data_6UDG # _entry.id 6UDG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6UDG pdb_00006udg 10.2210/pdb6udg/pdb WWPDB D_1000244116 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-10-16 2 'Structure model' 1 1 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 4 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 5 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 6 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 7 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 8 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 9 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 10 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6UDG _pdbx_database_status.recvd_initial_deposition_date 2019-09-19 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'TO BE PUBLISHED' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of a Probable thiol peroxidase from Elizabethkingia anophelis NUHP1' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Abendroth, J.' 1 ? primary 'Lorimer, D.D.' 2 ? primary 'Horanyi, P.S.' 3 ? primary 'Edwards, T.E.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Thiol peroxidase' 18592.791 4 1.11.1.15 ? ? ? 2 water nat water 18.015 11 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Tpx,Peroxiredoxin tpx,Prx,Thioredoxin peroxidase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHMANITLKGNAISTVGNLPNIGEQLKDFTLVNADLSEKTLADYKGKKVVLNIFPSIDTGVCAASARKFNQEAS NLDNTVVVNVSKDLPFALGRFCAAEGLNNVDTLSDFRGHFGDDYGVTLADSPLQGLLSRAVVVADENGNVVYTEQVPEIA QEPNYDAALAALK ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHMANITLKGNAISTVGNLPNIGEQLKDFTLVNADLSEKTLADYKGKKVVLNIFPSIDTGVCAASARKFNQEAS NLDNTVVVNVSKDLPFALGRFCAAEGLNNVDTLSDFRGHFGDDYGVTLADSPLQGLLSRAVVVADENGNVVYTEQVPEIA QEPNYDAALAALK ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 ALA n 1 11 ASN n 1 12 ILE n 1 13 THR n 1 14 LEU n 1 15 LYS n 1 16 GLY n 1 17 ASN n 1 18 ALA n 1 19 ILE n 1 20 SER n 1 21 THR n 1 22 VAL n 1 23 GLY n 1 24 ASN n 1 25 LEU n 1 26 PRO n 1 27 ASN n 1 28 ILE n 1 29 GLY n 1 30 GLU n 1 31 GLN n 1 32 LEU n 1 33 LYS n 1 34 ASP n 1 35 PHE n 1 36 THR n 1 37 LEU n 1 38 VAL n 1 39 ASN n 1 40 ALA n 1 41 ASP n 1 42 LEU n 1 43 SER n 1 44 GLU n 1 45 LYS n 1 46 THR n 1 47 LEU n 1 48 ALA n 1 49 ASP n 1 50 TYR n 1 51 LYS n 1 52 GLY n 1 53 LYS n 1 54 LYS n 1 55 VAL n 1 56 VAL n 1 57 LEU n 1 58 ASN n 1 59 ILE n 1 60 PHE n 1 61 PRO n 1 62 SER n 1 63 ILE n 1 64 ASP n 1 65 THR n 1 66 GLY n 1 67 VAL n 1 68 CYS n 1 69 ALA n 1 70 ALA n 1 71 SER n 1 72 ALA n 1 73 ARG n 1 74 LYS n 1 75 PHE n 1 76 ASN n 1 77 GLN n 1 78 GLU n 1 79 ALA n 1 80 SER n 1 81 ASN n 1 82 LEU n 1 83 ASP n 1 84 ASN n 1 85 THR n 1 86 VAL n 1 87 VAL n 1 88 VAL n 1 89 ASN n 1 90 VAL n 1 91 SER n 1 92 LYS n 1 93 ASP n 1 94 LEU n 1 95 PRO n 1 96 PHE n 1 97 ALA n 1 98 LEU n 1 99 GLY n 1 100 ARG n 1 101 PHE n 1 102 CYS n 1 103 ALA n 1 104 ALA n 1 105 GLU n 1 106 GLY n 1 107 LEU n 1 108 ASN n 1 109 ASN n 1 110 VAL n 1 111 ASP n 1 112 THR n 1 113 LEU n 1 114 SER n 1 115 ASP n 1 116 PHE n 1 117 ARG n 1 118 GLY n 1 119 HIS n 1 120 PHE n 1 121 GLY n 1 122 ASP n 1 123 ASP n 1 124 TYR n 1 125 GLY n 1 126 VAL n 1 127 THR n 1 128 LEU n 1 129 ALA n 1 130 ASP n 1 131 SER n 1 132 PRO n 1 133 LEU n 1 134 GLN n 1 135 GLY n 1 136 LEU n 1 137 LEU n 1 138 SER n 1 139 ARG n 1 140 ALA n 1 141 VAL n 1 142 VAL n 1 143 VAL n 1 144 ALA n 1 145 ASP n 1 146 GLU n 1 147 ASN n 1 148 GLY n 1 149 ASN n 1 150 VAL n 1 151 VAL n 1 152 TYR n 1 153 THR n 1 154 GLU n 1 155 GLN n 1 156 VAL n 1 157 PRO n 1 158 GLU n 1 159 ILE n 1 160 ALA n 1 161 GLN n 1 162 GLU n 1 163 PRO n 1 164 ASN n 1 165 TYR n 1 166 ASP n 1 167 ALA n 1 168 ALA n 1 169 LEU n 1 170 ALA n 1 171 ALA n 1 172 LEU n 1 173 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 173 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'tpx, BD94_2659' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Elizabethkingia anophelis NUHP1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1338011 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ElanA.00055.a.B1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -7 ? ? ? A . n A 1 2 ALA 2 -6 ? ? ? A . n A 1 3 HIS 3 -5 ? ? ? A . n A 1 4 HIS 4 -4 ? ? ? A . n A 1 5 HIS 5 -3 ? ? ? A . n A 1 6 HIS 6 -2 ? ? ? A . n A 1 7 HIS 7 -1 ? ? ? A . n A 1 8 HIS 8 0 ? ? ? A . n A 1 9 MET 9 1 ? ? ? A . n A 1 10 ALA 10 2 ? ? ? A . n A 1 11 ASN 11 3 3 ASN ASN A . n A 1 12 ILE 12 4 4 ILE ILE A . n A 1 13 THR 13 5 5 THR THR A . n A 1 14 LEU 14 6 6 LEU LEU A . n A 1 15 LYS 15 7 7 LYS LYS A . n A 1 16 GLY 16 8 8 GLY GLY A . n A 1 17 ASN 17 9 9 ASN ASN A . n A 1 18 ALA 18 10 10 ALA ALA A . n A 1 19 ILE 19 11 11 ILE ILE A . n A 1 20 SER 20 12 12 SER SER A . n A 1 21 THR 21 13 13 THR THR A . n A 1 22 VAL 22 14 14 VAL VAL A . n A 1 23 GLY 23 15 15 GLY GLY A . n A 1 24 ASN 24 16 16 ASN ASN A . n A 1 25 LEU 25 17 17 LEU LEU A . n A 1 26 PRO 26 18 18 PRO PRO A . n A 1 27 ASN 27 19 19 ASN ASN A . n A 1 28 ILE 28 20 20 ILE ILE A . n A 1 29 GLY 29 21 21 GLY GLY A . n A 1 30 GLU 30 22 22 GLU GLU A . n A 1 31 GLN 31 23 23 GLN GLN A . n A 1 32 LEU 32 24 24 LEU LEU A . n A 1 33 LYS 33 25 25 LYS LYS A . n A 1 34 ASP 34 26 26 ASP ASP A . n A 1 35 PHE 35 27 27 PHE PHE A . n A 1 36 THR 36 28 28 THR THR A . n A 1 37 LEU 37 29 29 LEU LEU A . n A 1 38 VAL 38 30 30 VAL VAL A . n A 1 39 ASN 39 31 31 ASN ASN A . n A 1 40 ALA 40 32 32 ALA ALA A . n A 1 41 ASP 41 33 33 ASP ASP A . n A 1 42 LEU 42 34 34 LEU LEU A . n A 1 43 SER 43 35 35 SER SER A . n A 1 44 GLU 44 36 36 GLU GLU A . n A 1 45 LYS 45 37 37 LYS LYS A . n A 1 46 THR 46 38 38 THR THR A . n A 1 47 LEU 47 39 39 LEU LEU A . n A 1 48 