13 1 Y 1 A GLY 19 ? A GLY 13 14 1 Y 1 A LEU 20 ? A LEU 14 15 1 Y 1 A VAL 21 ? A VAL 15 16 1 Y 1 A PRO 22 ? A PRO 16 17 1 Y 1 A ALA 23 ? A ALA 17 18 1 Y 1 A GLY 24 ? A GLY 18 19 1 Y 1 A SER 25 ? A SER 19 20 1 Y 1 A HIS 26 ? A HIS 20 21 1 Y 1 A MET 27 ? A MET 21 22 1 Y 1 A ALA 28 ? A ALA 22 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BGC C2 C N R 74 BGC C3 C N S 75 BGC C4 C N S 76 BGC C5 C N R 77 BGC C6 C N N 78 BGC C1 C N R 79 BGC O1 O N N 80 BGC O2 O N N 81 BGC O3 O N N 82 BGC O4 O N N 83 BGC O5 O N N 84 BGC O6 O N N 85 BGC H2 H N N 86 BGC H3 H N N 87 BGC H4 H N N 88 BGC H5 H N N 89 BGC H61 H N N 90 BGC H62 H N N 91 BGC H1 H N N 92 BGC HO1 H N N 93 BGC HO2 H N N 94 BGC HO3 H N N 95 BGC HO4 H N N 96 BGC HO6 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 PEG C1 C N N 260 PEG O1 O N N 261 PEG C2 C N N 262 PEG O2 O N N 263 PEG C3 C N N 264 PEG C4 C N N 265 PEG O4 O N N 266 PEG H11 H N N 267 PEG H12 H N N 268 PEG HO1 H N N 269 PEG H21 H N N 270 PEG H22 H N N 271 PEG H31 H N N 272 PEG H32 H N N 273 PEG H41 H N N 274 PEG H42 H N N 275 PEG HO4 H N N 276 PHE N N N N 277 PHE CA C N S 278 PHE C C N N 279 PHE O O N N 280 PHE CB C N N 281 PHE CG C Y N 282 PHE CD1 C Y N 283 PHE CD2 C Y N 284 PHE CE1 C Y N 285 PHE CE2 C Y N 286 PHE CZ C Y N 287 PHE OXT O N N 288 PHE H H N N 289 PHE H2 H N N 290 PHE HA H N N 291 PHE HB2 H N N 292 PHE HB3 H N N 293 PHE HD1 H N N 294 PHE HD2 H N N 295 PHE HE1 H N N 296 PHE HE2 H N N 297 PHE HZ H N N 298 PHE HXT H N N 299 PRO N N N N 300 PRO CA C N S 301 PRO C C N N 302 PRO O O N N 303 PRO CB C N N 304 PRO CG C N N 305 PRO CD C N N 306 PRO OXT O N N 307 PRO H H N N 308 PRO HA H N N 309 PRO HB2 H N N 310 PRO HB3 H N N 311 PRO HG2 H N N 312 PRO HG3 H N N 313 PRO HD2 H N N 314 PRO HD3 H N N 315 PRO HXT H N N 316 SER N N N N 317 SER CA C N S 318 SER C C N N 319 SER O O N N 320 SER CB C N N 321 SER OG O N N 322 SER OXT O N N 323 SER H H N N 324 SER H2 H N N 325 SER HA H N N 326 SER HB2 H N N 327 SER HB3 H N N 328 SER HG H N N 329 SER HXT H N N 330 THR N N N N 331 THR CA C N S 332 THR C C N N 333 THR O O N N 334 THR CB C N R 335 THR OG1 O N N 336 THR CG2 C N N 337 THR OXT O N N 338 THR H H N N 339 THR H2 H N N 340 THR HA H N N 341 THR HB H N N 342 THR HG1 H N N 343 THR HG21 H N N 344 THR HG22 H N N 345 THR HG23 H N N 346 THR HXT H N N 347 TRP N N N N 348 TRP CA C N S 349 TRP C C N N 350 TRP O O N N 351 TRP CB C N N 352 TRP CG C Y N 353 TRP CD1 C Y N 354 TRP CD2 C Y N 355 TRP NE1 N Y N 356 TRP CE2 C Y N 357 TRP CE3 C Y N 358 TRP CZ2 C Y N 359 TRP CZ3 C Y N 360 TRP CH2 C Y N 361 TRP OXT O N N 362 TRP H H N N 363 TRP H2 H N N 364 TRP HA H N N 365 TRP HB2 H N N 366 TRP HB3 H N N 367 TRP HD1 H N N 368 TRP HE1 H N N 369 TRP HE3 H N N 370 TRP HZ2 H N N 371 TRP HZ3 H N N 372 TRP HH2 H N N 373 TRP HXT H N N 374 TYR N N N N 375 TYR CA C N S 376 TYR C C N N 377 TYR O O N N 378 TYR CB C N N 379 TYR CG C Y N 380 TYR CD1 C Y N 381 TYR CD2 C Y N 382 TYR CE1 C Y N 383 TYR CE2 C Y N 384 TYR CZ C Y N 385 TYR OH O N N 386 TYR OXT O N N 387 TYR H H N N 388 TYR H2 H N N 389 TYR