ALA 48 40 40 ALA ALA A . n A 1 49 ASP 49 41 41 ASP ASP A . n A 1 50 TYR 50 42 42 TYR TYR A . n A 1 51 LYS 51 43 43 LYS LYS A . n A 1 52 GLY 52 44 44 GLY GLY A . n A 1 53 LYS 53 45 45 LYS LYS A . n A 1 54 LYS 54 46 46 LYS LYS A . n A 1 55 VAL 55 47 47 VAL VAL A . n A 1 56 VAL 56 48 48 VAL VAL A . n A 1 57 LEU 57 49 49 LEU LEU A . n A 1 58 ASN 58 50 50 ASN ASN A . n A 1 59 ILE 59 51 51 ILE ILE A . n A 1 60 PHE 60 52 52 PHE PHE A . n A 1 61 PRO 61 53 53 PRO PRO A . n A 1 62 SER 62 54 54 SER SER A . n A 1 63 ILE 63 55 55 ILE ILE A . n A 1 64 ASP 64 56 56 ASP ASP A . n A 1 65 THR 65 57 57 THR THR A . n A 1 66 GLY 66 58 58 GLY GLY A . n A 1 67 VAL 67 59 59 VAL VAL A . n A 1 68 CYS 68 60 60 CYS CYS A . n A 1 69 ALA 69 61 61 ALA ALA A . n A 1 70 ALA 70 62 62 ALA ALA A . n A 1 71 SER 71 63 63 SER SER A . n A 1 72 ALA 72 64 64 ALA ALA A . n A 1 73 ARG 73 65 65 ARG ARG A . n A 1 74 LYS 74 66 66 LYS LYS A . n A 1 75 PHE 75 67 67 PHE PHE A . n A 1 76 ASN 76 68 68 ASN ASN A . n A 1 77 GLN 77 69 69 GLN GLN A . n A 1 78 GLU 78 70 70 GLU GLU A . n A 1 79 ALA 79 71 71 ALA ALA A . n A 1 80 SER 80 72 72 SER SER A . n A 1 81 ASN 81 73 73 ASN ASN A . n A 1 82 LEU 82 74 74 LEU LEU A . n A 1 83 ASP 83 75 75 ASP ASP A . n A 1 84 ASN 84 76 76 ASN ASN A . n A 1 85 THR 85 77 77 THR THR A . n A 1 86 VAL 86 78 78 VAL VAL A . n A 1 87 VAL 87 79 79 VAL VAL A . n A 1 88 VAL 88 80 80 VAL VAL A . n A 1 89 ASN 89 81 81 ASN ASN A . n A 1 90 VAL 90 82 82 VAL VAL A . n A 1 91 SER 91 83 83 SER SER A . n A 1 92 LYS 92 84 84 LYS LYS A . n A 1 93 ASP 93 85 85 ASP ASP A . n A 1 94 LEU 94 86 86 LEU LEU A . n A 1 95 PRO 95 87 87 PRO PRO A . n A 1 96 PHE 96 88 88 PHE PHE A . n A 1 97 ALA 97 89 89 ALA ALA A . n A 1 98 LEU 98 90 90 LEU LEU A . n A 1 99 GLY 99 91 91 GLY GLY A . n A 1 100 ARG 100 92 92 ARG ARG A . n A 1 101 PHE 101 93 93 PHE PHE A . n A 1 102 CYS 102 94 94 CYS CYS A . n A 1 103 ALA 103 95 95 ALA ALA A . n A 1 104 ALA 104 96 96 ALA ALA A . n A 1 105 GLU 105 97 97 GLU GLU A . n A 1 106 GLY 106 98 98 GLY GLY A . n A 1 107 LEU 107 99 99 LEU LEU A . n A 1 108 ASN 108 100 100 ASN ASN A . n A 1 109 ASN 109 101 101 ASN ASN A . n A 1 110 VAL 110 102 102 VAL VAL A . n A 1 111 ASP 111 103 103 ASP ASP A . n A 1 112 THR 112 104 104 THR THR A . n A 1 113 LEU 113 105 105 LEU LEU A . n A 1 114 SER 114 106 106 SER SER A . n A 1 115 ASP 115 107 107 ASP ASP A . n A 1 116 PHE 116 108 108 PHE PHE A . n A 1 117 ARG 117 109 109 ARG ARG A . n A 1 118 GLY 118 110 110 GLY GLY A . n A 1 119 HIS 119 111 111 HIS HIS A . n A 1 120 PHE 120 112 112 PHE PHE A . n A 1 121 GLY 121 113 113 GLY GLY A . n A 1 122 ASP 122 114 114 ASP ASP A . n A 1 123 ASP 123 115 115 ASP ASP A . n A 1 124 TYR 124 116 116 TYR TYR A . n A 1 125 GLY 125 117 117 GLY GLY A . n A 1 126 VAL 126 118 118 VAL VAL A . n A 1 127 THR 127 119 119 THR THR A . n A 1 128 LEU 128 120 120 LEU LEU A . n A 1 129 ALA 129 121 121 ALA ALA A . n A 1 130 ASP 130 122 122 ASP ASP A . n A 1 131 SER 131 123 123 SER SER A . n A 1 132 PRO 132 124 124 PRO PRO A . n A 1 133 LEU 133 125 125 LEU LEU A . n A 1 134 GLN 134 126 126 GLN GLN A . n A 1 135 GLY 135 127 127 GLY GLY A . n A 1 136 LEU 136 128 128 LEU LEU A . n A 1 137 LEU 137 129 129 LEU LEU A . n A 1 138 SER 138 130 130 SER SER A . n A 1 139 ARG 139 131 131 ARG ARG A . n A 1 140 ALA 140 132 132 ALA ALA A . n A 1 141 VAL 141 133 133 VAL VAL A . n A 1 142 VAL 142 134 134 VAL VAL A . n A 1 143 VAL 143 135 135 VAL VAL A . n A 1 144 ALA 144 136 136 ALA ALA A . n A 1 145 ASP 145 137 137 ASP ASP A . n A 1 146 GLU 146 138 138 GLU GLU A . n A 1 147 ASN 147 139 139 ASN ASN A . n A 1 148 GLY 148 140 140 GLY GLY A . n A 1 149 ASN 149 141 141 ASN ASN A . n A 1 150 VAL 150 142 142 VAL VAL A . n A 1 151 VAL 151 143 143 VAL VAL A . n A 1 152 TYR 152 144 144 TYR TYR A . n A 1 153 THR 153 145 145 THR THR A . n A 1 154 GLU 154 146 146 GLU GLU A . n A 1 155 GLN 155 147 147 GLN GLN A . n A 1 156 VAL 156 148 148 VAL VAL A . n A 1 157 PRO 157 149 149 PRO PRO A . n A 1 158 GLU 158 150 150 GLU GLU A . n A 1 159 ILE 159 151 151 ILE ILE A . n A 1 160 ALA 160 152 152 ALA ALA A . n A 1 161 GLN 161 153 153 GLN GLN A . n A 1 162 GLU 162 154 154 GLU GLU A . n A 1 163 PRO 163 155 155 PRO PRO A . n A 1 164 ASN 164 156 156 ASN ASN A . n A 1 165 TYR 165 157 157 TYR TYR A . n A 1 166 ASP 166 158 158 ASP ASP A . n A 1 167 ALA 167 159 159 ALA ALA A . n A 1 168 ALA 168 160 160 ALA ALA A . n A 1 169 LEU 169 161 161 LEU LEU A . n A 1 170 ALA 170 162 162 ALA ALA A . n A 1 171 ALA 171 163 163 ALA ALA A . n A 1 172 LEU 172 164 164 LEU LEU A . n A 1 173 LYS 173 165 165 LYS LYS A . n B 1 1 MET 1 -7 ? ? ? B . n B 1 2 ALA 2 -6 ? ? ? B . n B 1 3 HIS 3 -5 ? ? ? B . n B 1 4 HIS 4 -4 ? ? ? B . n B 1 5 HIS 5 -3 ? ? ? B . n B 1 6 HIS 6 -2 ? ? ? B . n B 1 7 HIS 7 -1 ? ? ? B . n B 1 8 HIS 8 0 ? ? ? B . n B 1 9 MET 9 1 ? ? ? B . n B 1 10 ALA 10 2 ? ? ? B . n B 1 11 ASN 11 3 ? ? ? B . n B 1 12 ILE 12 4 ? ? ? B . n B 1 13 THR 13 5 5 THR THR B . n B 1 14 LEU 14 6 6 LEU LEU B . n B 1 15 LYS 15 7 7 LYS LYS B . n B 1 16 GLY 16 8 8 GLY GLY B . n B 1 17 ASN 17 9 9 ASN ASN B . n B 1 18 ALA 18 10 10 ALA ALA B . n B 1 19 ILE 19 11 11 ILE ILE B . n B 1 20 SER 20 12 12 SER SER B . n B 1 21 THR 21 13 13 THR THR B . n B 1 22 VAL 22 14 14 VAL VAL B . n B 1 23 GLY 23 15 15 GLY GLY B . n B 1 24 ASN 24 16 16 ASN ASN B . n B 1 25 LEU 25 17 17 LEU LEU B . n B 1 26 PRO 26 18 18 PRO PRO B . n B 1 27 ASN 27 19 19 ASN ASN B . n B 1 28 ILE 28 20 20 ILE ILE B . n B 1 29 GLY 29 21 21 GLY GLY B . n B 1 30 GLU 30 22 22 GLU GLU B . n B 1 31 GLN 31 23 23 GLN GLN B . n B 1 32 LEU 32 24 24 LEU LEU B . n B 1 33 LYS 33 25 