HA H N N 390 TYR HB2 H N N 391 TYR HB3 H N N 392 TYR HD1 H N N 393 TYR HD2 H N N 394 TYR HE1 H N N 395 TYR HE2 H N N 396 TYR HH H N N 397 TYR HXT H N N 398 VAL N N N N 399 VAL CA C N S 400 VAL C C N N 401 VAL O O N N 402 VAL CB C N N 403 VAL CG1 C N N 404 VAL CG2 C N N 405 VAL OXT O N N 406 VAL H H N N 407 VAL H2 H N N 408 VAL HA H N N 409 VAL HB H N N 410 VAL HG11 H N N 411 VAL HG12 H N N 412 VAL HG13 H N N 413 VAL HG21 H N N 414 VAL HG22 H N N 415 VAL HG23 H N N 416 VAL HXT H N N 417 ZN ZN ZN N N 418 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BGC C2 C3 sing N N 70 BGC C2 C1 sing N N 71 BGC C2 O2 sing N N 72 BGC C2 H2 sing N N 73 BGC C3 C4 sing N N 74 BGC C3 O3 sing N N 75 BGC C3 H3 sing N N 76 BGC C4 C5 sing N N 77 BGC C4 O4 sing N N 78 BGC C4 H4 sing N N 79 BGC C5 C6 sing N N 80 BGC C5 O5 sing N N 81 BGC C5 H5 sing N N 82 BGC C6 O6 sing N N 83 BGC C6 H61 sing N N 84 BGC C6 H62 sing N N 85 BGC C1 O1 sing N N 86 BGC C1 O5 sing N N 87 BGC C1 H1 sing N N 88 BGC O1 HO1 sing N N 89 BGC O2 HO2 sing N N 90 BGC O3 HO3 sing N N 91 BGC O4 HO4 sing N N 92 BGC O6 HO6 sing N N 93 GLN N CA sing N N 94 GLN N H sing N N 95 GLN N H2 sing N N 96 GLN CA C sing N N 97 GLN CA CB sing N N 98 GLN CA HA sing N N 99 GLN C O doub N N 100 GLN C OXT sing N N 101 GLN CB CG sing N N 102 GLN CB HB2 sing N N 103 GLN CB HB3 sing N N 104 GLN CG CD sing N N 105 GLN CG HG2 sing N N 106 GLN CG HG3 sing N N 107 GLN CD OE1 doub N N 108 GLN CD NE2 sing N N 109 GLN NE2 HE21 sing N N 110 GLN NE2 HE22 sing N N 111 GLN OXT HXT sing N N 112 GLU N CA sing N N 113 GLU N H sing N N 114 GLU N H2 sing N N 115 GLU CA C sing N N 116 GLU CA CB sing N N 117 GLU CA HA sing N N 118 GLU C O doub N N 119 GLU C OXT sing N N 120 GLU CB CG sing N N 121 GLU CB HB2 sing N N 122 GLU CB HB3 sing N N 123 GLU CG CD sing N N 124 GLU CG HG2 sing N N 125 GLU CG HG3 sing N N 126 GLU CD OE1 doub N N 127 GLU CD OE2 sing N N 128 GLU OE2 HE2 sing N N 129 GLU OXT HXT sing N N 130 GLY N CA sing N N 131 GLY N H sing N N 132 GLY N H2 sing N N 133 GLY CA C sing N N 134 GLY CA HA2 sing N N 135 GLY CA HA3 sing N N 136 GLY C O doub N N 137 GLY C OXT sing N N 138 GLY OXT HXT sing N N 139 HIS N CA sing N N 140 HIS N H sing N N 141 HIS N H2 sing N N 142 HIS CA C sing N N 143 HIS CA CB sing N N 144 HIS CA HA sing N N 145 HIS C O doub N N 146 HIS C OXT sing N N 147 HIS CB CG sing N N 148 HIS CB HB2 sing N N 149 HIS CB HB3 sing N N 150 HIS CG ND1 sing Y N 151 HIS CG CD2 doub Y N 152 HIS ND1 CE1 doub Y N 153 HIS ND1 HD1 sing N N 154 HIS CD2 NE2 sing Y N 155 HIS CD2 HD2 sing N N 156 HIS CE1 NE2 sing Y N 157 HIS CE1 HE1 sing N N 158 HIS NE2 HE2 sing N N 159 HIS OXT HXT sing N N 160 HOH O H1 sing N N 161 HOH O H2 sing N N 162 ILE N CA sing N N 163 ILE N H sing N N 164 ILE N H2 sing N N 165 ILE CA C sing N N 166 ILE CA CB sing N N 167 ILE CA HA sing N N 168 ILE C O doub N N 169 ILE C OXT sing N N 170 ILE CB CG1 sing N N 171 ILE CB CG2 sing N N 172 ILE CB HB sing N N 173 ILE CG1 CD1 sing N N 174 ILE CG1 HG12 sing N N 175 ILE CG1 HG13 sing N N 176 ILE CG2 HG21 