25 LYS LYS B . n B 1 34 ASP 34 26 26 ASP ASP B . n B 1 35 PHE 35 27 27 PHE PHE B . n B 1 36 THR 36 28 28 THR THR B . n B 1 37 LEU 37 29 29 LEU LEU B . n B 1 38 VAL 38 30 30 VAL VAL B . n B 1 39 ASN 39 31 31 ASN ASN B . n B 1 40 ALA 40 32 32 ALA ALA B . n B 1 41 ASP 41 33 33 ASP ASP B . n B 1 42 LEU 42 34 34 LEU LEU B . n B 1 43 SER 43 35 35 SER SER B . n B 1 44 GLU 44 36 36 GLU GLU B . n B 1 45 LYS 45 37 37 LYS LYS B . n B 1 46 THR 46 38 38 THR THR B . n B 1 47 LEU 47 39 39 LEU LEU B . n B 1 48 ALA 48 40 40 ALA ALA B . n B 1 49 ASP 49 41 41 ASP ASP B . n B 1 50 TYR 50 42 42 TYR TYR B . n B 1 51 LYS 51 43 43 LYS LYS B . n B 1 52 GLY 52 44 44 GLY GLY B . n B 1 53 LYS 53 45 45 LYS LYS B . n B 1 54 LYS 54 46 46 LYS LYS B . n B 1 55 VAL 55 47 47 VAL VAL B . n B 1 56 VAL 56 48 48 VAL VAL B . n B 1 57 LEU 57 49 49 LEU LEU B . n B 1 58 ASN 58 50 50 ASN ASN B . n B 1 59 ILE 59 51 51 ILE ILE B . n B 1 60 PHE 60 52 52 PHE PHE B . n B 1 61 PRO 61 53 53 PRO PRO B . n B 1 62 SER 62 54 54 SER SER B . n B 1 63 ILE 63 55 55 ILE ILE B . n B 1 64 ASP 64 56 56 ASP ASP B . n B 1 65 THR 65 57 57 THR THR B . n B 1 66 GLY 66 58 58 GLY GLY B . n B 1 67 VAL 67 59 59 VAL VAL B . n B 1 68 CYS 68 60 60 CYS CYS B . n B 1 69 ALA 69 61 61 ALA ALA B . n B 1 70 ALA 70 62 62 ALA ALA B . n B 1 71 SER 71 63 63 SER SER B . n B 1 72 ALA 72 64 64 ALA ALA B . n B 1 73 ARG 73 65 65 ARG ARG B . n B 1 74 LYS 74 66 66 LYS LYS B . n B 1 75 PHE 75 67 67 PHE PHE B . n B 1 76 ASN 76 68 68 ASN ASN B . n B 1 77 GLN 77 69 69 GLN GLN B . n B 1 78 GLU 78 70 70 GLU GLU B . n B 1 79 ALA 79 71 71 ALA ALA B . n B 1 80 SER 80 72 72 SER SER B . n B 1 81 ASN 81 73 73 ASN ASN B . n B 1 82 LEU 82 74 74 LEU LEU B . n B 1 83 ASP 83 75 75 ASP ASP B . n B 1 84 ASN 84 76 76 ASN ASN B . n B 1 85 THR 85 77 77 THR THR B . n B 1 86 VAL 86 78 78 VAL VAL B . n B 1 87 VAL 87 79 79 VAL VAL B . n B 1 88 VAL 88 80 80 VAL VAL B . n B 1 89 ASN 89 81 81 ASN ASN B . n B 1 90 VAL 90 82 82 VAL VAL B . n B 1 91 SER 91 83 83 SER SER B . n B 1 92 LYS 92 84 84 LYS LYS B . n B 1 93 ASP 93 85 85 ASP ASP B . n B 1 94 LEU 94 86 86 LEU LEU B . n B 1 95 PRO 95 87 87 PRO PRO B . n B 1 96 PHE 96 88 88 PHE PHE B . n B 1 97 ALA 97 89 89 ALA ALA B . n B 1 98 LEU 98 90 90 LEU LEU B . n B 1 99 GLY 99 91 91 GLY GLY B . n B 1 100 ARG 100 92 92 ARG ARG B . n B 1 101 PHE 101 93 93 PHE PHE B . n B 1 102 CYS 102 94 94 CYS CYS B . n B 1 103 ALA 103 95 95 ALA ALA B . n B 1 104 ALA 104 96 96 ALA ALA B . n B 1 105 GLU 105 97 97 GLU GLU B . n B 1 106 GLY 106 98 98 GLY GLY B . n B 1 107 LEU 107 99 99 LEU LEU B . n B 1 108 ASN 108 100 100 ASN ASN B . n B 1 109 ASN 109 101 101 ASN ASN B . n B 1 110 VAL 110 102 102 VAL VAL B . n B 1 111 ASP 111 103 103 ASP ASP B . n B 1 112 THR 112 104 104 THR THR B . n B 1 113 LEU 113 105 105 LEU LEU B . n B 1 114 SER 114 106 106 SER SER B . n B 1 115 ASP 115 107 107 ASP ASP B . n B 1 116 PHE 116 108 108 PHE PHE B . n B 1 117 ARG 117 109 109 ARG ARG B . n B 1 118 GLY 118 110 110 GLY GLY B . n B 1 119 HIS 119 111 111 HIS HIS B . n B 1 120 PHE 120 112 112 PHE PHE B . n B 1 121 GLY 121 113 113 GLY GLY B . n B 1 122 ASP 122 114 114 ASP ASP B . n B 1 123 ASP 123 115 115 ASP ASP B . n B 1 124 TYR 124 116 116 TYR TYR B . n B 1 125 GLY 125 117 117 GLY GLY B . n B 1 126 VAL 126 118 118 VAL VAL B . n B 1 127 THR 127 119 119 THR THR B . n B 1 128 LEU 128 120 120 LEU LEU B . n B 1 129 ALA 129 121 121 ALA ALA B . n B 1 130 ASP 130 122 122 ASP ASP B . n B 1 131 SER 131 123 123 SER SER B . n B 1 132 PRO 132 124 124 PRO PRO B . n B 1 133 LEU 133 125 125 LEU LEU B . n B 1 134 GLN 134 126 126 GLN GLN B . n B 1 135 GLY 135 127 127 GLY GLY B . n B 1 136 LEU 136 128 128 LEU LEU B . n B 1 137 LEU 137 129 129 LEU LEU B . n B 1 138 SER 138 130 130 SER SER B . n B 1 139 ARG 139 131 131 ARG ARG B . n B 1 140 ALA 140 132 132 ALA ALA B . n B 1 141 VAL 141 133 133 VAL VAL B . n B 1 142 VAL 142 134 134 VAL VAL B . n B 1 143 VAL 143 135 135 VAL VAL B . n B 1 144 ALA 144 136 136 ALA ALA B . n B 1 145 ASP 145 137 137 ASP ASP B . n B 1 146 GLU 146 138 138 GLU GLU B . n B 1 147 ASN 147 139 139 ASN ASN B . n B 1 148 GLY 148 140 140 GLY GLY B . n B 1 149 ASN 149 141 141 ASN ASN B . n B 1 150 VAL 150 142 142 VAL VAL B . n B 1 151 VAL 151 143 143 VAL VAL B . n B 1 152 TYR 152 144 144 TYR TYR B . n B 1 153 THR 153 145 145 THR THR B . n B 1 154 GLU 154 146 146 GLU GLU B . n B 1 155 GLN 155 147 147 GLN GLN B . n B 1 156 VAL 156 148 148 VAL VAL B . n B 1 157 PRO 157 149 149 PRO PRO B . n B 1 158 GLU 158 150 150 GLU GLU B . n B 1 159 ILE 159 151 151 ILE ILE B . n B 1 160 ALA 160 152 152 ALA ALA B . n B 1 161 GLN 161 153 153 GLN GLN B . n B 1 162 GLU 162 154 154 GLU GLU B . n B 1 163 PRO 163 155 155 PRO PRO B . n B 1 164 ASN 164 156 156 ASN ASN B . n B 1 165 TYR 165 157 157 TYR TYR B . n B 1 166 ASP 166 158 158 ASP ASP B . n B 1 167 ALA 167 159 159 ALA ALA B . n B 1 168 ALA 168 160 160 ALA ALA B . n B 1 169 LEU 169 161 161 LEU LEU B . n B 1 170 ALA 170 162 162 ALA ALA B . n B 1 171 ALA 171 163 163 ALA ALA B . n B 1 172 LEU 172 164 164 LEU LEU B . n B 1 173 LYS 173 165 165 LYS LYS B . n C 1 1 MET 1 -7 ? ? ? C . n C 1 2 ALA 2 -6 ? ? ? C . n C 1 3 HIS 3 -5 ? ? ? C . n C 1 4 HIS 4 -4 ? ? ? C . n C 1 5 HIS 5 -3 ? ? ? C . n C 1 6 HIS 6 -2 ? ? ? C . n C 1 7 HIS 7 -1 ? ? ? C . n C 1 8 HIS 8 0 ? ? ? C . n C 1 9 MET 9 1 ? ? ? C . n C 1 10 ALA 10 2 ? ? ? C . n C 1 11 ASN 11 3 ? ? ? C . n C 1 12 ILE 12 4 4 ILE ILE C . n C 1 13 THR 13 5 5 THR THR C . n C 1 14 LEU 14 6 6 LEU LEU C . n C 1 15 LYS 15 7 7 LYS LYS C . n C 1 16 GLY 16 8 8 GLY GLY C . n C 1 17 ASN 17 9 9 ASN ASN C . n C 1 18 ALA 18 10 10 ALA