sing N N 177 ILE CG2 HG22 sing N N 178 ILE CG2 HG23 sing N N 179 ILE CD1 HD11 sing N N 180 ILE CD1 HD12 sing N N 181 ILE CD1 HD13 sing N N 182 ILE OXT HXT sing N N 183 LEU N CA sing N N 184 LEU N H sing N N 185 LEU N H2 sing N N 186 LEU CA C sing N N 187 LEU CA CB sing N N 188 LEU CA HA sing N N 189 LEU C O doub N N 190 LEU C OXT sing N N 191 LEU CB CG sing N N 192 LEU CB HB2 sing N N 193 LEU CB HB3 sing N N 194 LEU CG CD1 sing N N 195 LEU CG CD2 sing N N 196 LEU CG HG sing N N 197 LEU CD1 HD11 sing N N 198 LEU CD1 HD12 sing N N 199 LEU CD1 HD13 sing N N 200 LEU CD2 HD21 sing N N 201 LEU CD2 HD22 sing N N 202 LEU CD2 HD23 sing N N 203 LEU OXT HXT sing N N 204 LYS N CA sing N N 205 LYS N H sing N N 206 LYS N H2 sing N N 207 LYS CA C sing N N 208 LYS CA CB sing N N 209 LYS CA HA sing N N 210 LYS C O doub N N 211 LYS C OXT sing N N 212 LYS CB CG sing N N 213 LYS CB HB2 sing N N 214 LYS CB HB3 sing N N 215 LYS CG CD sing N N 216 LYS CG HG2 sing N N 217 LYS CG HG3 sing N N 218 LYS CD CE sing N N 219 LYS CD HD2 sing N N 220 LYS CD HD3 sing N N 221 LYS CE NZ sing N N 222 LYS CE HE2 sing N N 223 LYS CE HE3 sing N N 224 LYS NZ HZ1 sing N N 225 LYS NZ HZ2 sing N N 226 LYS NZ HZ3 sing N N 227 LYS OXT HXT sing N N 228 MET N CA sing N N 229 MET N H sing N N 230 MET N H2 sing N N 231 MET CA C sing N N 232 MET CA CB sing N N 233 MET CA HA sing N N 234 MET C O doub N N 235 MET C OXT sing N N 236 MET CB CG sing N N 237 MET CB HB2 sing N N 238 MET CB HB3 sing N N 239 MET CG SD sing N N 240 MET CG HG2 sing N N 241 MET CG HG3 sing N N 242 MET SD CE sing N N 243 MET CE HE1 sing N N 244 MET CE HE2 sing N N 245 MET CE HE3 sing N N 246 MET OXT HXT sing N N 247 PEG C1 O1 sing N N 248 PEG C1 C2 sing N N 249 PEG C1 H11 sing N N 250 PEG C1 H12 sing N N 251 PEG O1 HO1 sing N N 252 PEG C2 O2 sing N N 253 PEG C2 H21 sing N N 254 PEG C2 H22 sing N N 255 PEG O2 C3 sing N N 256 PEG C3 C4 sing N N 257 PEG C3 H31 sing N N 258 PEG C3 H32 sing N N 259 PEG C4 O4 sing N N 260 PEG C4 H41 sing N N 261 PEG C4 H42 sing N N 262 PEG O4 HO4 sing N N 263 PHE N CA sing N N 264 PHE N H sing N N 265 PHE N H2 sing N N 266 PHE CA C sing N N 267 PHE CA CB sing N N 268 PHE CA HA sing N N 269 PHE C O doub N N 270 PHE C OXT sing N N 271 PHE CB CG sing N N 272 PHE CB HB2 sing N N 273 PHE CB HB3 sing N N 274 PHE CG CD1 doub Y N 275 PHE CG CD2 sing Y N 276 PHE CD1 CE1 sing Y N 277 PHE CD1 HD1 sing N N 278 PHE CD2 CE2 doub Y N 279 PHE CD2 HD2 sing N N 280 PHE CE1 CZ doub Y N 281 PHE CE1 HE1 sing N N 282 PHE CE2 CZ sing Y N 283 PHE CE2 HE2 sing N N 284 PHE CZ HZ sing N N 285 PHE OXT HXT sing N N 286 PRO N CA sing N N 287 PRO N CD sing N N 288 PRO N H sing N N 289 PRO CA C sing N N 290 PRO CA CB sing N N 291 PRO CA HA sing N N 292 PRO C O doub N N 293 PRO C OXT sing N N 294 PRO CB CG sing N N 295 PRO CB HB2 sing N N 296 PRO CB HB3 sing N N 297 PRO CG CD sing N N 298 PRO CG HG2 sing N N 299 PRO CG HG3 sing N N 300 PRO CD HD2 sing N N 301 PRO CD HD3 sing N N 302 PRO OXT HXT sing N N 303 SER N CA sing N N 304 SER N H sing N N 305 SER N H2 sing N N 