ALA C . n C 1 19 ILE 19 11 11 ILE ILE C . n C 1 20 SER 20 12 12 SER SER C . n C 1 21 THR 21 13 13 THR THR C . n C 1 22 VAL 22 14 14 VAL VAL C . n C 1 23 GLY 23 15 15 GLY GLY C . n C 1 24 ASN 24 16 16 ASN ASN C . n C 1 25 LEU 25 17 17 LEU LEU C . n C 1 26 PRO 26 18 18 PRO PRO C . n C 1 27 ASN 27 19 19 ASN ASN C . n C 1 28 ILE 28 20 20 ILE ILE C . n C 1 29 GLY 29 21 21 GLY GLY C . n C 1 30 GLU 30 22 22 GLU GLU C . n C 1 31 GLN 31 23 23 GLN GLN C . n C 1 32 LEU 32 24 24 LEU LEU C . n C 1 33 LYS 33 25 25 LYS LYS C . n C 1 34 ASP 34 26 26 ASP ASP C . n C 1 35 PHE 35 27 27 PHE PHE C . n C 1 36 THR 36 28 28 THR THR C . n C 1 37 LEU 37 29 29 LEU LEU C . n C 1 38 VAL 38 30 30 VAL VAL C . n C 1 39 ASN 39 31 31 ASN ASN C . n C 1 40 ALA 40 32 32 ALA ALA C . n C 1 41 ASP 41 33 33 ASP ASP C . n C 1 42 LEU 42 34 34 LEU LEU C . n C 1 43 SER 43 35 35 SER SER C . n C 1 44 GLU 44 36 36 GLU GLU C . n C 1 45 LYS 45 37 37 LYS LYS C . n C 1 46 THR 46 38 38 THR THR C . n C 1 47 LEU 47 39 39 LEU LEU C . n C 1 48 ALA 48 40 40 ALA ALA C . n C 1 49 ASP 49 41 41 ASP ASP C . n C 1 50 TYR 50 42 42 TYR TYR C . n C 1 51 LYS 51 43 43 LYS LYS C . n C 1 52 GLY 52 44 44 GLY GLY C . n C 1 53 LYS 53 45 45 LYS LYS C . n C 1 54 LYS 54 46 46 LYS LYS C . n C 1 55 VAL 55 47 47 VAL VAL C . n C 1 56 VAL 56 48 48 VAL VAL C . n C 1 57 LEU 57 49 49 LEU LEU C . n C 1 58 ASN 58 50 50 ASN ASN C . n C 1 59 ILE 59 51 51 ILE ILE C . n C 1 60 PHE 60 52 52 PHE PHE C . n C 1 61 PRO 61 53 53 PRO PRO C . n C 1 62 SER 62 54 54 SER SER C . n C 1 63 ILE 63 55 55 ILE ILE C . n C 1 64 ASP 64 56 56 ASP ASP C . n C 1 65 THR 65 57 57 THR THR C . n C 1 66 GLY 66 58 58 GLY GLY C . n C 1 67 VAL 67 59 59 VAL VAL C . n C 1 68 CYS 68 60 60 CYS CYS C . n C 1 69 ALA 69 61 61 ALA ALA C . n C 1 70 ALA 70 62 62 ALA ALA C . n C 1 71 SER 71 63 63 SER SER C . n C 1 72 ALA 72 64 64 ALA ALA C . n C 1 73 ARG 73 65 65 ARG ARG C . n C 1 74 LYS 74 66 66 LYS LYS C . n C 1 75 PHE 75 67 67 PHE PHE C . n C 1 76 ASN 76 68 68 ASN ASN C . n C 1 77 GLN 77 69 69 GLN GLN C . n C 1 78 GLU 78 70 70 GLU GLU C . n C 1 79 ALA 79 71 71 ALA ALA C . n C 1 80 SER 80 72 72 SER SER C . n C 1 81 ASN 81 73 73 ASN ASN C . n C 1 82 LEU 82 74 74 LEU LEU C . n C 1 83 ASP 83 75 75 ASP ASP C . n C 1 84 ASN 84 76 76 ASN ASN C . n C 1 85 THR 85 77 77 THR THR C . n C 1 86 VAL 86 78 78 VAL VAL C . n C 1 87 VAL 87 79 79 VAL VAL C . n C 1 88 VAL 88 80 80 VAL VAL C . n C 1 89 ASN 89 81 81 ASN ASN C . n C 1 90 VAL 90 82 82 VAL VAL C . n C 1 91 SER 91 83 83 SER SER C . n C 1 92 LYS 92 84 84 LYS LYS C . n C 1 93 ASP 93 85 85 ASP ASP C . n C 1 94 LEU 94 86 86 LEU LEU C . n C 1 95 PRO 95 87 87 PRO PRO C . n C 1 96 PHE 96 88 88 PHE PHE C . n C 1 97 ALA 97 89 89 ALA ALA C . n C 1 98 LEU 98 90 90 LEU LEU C . n C 1 99 GLY 99 91 91 GLY GLY C . n C 1 100 ARG 100 92 92 ARG ARG C . n C 1 101 PHE 101 93 93 PHE PHE C . n C 1 102 CYS 102 94 94 CYS CYS C . n C 1 103 ALA 103 95 95 ALA ALA C . n C 1 104 ALA 104 96 96 ALA ALA C . n C 1 105 GLU 105 97 97 GLU GLU C . n C 1 106 GLY 106 98 98 GLY GLY C . n C 1 107 LEU 107 99 99 LEU LEU C . n C 1 108 ASN 108 100 100 ASN ASN C . n C 1 109 ASN 109 101 101 ASN ASN C . n C 1 110 VAL 110 102 102 VAL VAL C . n C 1 111 ASP 111 103 103 ASP ASP C . n C 1 112 THR 112 104 104 THR THR C . n C 1 113 LEU 113 105 105 LEU LEU C . n C 1 114 SER 114 106 106 SER SER C . n C 1 115 ASP 115 107 107 ASP ASP C . n C 1 116 PHE 116 108 108 PHE PHE C . n C 1 117 ARG 117 109 109 ARG ARG C . n C 1 118 GLY 118 110 110 GLY GLY C . n C 1 119 HIS 119 111 111 HIS HIS C . n C 1 120 PHE 120 112 112 PHE PHE C . n C 1 121 GLY 121 113 113 GLY GLY C . n C 1 122 ASP 122 114 114 ASP ASP C . n C 1 123 ASP 123 115 115 ASP ASP C . n C 1 124 TYR 124 116 116 TYR TYR C . n C 1 125 GLY 125 117 117 GLY GLY C . n C 1 126 VAL 126 118 118 VAL VAL C . n C 1 127 THR 127 119 119 THR THR C . n C 1 128 LEU 128 120 120 LEU LEU C . n C 1 129 ALA 129 121 121 ALA ALA C . n C 1 130 ASP 130 122 122 ASP ASP C . n C 1 131 SER 131 123 123 SER SER C . n C 1 132 PRO 132 124 124 PRO PRO C . n C 1 133 LEU 133 125 125 LEU LEU C . n C 1 134 GLN 134 126 126 GLN GLN C . n C 1 135 GLY 135 127 127 GLY GLY C . n C 1 136 LEU 136 128 128 LEU LEU C . n C 1 137 LEU 137 129 129 LEU LEU C . n C 1 138 SER 138 130 130 SER SER C . n C 1 139 ARG 139 131 131 ARG ARG C . n C 1 140 ALA 140 132 132 ALA ALA C . n C 1 141 VAL 141 133 133 VAL VAL C . n C 1 142 VAL 142 134 134 VAL VAL C . n C 1 143 VAL 143 135 135 VAL VAL C . n C 1 144 ALA 144 136 136 ALA ALA C . n C 1 145 ASP 145 137 137 ASP ASP C . n C 1 146 GLU 146 138 138 GLU GLU C . n C 1 147 ASN 147 139 139 ASN ASN C . n C 1 148 GLY 148 140 140 GLY GLY C . n C 1 149 ASN 149 141 141 ASN ASN C . n C 1 150 VAL 150 142 142 VAL VAL C . n C 1 151 VAL 151 143 143 VAL VAL C . n C 1 152 TYR 152 144 144 TYR TYR C . n C 1 153 THR 153 145 145 THR THR C . n C 1 154 GLU 154 146 146 GLU GLU C . n C 1 155 GLN 155 147 147 GLN GLN C . n C 1 156 VAL 156 148 148 VAL VAL C . n C 1 157 PRO 157 149 149 PRO PRO C . n C 1 158 GLU 158 150 150 GLU GLU C . n C 1 159 ILE 159 151 151 ILE ILE C . n C 1 160 ALA 160 152 152 ALA ALA C . n C 1 161 GLN 161 153 153 GLN GLN C . n C 1 162 GLU 162 154 154 GLU GLU C . n C 1 163 PRO 163 155 155 PRO PRO C . n C 1 164 ASN 164 156 156 ASN ASN C . n C 1 165 TYR 165 157 157 TYR TYR C . n C 1 166 ASP 166 158 158 ASP ASP C . n C 1 167 ALA 167 159 159 ALA ALA C . n C 1 168 ALA 168 160 160 ALA ALA C . n C 1 169 LEU 169 161 161 LEU LEU C . n C 1 170 ALA 170 162 162 ALA ALA C . n C 1 171 ALA 171 163 163 ALA ALA C . n C 1 172 LEU 172 164 164 LEU LEU C . n C 1 173 LYS 173 165 165 LYS LYS C . n D 1 1 MET 1 -7 ? ? ? D . n D 1 2 ALA 2 -6 ? ? ? D . n D 1 3 HIS 3 -5 ? ? ? D . n D 1 4 HIS 4 -4 ? ? ? D . n D 1 5 HIS 5 -3 ? ? ? D . n D 1 6 HIS 6 -2 ? ? ? D . n D 1 7 HIS 7 -1 ? ? ? D . n D 1 8 HIS 8 0 ? ? ? D . n D 1 9 MET 9 1 ? ? ? D . n D 1 10 ALA 10 2 ? ? ? D . n D 1 11 ASN 11 3 ? ? ? D . n D 1 12 ILE 12 4 4 ILE ILE D . n D 1 13 THR 13 5 5 THR THR D . n D 1 14 LEU 14 6 6 LEU LEU D . n D 1 15 LYS 15 7 7 LYS LYS D . n D 1 16 GLY 16 8 8 GLY GLY D . n D 1 17 ASN 17 9 9 ASN ASN D . n D 1 18 ALA 18 10 10 ALA ALA D . n D 1 19 ILE 19 11 11 ILE ILE D . n D 1 20 SER 20 12 12 SER SER D . n D 1 21 THR 21 13 13 THR THR D . n D 1 22 VAL 22 14 14 VAL VAL D . n D 1 23 GLY 23 15 15 GLY GLY D . n D 1 24 ASN 24 16 16 ASN ASN D . n D 1 25 LEU 25 17 17 LEU LEU D . n D 1 26 PRO 26 18 18 PRO PRO D . n D 1 27 ASN 27 19 19 ASN ASN D . n D 1 28 ILE 28 20 20 ILE ILE D . n D 1 29 GLY 29 21 21 GLY GLY D . n D 1 30 GLU 30 22 22 GLU GLU D . n D 1 31 GLN 31 23 23 GLN GLN D . n D 1 32 LEU 32 24 24 LEU LEU D . n D 1 33 LYS 33 25 25 LYS LYS D . n D 1 34 ASP 34 26 26 ASP ASP D . n D 1 35 PHE 35 27 27 PHE PHE D . n D 1 36 THR 36 28 28 THR THR D . n D 1 37 LEU 37 29 29 LEU LEU D . n D 1 38 VAL 38 30 30 VAL VAL D . n D 1 39 ASN 39 31 31 ASN ASN D . n D 1 40 ALA 40 32 32 ALA ALA D . n D 1 41 ASP 41 33 33 ASP ASP D . n D 1 42 LEU 42 34 34 LEU LEU D . n D 1 43 SER 43 35 35 SER SER D . n D 1 44 GLU 44 36 36 GLU GLU D . n D 1 45 LYS 45 37 37 LYS LYS D . n D 1 46 THR 46 38 38 THR THR D . n D 1 47 LEU 47 39 39 LEU LEU D . n D 1 48 ALA 48 40 40 ALA ALA D . n D 1 49 ASP 49 41 41 ASP ASP D . n D 1 50 TYR 50 42 42 TYR TYR D . n D 1 51 LYS 51 43 43 LYS LYS D . n D 1 52 GLY 52 44 44 GLY GLY D . n D 1 53 LYS 53 45 45 LYS LYS D . n D 1 54 LYS 54 46 46 LYS LYS D . n D 1 55 VAL 55 47 47 VAL VAL D . n D 1 56 VAL 56 48 48 VAL VAL D . n D 1 57 LEU 57 49 49 LEU LEU D . n D 1 58 ASN 58 50 50 ASN ASN D . n D 1 59 ILE 59 51 51 ILE ILE D . n D 1 60 PHE 60 52 52 PHE PHE D . n D 1 61 PRO 61 53 53 PRO PRO D . n D 1 62 SER 62 54 54 SER SER D . n D 1 63 ILE 63 55 55 ILE ILE D . n D 1 64 ASP 64 56 56 ASP ASP D . n D 1 65 THR 65 57 57 THR THR D . n D 1 66 GLY 66 58 58 GLY GLY D . n D 1 67 VAL 67 59 59 VAL VAL D . n D 1 68 CYS 68 60 60 CYS CYS D . n D 1 69 ALA 69 61 61 ALA ALA D . n D 1 70 ALA 70 62 62 ALA ALA D . n D 1 71 SER 71 63 63 SER SER D . n D 1 72 ALA 72 64 64 ALA ALA D . n D 1 73 ARG 73 65 65 ARG ARG D . n D 1 74 LYS 74 66 66 LYS LYS D . n D 1 75 PHE 75 67 67 PHE PHE D . n D 1 76 ASN 76 68 68 ASN ASN D . n D 1 77 GLN 77 69 69 GLN GLN D . n D 1 78 GLU 78 70 70 GLU GLU D . n D 1 79 ALA 79 71 71 ALA ALA D . n D 1 80 SER 80 72 72 SER SER D . n D 1 81 ASN 81 73 73 ASN ASN D . n D 1 82 LEU 82 74 74 LEU LEU D . n D 1 83 ASP 83 75 75 ASP ASP D . n D 1 84 ASN 84 76 76 ASN ASN D . n D 1 85 THR 85 77 77 THR THR D . n D 1 86 VAL 86 78 78 VAL VAL D . n D 1 87 VAL 87 79 79 VAL VAL D . n D 1 88 VAL 88 80 80 VAL VAL D . n D 1 89 ASN 89 81 81 ASN ASN D . n D 1 90 VAL 90 82 82 VAL VAL D . n D 1 91 SER 91 83 83 SER SER D . n D 1 92 LYS 92 84 84 LYS LYS D . n D 1 93 ASP 93 85 85 ASP ASP D . n D 1 94 LEU 94 86 86 LEU LEU D . n D 1 95 PRO 95 87 87 PRO PRO D . n D 1 96 PHE 96 88 88 PHE PHE D . n D 1 97 ALA 97 89 89 ALA ALA D . n D 1 98 LEU 98 90 90 LEU LEU D . n D 1 99 GLY 99 91 91 GLY GLY D . n D 1 100 ARG 100 92 92 ARG ARG D . n D 1 101 PHE 101 93 93 PHE PHE D . n D 1 102 CYS 102 94 94 CYS CYS D . n D 1 103 ALA 103 95 95 ALA ALA D . n D 1 104 ALA 104 96 96 ALA ALA D . n D 1 105 GLU 105 97 97 GLU GLU D . n D 1 106 GLY 106 98 98 GLY GLY D . n D 1 107 LEU 107 99 99 LEU LEU D . n D 1 108 ASN 108 100 100 ASN ASN D . n D 1 109 ASN 109 101 101 ASN ASN D . n D 1 110 VAL 110 102 102 VAL VAL D . n D 1 111 ASP 111 103 103 ASP ASP D . n D 1 112 THR 112 104 104 THR THR D . n D 1 113 LEU 113 105 105 LEU LEU D . n D 1 114 SER 114 106 106 SER SER D . n D 1 115 ASP 115 107 107 ASP ASP D . n D 1 116 PHE 116 108 108 PHE PHE D . n D 1 117 ARG 117 109 109 ARG ARG D . n D 1 118 GLY 118 110 110 GLY GLY D . n D 1 119 HIS 119 111 111 HIS HIS D . n D 1 120 PHE 120 112 112 PHE PHE D . n D 1 121 GLY 121 113 113 GLY GLY D . n D 1 122 ASP 122 114 114 ASP ASP D . n D 1 123 ASP 123 115 115 ASP ASP D . n D 1 124 TYR 124 116 116 TYR TYR D . n D 1 125 GLY 125 117 117 GLY GLY D . n D 1 126 VAL 126 118 118 VAL VAL D . n D 1 127 THR 127 119 119 THR THR D . n D 1 128 LEU 128 120 120 LEU LEU D . n D 1 129 ALA 129 121 121 ALA ALA D . n D 1 130 ASP 130 122 122 ASP ASP D . n D 1 131 SER 131 123 123 SER SER D . n D 1 132 PRO 132 124 124 PRO PRO D . n D 1 133 LEU 133 125 125 LEU LEU D . n D 1 134 GLN 134 126 126 GLN GLN D . n D 1 135 GLY 135 127 127 GLY GLY D . n D 1 136 LEU 136 128 128 LEU LEU D . n D 1 137 LEU 137 129 129 LEU LEU D . n D 1 138 SER 138 130 130 SER SER D . n D 1 139 ARG 139 131 131 ARG ARG D . n D 1 140 ALA 140 132 132 ALA ALA D . n D 1 141 VAL 141 133 133 VAL VAL D . n D 1 142 VAL 142 134 134 VAL VAL D . n D 1 143 VAL 143 135 135 VAL VAL D . n D 1 144 ALA 144 136 136 ALA ALA D . n D 1 145 ASP 145 137 137 ASP ASP D . n D 1 146 GLU 146 138 138 GLU GLU D . n D 1 147 ASN 147 139 139 ASN ASN D . n D 1 148 GLY 148 140 140 GLY GLY D . n D 1 149 ASN 149 141 141 ASN ASN D . n D 1 150 VAL 150 142 142 VAL VAL D . n D 1 151 VAL 151 143 143 VAL VAL D . n D 1 152 TYR 152 144 144 TYR TYR D . n D 1 153 THR 153 145 145 THR THR D . n D 1 154 GLU 154 146 146 GLU GLU D . n D 1 155 GLN 155 147 147 GLN GLN D . n D 1 156 VAL 156 148 148 VAL VAL D . n D 1 157 PRO 157 149 149 PRO PRO D . n D 1 158 GLU 158 150 150 GLU GLU D . n D 1 159 ILE 159 151 151 ILE ILE D . n D 1 160 ALA 160 152 152 ALA ALA D . n