306 SER CA C sing N N 307 SER CA CB sing N N 308 SER CA HA sing N N 309 SER C O doub N N 310 SER C OXT sing N N 311 SER CB OG sing N N 312 SER CB HB2 sing N N 313 SER CB HB3 sing N N 314 SER OG HG sing N N 315 SER OXT HXT sing N N 316 THR N CA sing N N 317 THR N H sing N N 318 THR N H2 sing N N 319 THR CA C sing N N 320 THR CA CB sing N N 321 THR CA HA sing N N 322 THR C O doub N N 323 THR C OXT sing N N 324 THR CB OG1 sing N N 325 THR CB CG2 sing N N 326 THR CB HB sing N N 327 THR OG1 HG1 sing N N 328 THR CG2 HG21 sing N N 329 THR CG2 HG22 sing N N 330 THR CG2 HG23 sing N N 331 THR OXT HXT sing N N 332 TRP N CA sing N N 333 TRP N H sing N N 334 TRP N H2 sing N N 335 TRP CA C sing N N 336 TRP CA CB sing N N 337 TRP CA HA sing N N 338 TRP C O doub N N 339 TRP C OXT sing N N 340 TRP CB CG sing N N 341 TRP CB HB2 sing N N 342 TRP CB HB3 sing N N 343 TRP CG CD1 doub Y N 344 TRP CG CD2 sing Y N 345 TRP CD1 NE1 sing Y N 346 TRP CD1 HD1 sing N N 347 TRP CD2 CE2 doub Y N 348 TRP CD2 CE3 sing Y N 349 TRP NE1 CE2 sing Y N 350 TRP NE1 HE1 sing N N 351 TRP CE2 CZ2 sing Y N 352 TRP CE3 CZ3 doub Y N 353 TRP CE3 HE3 sing N N 354 TRP CZ2 CH2 doub Y N 355 TRP CZ2 HZ2 sing N N 356 TRP CZ3 CH2 sing Y N 357 TRP CZ3 HZ3 sing N N 358 TRP CH2 HH2 sing N N 359 TRP OXT HXT sing N N 360 TYR N CA sing N N 361 TYR N H sing N N 362 TYR N H2 sing N N 363 TYR CA C sing N N 364 TYR CA CB sing N N 365 TYR CA HA sing N N 366 TYR C O doub N N 367 TYR C OXT sing N N 368 TYR CB CG sing N N 369 TYR CB HB2 sing N N 370 TYR CB HB3 sing N N 371 TYR CG CD1 doub Y N 372 TYR CG CD2 sing Y N 373 TYR CD1 CE1 sing Y N 374 TYR CD1 HD1 sing N N 375 TYR CD2 CE2 doub Y N 376 TYR CD2 HD2 sing N N 377 TYR CE1 CZ doub Y N 378 TYR CE1 HE1 sing N N 379 TYR CE2 CZ sing Y N 380 TYR CE2 HE2 sing N N 381 TYR CZ OH sing N N 382 TYR OH HH sing N N 383 TYR OXT HXT sing N N 384 VAL N CA sing N N 385 VAL N H sing N N 386 VAL N H2 sing N N 387 VAL CA C sing N N 388 VAL CA CB sing N N 389 VAL CA HA sing N N 390 VAL C O doub N N 391 VAL C OXT sing N N 392 VAL CB CG1 sing N N 393 VAL CB CG2 sing N N 394 VAL CB HB sing N N 395 VAL CG1 HG11 sing N N 396 VAL CG1 HG12 sing N N 397 VAL CG1 HG13 sing N N 398 VAL CG2 HG21 sing N N 399 VAL CG2 HG22 sing N N 400 VAL CG2 HG23 sing N N 401 VAL OXT HXT sing N N 402 # _pdbx_audit_support.funding_organization 'Sao Paulo Research Foundation (FAPESP)' _pdbx_audit_support.country Brazil _pdbx_audit_support.grant_number 15/26982-0 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 BGC 1 n 2 BGC 2 n 3 BGC 1 n 3 BGC 2 n 3 BGC 3 n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id BGC _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id BGC _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _atom_sites.entry_id 6UAU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.025647 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.005344 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012650 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021752 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_