D 1 161 GLN 161 153 153 GLN GLN D . n D 1 162 GLU 162 154 154 GLU GLU D . n D 1 163 PRO 163 155 155 PRO PRO D . n D 1 164 ASN 164 156 156 ASN ASN D . n D 1 165 TYR 165 157 157 TYR TYR D . n D 1 166 ASP 166 158 158 ASP ASP D . n D 1 167 ALA 167 159 159 ALA ALA D . n D 1 168 ALA 168 160 160 ALA ALA D . n D 1 169 LEU 169 161 161 LEU LEU D . n D 1 170 ALA 170 162 162 ALA ALA D . n D 1 171 ALA 171 163 163 ALA ALA D . n D 1 172 LEU 172 164 164 LEU LEU D . n D 1 173 LYS 173 165 165 LYS LYS D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 HOH 1 201 27 HOH HOH A . E 2 HOH 2 202 19 HOH HOH A . E 2 HOH 3 203 34 HOH HOH A . E 2 HOH 4 204 36 HOH HOH A . E 2 HOH 5 205 28 HOH HOH A . E 2 HOH 6 206 35 HOH HOH A . F 2 HOH 1 201 37 HOH HOH B . F 2 HOH 2 202 7 HOH HOH B . G 2 HOH 1 201 38 HOH HOH C . G 2 HOH 2 202 30 HOH HOH C . G 2 HOH 3 203 31 HOH HOH C . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ILE 4 ? CG1 ? A ILE 12 CG1 2 1 Y 1 A ILE 4 ? CG2 ? A ILE 12 CG2 3 1 Y 1 A ILE 4 ? CD1 ? A ILE 12 CD1 4 1 Y 1 A LYS 7 ? CG ? A LYS 15 CG 5 1 Y 1 A LYS 7 ? CD ? A LYS 15 CD 6 1 Y 1 A LYS 7 ? CE ? A LYS 15 CE 7 1 Y 1 A LYS 7 ? NZ ? A LYS 15 NZ 8 1 Y 1 A ILE 11 ? CG1 ? A ILE 19 CG1 9 1 Y 1 A ILE 11 ? CG2 ? A ILE 19 CG2 10 1 Y 1 A ILE 11 ? CD1 ? A ILE 19 CD1 11 1 Y 1 A ILE 20 ? CG1 ? A ILE 28 CG1 12 1 Y 1 A ILE 20 ? CG2 ? A ILE 28 CG2 13 1 Y 1 A ILE 20 ? CD1 ? A ILE 28 CD1 14 1 Y 1 A LYS 37 ? CG ? A LYS 45 CG 15 1 Y 1 A LYS 37 ? CD ? A LYS 45 CD 16 1 Y 1 A LYS 37 ? CE ? A LYS 45 CE 17 1 Y 1 A LYS 37 ? NZ ? A LYS 45 NZ 18 1 Y 1 A LYS 45 ? CG ? A LYS 53 CG 19 1 Y 1 A LYS 45 ? CD ? A LYS 53 CD 20 1 Y 1 A LYS 45 ? CE ? A LYS 53 CE 21 1 Y 1 A LYS 45 ? NZ ? A LYS 53 NZ 22 1 Y 1 A LYS 46 ? CG ? A LYS 54 CG 23 1 Y 1 A LYS 46 ? CD ? A LYS 54 CD 24 1 Y 1 A LYS 46 ? CE ? A LYS 54 CE 25 1 Y 1 A LYS 46 ? NZ ? A LYS 54 NZ 26 1 Y 1 A VAL 59 ? CG1 ? A VAL 67 CG1 27 1 Y 1 A VAL 59 ? CG2 ? A VAL 67 CG2 28 1 Y 1 A ARG 65 ? CG ? A ARG 73 CG 29 1 Y 1 A ARG 65 ? CD ? A ARG 73 CD 30 1 Y 1 A ARG 65 ? NE ? A ARG 73 NE 31 1 Y 1 A ARG 65 ? CZ ? A ARG 73 CZ 32 1 Y 1 A ARG 65 ? NH1 ? A ARG 73 NH1 33 1 Y 1 A ARG 65 ? NH2 ? A ARG 73 NH2 34 1 Y 1 A LYS 66 ? CG ? A LYS 74 CG 35 1 Y 1 A LYS 66 ? CD ? A LYS 74 CD 36 1 Y 1 A LYS 66 ? CE ? A LYS 74 CE 37 1 Y 1 A LYS 66 ? NZ ? A LYS 74 NZ 38 1 Y 1 A ASN 68 ? CG ? A ASN 76 CG 39 1 Y 1 A ASN 68 ? OD1 ? A ASN 76 OD1 40 1 Y 1 A ASN 68 ? ND2 ? A ASN 76 ND2 41 1 Y 1 A GLN 69 ? CG ? A GLN 77 CG 42 1 Y 1 A GLN 69 ? CD ? A GLN 77 CD 43 1 Y 1 A GLN 69 ? OE1 ? A GLN 77 OE1 44 1 Y 1 A GLN 69 ? NE2 ? A GLN 77 NE2 45 1 Y 1 A ASN 73 ? CG ? A ASN 81 CG 46 1 Y 1 A ASN 73 ? OD1 ? A ASN 81 OD1 47 1 Y 1 A ASN 73 ? ND2 ? A ASN 81 ND2 48 1 Y 1 A GLN 153 ? CG ? A GLN 161 CG 49 1 Y 1 A GLN 153 ? CD ? A GLN 161 CD 50 1 Y 1 A GLN 153 ? OE1 ? A GLN 161 OE1 51 1 Y 1 A GLN 153 ? NE2 ? A GLN 161 NE2 52 1 Y 1 B LEU 6 ? CG ? B LEU 14 CG 53 1 Y 1 B LEU 6 ? CD1 ? B LEU 14 CD1 54 1 Y 1 B LEU 6 ? CD2 ? B LEU 14 CD2 55 1 Y 1 B LYS 7 ? CG ? B LYS 15 CG 56 1 Y 1 B LYS 7 ? CD ? B LYS 15 CD 57 1 Y 1 B LYS 7 ? CE ? B LYS 15 CE 58 1 Y 1 B LYS 7 ? NZ ? B LYS 15 NZ 59 1 Y 1 B ASN 9 ? CG ? B ASN 17 CG 60 1 Y 1 B ASN 9 ? OD1 ? B ASN 17 OD1 61 1 Y 1 B ASN 9 ? ND2 ? B ASN 17 ND2 62 1 Y 1 B ILE 11 ? CG1 ? B ILE 19 CG1 63 1 Y 1 B ILE 11 ? CG2 ? B ILE 19 CG2 64 1 Y 1 B ILE 11 ? CD1 ? B ILE 19 CD1 65 1 Y 1 B ASN 16 ? CG ? B ASN 24 CG 66 1 Y 1 B ASN 16 ? OD1 ? B ASN 24 OD1 67 1 Y 1 B ASN 16 ? ND2 ? B ASN 24 ND2 68 1 Y 1 B LEU 17 ? CG ? B LEU 25 CG 69 1 Y 1 B LEU 17 ? CD1 ? B LEU 25 CD1 70 1 Y 1 B LEU 17 ? CD2 ? B LEU 25 CD2 71 1 Y 1 B ILE 20 ? CG1 ? B ILE 28 CG1 72 1 Y 1 B ILE 20 ? CG2 ? B ILE 28 CG2 73 1 Y 1 B ILE 20 ? CD1 ? B ILE 28 CD1 74 1 Y 1 B LYS 25 ? CG ? B LYS 33 CG 75 1 Y 1 B LYS 25 ? CD ? B LYS 33 CD 76 1 Y 1 B LYS 25 ? CE ? B LYS 33 CE 77 1 Y 1 B LYS 25 ? NZ ? B LYS 33 NZ 78 1 Y 1 B LYS 37 ? CG ? B LYS 45 CG 79 1 Y 1 B LYS 37 ? CD ? B LYS 45 CD 80 1 Y 1 B LYS 37 ? CE ? B LYS 45 CE 81 1 Y 1 B LYS 37 ? NZ ? B LYS 45 NZ 82 1 Y 1 B LYS 43 ? CG ? B LYS 51 CG 83 1 Y 1 B LYS 43 ? CD ? B LYS 51 CD 84 1 Y 1 B LYS 43 ? CE ? B LYS 51 CE 85 1 Y 1 B LYS 43 ? NZ ? B LYS 51 NZ 86 1 Y 1 B LYS 45 ? CG ? B LYS 53 CG 87 1 Y 1 B LYS 45 ? CD ? B LYS 53 CD 88 1 Y 1 B LYS 45 ? CE ? B LYS 53 CE 89 1 Y 1 B LYS 45 ? NZ ? B LYS 53 NZ 90 1 Y 1 B LYS 46 ? CG ? B LYS 54 CG 91 1 Y 1 B LYS 46 ? CD ? B LYS 54 CD 92 1 Y 1 B LYS 46 ? CE ? B LYS 54 CE 93 1 Y 1 B LYS 46 ? NZ ? B LYS 54 NZ 94 1 Y 1 B VAL 59 ? CG1 ? B VAL 67 CG1 95 1 Y 1 B VAL 59 ? CG2 ? B VAL 67 CG2 96 1 Y 1 B ARG 65 ? CG ? B ARG 73 CG 97 1 Y 1 B ARG 65 ? CD ? B ARG 73 CD 98 1 Y 1 B ARG 65 ? NE ? B ARG 73 NE 99 1 Y 1 B ARG 65 ? CZ ? B ARG 73 CZ 100 1 Y 1 B ARG 65 ? NH1 ? B ARG 73 NH1 101 1 Y 1 B ARG 65 ? NH2 ? B ARG 73 NH2 102 1 Y 1 B GLN 69 ? CG ? B GLN 77 CG 103 1 Y 1 B GLN 69 ? CD ? B GLN 77 CD 104 1 Y 1 B GLN 69 ? OE1 ? B GLN 77 OE1 105 1 Y 1 B GLN 69 ? NE2 ? B GLN 77 NE2 106 1 Y 1 B ASN 73 ? CG ? B ASN 81 CG 107 1 Y 1 B ASN 73 ? OD1 ? B ASN 81 OD1 108 1 Y 1 B ASN 73 ? ND2 ? B ASN 81 ND2 109 1 Y 1 B ASP 75 ? CG ? B ASP 83 CG 110 1 Y 1 B ASP 75 ? OD1 ? B ASP 83 OD1 111 1 Y 1 B ASP 75 ? OD2 ? B ASP 83 OD2 112 1 Y 1 B ASN 141 ? CG ? B ASN 149 CG 113 1 Y 1 B ASN 141 ? OD1 ? B ASN 149 OD1 114 1 Y 1 B ASN 141 ? ND2 ? B ASN 149 ND2 115 1 Y 1 B LYS 165 ? CG ? B LYS 173 CG 116 1 Y 1 B LYS 165 ? CD ? B LYS 173 CD 117 1 Y 1 B LYS 165 ? CE ? B LYS 173 CE 118 1 Y 1 B LYS 165 ? NZ ? B LYS 173 NZ 119 1 Y 1 C ILE 4 ? CG1 ? C ILE 12 CG1 120 1 Y 1 C ILE 4 ? CG2 ? C ILE 12 CG2 121 1 Y 1 C ILE 4 ? CD1 ? C ILE 12 CD1 122 1 Y 1 C LEU 6 ? CG ? C LEU 14 CG 123 1 Y 1 C LEU 6 ? CD1 ? C LEU 14 CD1 124 1 Y 1 C LEU 6 ? CD2 ? C LEU 14 CD2 125 1 Y 1 C LYS 7 ? CG ? C LYS 15 CG 126 1 Y 1 C LYS 7 ? CD ? C LYS 15 CD 127 1 Y 1 C LYS 7 ? CE ? C LYS 15 CE 128 1 Y 1 C LYS 7 ? NZ ? C LYS 15 NZ 129 1 Y 1 C ASN 9 ? CG ? C ASN 17 CG 130 1 Y 1 C ASN 9 ? OD1 ? C ASN 17 OD1 131 1 Y 1 C ASN 9 ? ND2 ? C ASN 17 ND2 132 1 Y 1 C ILE 11 ? CG1 ? C ILE 19 CG1 133 1 Y 1 C ILE 11 ? CG2 ? C ILE 19 CG2 134 1 Y 1 C ILE 11 ? CD1 ? C ILE 19 CD1 135 1 Y 1 C ASN 16 ? CG ? C ASN 24 CG 136 1 Y 1 C ASN 16 ? OD1 ? C ASN 24 OD1 137 1 Y 1 C ASN 16 ? ND2 ? C ASN 24 ND2 138 1 Y 1 C ILE 20 ? CG1 ? C ILE 28 CG1 139 1 Y 1 C ILE 20 ? CG2 ? C ILE 28 CG2 140 1 Y 1 C ILE 20 ? CD1 ? C ILE 28 CD1 141 1 Y 1 C LYS 25 ? CG ? C LYS 33 CG 142 1 Y 1 C LYS 25 ? CD ? C LYS 33 CD 143 1 Y 1 C LYS 25 ? CE ? C LYS 33 CE 144 1 Y 1 C LYS 25 ? NZ ? C LYS 33 NZ 145 1 Y 1 C LYS 43 ? CG ? C LYS 51 CG 146 1 Y 1 C LYS 43 ? CD ? C LYS 51 CD 147 1 Y 1 C LYS 43 ? CE ? C LYS 51 CE 148 1 Y 1 C LYS 43 ? NZ ? C LYS 51 NZ 149 1 Y 1 C LYS 46 ? CG ? C LYS 54 CG 150 1 Y 1 C LYS 46 ? CD ? C LYS 54 CD 151 1 Y 1 C LYS 46 ? CE ? C LYS 54 CE 152 1 Y 1 C LYS 46 ? NZ ? C LYS 54 NZ 153 1 Y 1 C VAL 59 ? CG1 ? C VAL 67 CG1 154 1 Y 1 C VAL 59 ? CG2 ? C VAL 67 CG2 155 1 Y 1 C ARG 65 ? CG ? C ARG 73 CG 156 1 Y 1 C ARG 65 ? CD ? C ARG 73 CD 157 1 Y 1 C ARG 65 ? NE ? C ARG 73 NE 158 1 Y 1 C ARG 65 ? CZ ? C ARG 73 CZ 159 1 Y 1 C ARG 65 ? NH1 ? C ARG 73 NH1 160 1 Y 1 C ARG 65 ? NH2 ? C ARG 73 NH2 161 1 Y 1 C LYS 66 ? CG ? C LYS 74 CG 162 1 Y 1 C LYS 66 ? CD ? C LYS 74 CD 163 1 Y 1 C LYS 66 ? CE ? C LYS 74 CE 164 1 Y 1 C LYS 66 ? NZ ? C LYS 74 NZ 165 1 Y 1 C PHE 67 ? CG ? C PHE 75 CG 166 1 Y 1 C PHE 67 ? CD1 ? C PHE 75 CD1 167 1 Y 1 C PHE 67 ? CD2 ? C PHE 75 CD2 168 1 Y 1 C PHE 67 ? CE1 ? C PHE 75 CE1 169 1 Y 1 C PHE 67 ? CE2 ? C PHE 75 CE2 170 1 Y 1 C PHE 67 ? CZ ? C PHE 75 CZ 171 1 Y 1 C GLN 69 ? CG ? C GLN 77 CG 172 1 Y 1 C GLN 69 ? CD ? C GLN 77 CD 173 1 Y 1 C GLN 69 ? OE1 ? C GLN 77 OE1 174 1 Y 1 C GLN 69 ? NE2 ? C GLN 77 NE2 175 1 Y 1 C GLU 70 ? CG ? C GLU 78 CG 176 1 Y 1 C GLU 70 ? CD ? C GLU 78 CD 177 1 Y 1 C GLU 70 ? OE1 ? C GLU 78 OE1 178 1 Y 1 C GLU 70 ? OE2 ? C GLU 78 OE2 179 1 Y 1 C ASN 73 ? CG ? C ASN 81 CG 180 1 Y 1 C ASN 73 ? OD1 ? C ASN 81 OD1 181 1 Y 1 C ASN 73 ? ND2 ? C ASN 81 ND2 182 1 Y 1 C ASP 75 ? CG ? C ASP 83 CG 183 1 Y 1 C ASP 75 ? OD1 ? C ASP 83 OD1 184 1 Y 1 C ASP 75 ? OD2 ? C ASP 83 OD2 185 1 Y 1 C GLU 97 ? CG ? C GLU 105 CG 186 1 Y 1 C GLU 97 ? CD ? C GLU 105 CD 187 1 Y 1 C GLU 97 ? OE1 ? C GLU 105 OE1 188 1 Y 1 C GLU 97 ? OE2 ? C GLU 105 OE2 189 1 Y 1 C ASN 139 ? CG ? C ASN 147 CG 190 1 Y 1 C ASN 139 ? OD1 ? C ASN 147 OD1 191 1 Y 1 C ASN 139 ? ND2 ? C ASN 147 ND2 192 1 Y 1 C TYR 144 ? CG ? C TYR 152 CG 193 1 Y 1 C TYR 144 ? CD1 ? C TYR 152 CD1 194 1 Y 1 C TYR 144 ? CD2 ? C TYR 152 CD2 195 1 Y 1 C TYR 144 ? CE1 ? C TYR 152 CE1 196 1 Y 1 C TYR 144 ? CE2 ? C TYR 152 CE2 197 1 Y 1 C TYR 144 ? CZ ? C TYR 152 CZ 198 1 Y 1 C TYR 144 ? OH ? C TYR 152 OH 199 1 Y 1 C GLU 146 ? CG ? C GLU 154 CG 200 1 Y 1 C GLU 146 ? CD ? C GLU 154 CD 201 1 Y 1 C GLU 146 ? OE1 ? C GLU 154 OE1 202 1 Y 1 C GLU 146 ? OE2 ? C GLU 154 OE2 203 1 Y 1 C VAL 148 ? CG1 ? C VAL 156 CG1 204 1 Y 1 C VAL 148 ? CG2 ? C VAL 156 CG2 205 1 Y 1 C GLU 150 ? CG ? C GLU 158 CG 206 1 Y 1 C GLU 150 ? CD ? C GLU 158 CD 207 1 Y 1 C GLU 150 ? OE1 ? C GLU 158 OE1 208 1 Y 1 C GLU 150 ? OE2 ? C GLU 158 OE2 209 1 Y 1 C GLN 153 ? CG ? C GLN 161 CG 210 1 Y 1 C GLN 153 ? CD ? C GLN 161 CD 211 1 Y 1 C GLN 153 ? OE1 ? C GLN 161 OE1 212 1 Y 1 C GLN 153 ? NE2 ? C GLN 161 NE2 213 1 Y 1 C GLU 154 ? CG ? C GLU 162 CG 214 1 Y 1 C GLU 154 ? CD ? C GLU 162 CD 215 1 Y 1 C GLU 154 ? OE1 ? C GLU 162 OE1 216 1 Y 1 C GLU 154 ? OE2 ? C GLU 162 OE2 217 1 Y 1 C ASP 158 ? CG ? C ASP 166 CG 218 1 Y 1 C ASP 158 ? OD1 ? C ASP 166 OD1 219 1 Y 1 C ASP 158 ? OD2 ? C ASP 166 OD2 220 1 Y 1 C LEU 164 ? CG ? C LEU 172 CG 221 1 Y 1 C LEU 164 ? CD1 ? C LEU 172 CD1 222 1 Y 1 C LEU 164 ? CD2 ? C LEU 172 CD2 223 1 Y 1 C LYS 165 ? CG ? C LYS 173 CG 224 1 Y 1 C LYS 165 ? CD ? C LYS 173 CD 225 1 Y 1 C LYS 165 ? CE ? C LYS 173 CE 226 1 Y 1 C LYS 165 ? NZ ? C LYS 173 NZ 227 1 Y 1 D ILE 4 ? CG1 ? D ILE 12 CG1 228 1 Y 1 D ILE 4 ? CG2 ? D ILE 12 CG2 229 1 Y 1 D ILE 4 ? CD1 ? D ILE 12 CD1 230 1 Y 1 D LEU 6 ? CG ? D LEU 14 CG 231 1 Y 1 D LEU 6 ? CD1 ? D LEU 14 CD1 232 1 Y 1 D LEU 6 ? CD2 ? D LEU 14 CD2 233 1 Y 1 D LYS 7 ? CG ? D LYS 15 CG 234 1 Y 1 D LYS 7 ? CD ? D LYS 15 CD 235 1 Y 1 D LYS 7 ? CE ? D LYS 15 CE 236 1 Y 1 D LYS 7 ? NZ ? D LYS 15 NZ 237 1 Y 1 D ILE 11 ? CG1 ? D ILE 19 CG1 238 1 Y 1 D ILE 11 ? CG2 ? D ILE 19 CG2 239 1 Y 1 D ILE 11 ? CD1 ? D ILE 19 CD1 240 1 Y 1 D VAL 14 ? CG1 ? D VAL 22 CG1 241 1 Y 1 D VAL 14 ? CG2 ? D VAL 22 CG2 242 1 Y 1 D ILE 20 ? CG1 ? D ILE 28 CG1 243 1 Y 1 D ILE 20 ? CG2 ? D ILE 28 CG2 244 1 Y 1 D ILE 20 ? CD1 ? D ILE 28 CD1 245 1 Y 1 D LYS 43 ? CG ? D LYS 51 CG 246 1 Y 1 D LYS 43 ? CD ? D LYS 51 CD 247 1 Y 1 D LYS 43 ? CE ? D LYS 51 CE 248 1 Y 1 D LYS 43 ? NZ ? D LYS 51 NZ 249 1 Y 1 D LYS 45 ? CG ? D LYS 53 CG 250 1 Y 1 D LYS 45 ? CD ? D LYS 53 CD 251 1 Y 1 D LYS 45 ? CE ? D LYS 53 CE 252 1 Y 1 D LYS 45 ? NZ ? D LYS 53 NZ 253 1 Y 1 D LYS 46 ? CG ? D LYS 54 CG 254 1 Y 1 D LYS 46 ? CD ? D LYS 54 CD 255 1 Y 1 D LYS 46 ? CE ? D LYS 54 CE 256 1 Y 1 D LYS 46 ? NZ ? D LYS 54 NZ 257 1 Y 1 D VAL 59 ? CG1 ? D VAL 67 CG1 258 1 Y 1 D VAL 59 ? CG2 ? D VAL 67 CG2 259 1 Y 1 D ARG 65 ? CG ? D ARG 73 CG 260 1 Y 1 D ARG 65 ? CD ? D ARG 73 CD 261 1 Y 1 D ARG 65 ? NE ? D ARG 73 NE 262 1 Y 1 D ARG 65 ? CZ ? D ARG 73 CZ 263 1 Y 1 D ARG 65 ? NH1 ? D ARG 73 NH1 264 1 Y 1 D ARG 65 ? NH2 ? D ARG 73 NH2 265 1 Y 1 D LYS 66 ? CG ? D LYS 74 CG 266 1 Y 1 D LYS 66 ? CD ? D LYS 74 CD 267 1 Y 1 D LYS 66 ? CE ? D LYS 74 CE 268 1 Y 1 D LYS 66 ? NZ ? D LYS 74 NZ 269 1 Y 1 D GLN 69 ? CG ? D GLN 77 CG 270 1 Y 1 D GLN 69 ? CD ? D GLN 77 CD 271 1 Y 1 D GLN 69 ? OE1 ? D GLN 77 OE1 272 1 Y 1 D GLN 69 ? NE2 ? D GLN 77 NE2 273 1 Y 1 D GLU 70 ? CG ? D GLU 78 CG 274 1 Y 1 D GLU 70 ? CD ? D GLU 78 CD 275 1 Y 1 D GLU 70 ? OE1 ? D GLU 78 OE1 276 1 Y 1 D GLU 70 ? OE2 ? D GLU 78 OE2 277 1 Y 1 D ASN 73 ? CG ? D ASN 81 CG 278 1 Y 1 D ASN 73 ? OD1 ? D ASN 81 OD1 279 1 Y 1 D ASN 73 ? ND2 ? D ASN 81 ND2 280 1 Y 1 D ASP 75 ? CG ? D ASP 83 CG 281 1 Y 1 D ASP 75 ? OD1 ? D ASP 83 OD1 282 1 Y 1 D ASP 75 ? OD2 ? D ASP 83 OD2 283 1 Y 1 D GLU 97 ? CG ? D GLU 105 CG 284 1 Y 1 D GLU 97 ? CD ? D GLU 105 CD 285 1 Y 1 D GLU 97 ? OE1 ? D GLU 105 OE1 286 1 Y 1 D GLU 97 ? OE2 ? D GLU 105 OE2 287 1 Y 1 D LEU 99 ? CG ? D LEU 107 CG 288 1 Y 1 D LEU 99 ? CD1 ? D LEU 107 CD1 289 1 Y 1 D LEU 99 ? CD2 ? D LEU 107 CD2 290 1 Y 1 D ASN 100 ? CG ? D ASN 108 CG 291 1 Y 1 D ASN 100 ? OD1 ? D ASN 108 OD1 292 1 Y 1 D ASN 100 ? ND2 ? D ASN 108 ND2 293 1 Y 1 D ASN 141 ? CG ? D ASN 149 CG 294 1 Y 1 D ASN 141 ? OD1 ? D ASN 149 OD1 295 1 Y 1 D ASN 141 ? ND2 ? D ASN 149 ND2 296 1 Y 1 D GLN 153 ? CG ? D GLN 161 CG 297 1 Y 1 D GLN 153 ? CD ? D GLN 161 CD 298 1 Y 1 D GLN 153 ? OE1 ? D GLN 161 OE1 299 1 Y 1 D GLN 153 ? NE2 ? D GLN 161 NE2 300 1 Y 1 D GLU 154 ? CG ? D GLU 162 CG 301 1 Y 1 D GLU 154 ? CD ? D GLU 162 CD 302 1 Y 1 D GLU 154 ? OE1 ? D GLU 162 OE1 303 1 Y 1 D GLU 154 ? OE2 ? D GLU 162 OE2 304 1 Y 1 D LEU 161 ? CG ? D LEU 169 CG 305 1 Y 1 D LEU 161 ? CD1 ? D LEU 169 CD1 306 1 Y 1 D LEU 161 ? CD2 ? D LEU 169 CD2 307 1 Y 1 D LYS 165 ? CG ? D LYS 173 CG 308 1 Y 1 D LYS 165 ? CD ? D LYS 173 CD 309 1 Y 1 D LYS 165 ? CE ? D LYS 173 CE 310 1 Y 1 D LYS 165 ? NZ ? D LYS 173 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MoRDa ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 6 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 7 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6UDG _cell.details ? _cell.formula_units_Z ? _cell.length_a 53.590 _cell.length_a_esd ? _cell.length_b 107.800 _cell.length_b_esd ? _cell.length_c 113.700 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6UDG _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6UDG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.21 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.39 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Anatrace Morpheus screen, well g8: 12.5% w/v PEG 1000, 12.5% w/v PEG 3350, 12.5% v/v MPD: 20mM of each sodium formate, ammonium acetate, trisodium citrate, sodium potassium Ltartrate, sodium oxamate: 100mM MOPS/HEPES-Na pH 7.5: ElanA.00055.a.B1, PW38308, at 23mg/ml: cryo: direct: tray 294018 g8: puck xoe2-6. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-300' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-11-24 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'C(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97872 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-F' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97872 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-F _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 64.797 _reflns.entry_id 6UDG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.650 _reflns.d_resolution_low 48.700 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19753 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.840 _reflns.pdbx_Rmerge_I_obs 0.070 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.180 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.991 _reflns.pdbx_scaling_rejects 4 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.078 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 95601 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.650 2.720 ? 2.840 ? 7131 1434 ? 1431 99.800 ? ? ? ? 0.618 ? ? ? ? ? ? ? ? 4.983 ? ? ? ? 0.693 ? ? 1 1 0.882 ? 2.720 2.790 ? 3.390 ? 7056 1417 ? 1416 99.900 ? ? ? ? 0.501 ? ? ? ? ? ? ? ? 4.983 ? ? ? ? 0.562 ? ? 2 1 0.908 ? 2.790 2.870 ? 3.740 ? 6682 1343 ? 1342 99.900 ? ? ? ? 0.452 ? ? ? ? ? ? ? ? 4.979 ? ? ? ? 0.507 ? ? 3 1 0.918 ? 2.870 2.960 ? 4.960 ? 6632 1337 ? 1335 99.900 ? ? ? ? 0.336 ? ? ? ? ? ? ? ? 4.968 ? ? ? ? 0.377 ? ? 4 1 0.962 ? 2.960 3.060 ? 6.020 ? 6330 1285 ? 1282 99.800 ? ? ? ? 0.257 ? ? ? ? ? ? ? ? 4.938 ? ? ? ? 0.289 ? ? 5 1 0.974 ? 3.060 3.170 ? 7.480 ? 6262 1267 ? 1264 99.800 ? ? ? ? 0.198 ? ? ? ? ? ? ? ? 4.954 ? ? ? ? 0.222 ? ? 6 1 0.983 ? 3.170 3.290 ? 8.430 ? 5809 1183 ? 1183 100.000 ? ? ? ? 0.166 ? ? ? ? ? ? ? ? 4.910 ? ? ? ? 0.187 ? ? 7 1 0.986 ? 3.290 3.420 ? 10.750 ? 5674 1156 ? 1155 99.900 ? ? ? ? 0.128 ? ? ? ? ? ? ? ? 4.913 ? ? ? ? 0.143 ? ? 8 1 0.992 ? 3.420 3.570 ? 13.700 ? 5596 1140 ? 1139 99.900 ? ? ? ? 0.092 ? ? ? ? ? ? ? ? 4.913 ? ? ? ? 0.103 ? ? 9 1 0.996 ? 3.570 3.750 ? 16.700 ? 5121 1055 ? 1052 99.700 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 4.868 ? ? ? ? 0.082 ? ? 10 1 0.997 ? 3.750 3.950 ? 18.560 ? 4940 1025 ? 1025 100.000 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 4.820 ? ? ? ? 0.073 ? ? 11 1 0.997 ? 3.950 4.190 ? 20.790 ? 4628 968 ? 966 99.800 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 4.791 ? ? ? ? 0.063 ? ? 12 1 0.997 ? 4.190 4.480 ? 23.740 ? 4386 934 ? 928 99.400 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 4.726 ? ? ? ? 0.052 ? ? 13 1 0.998 ? 4.480 4.840 ? 27.180 ? 4009 847 ? 843 99.500 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 4.756 ? ? ? ? 0.049 ? ? 14 1 0.998 ? 4.840 5.300 ? 27.930 ? 3663 781 ? 778 99.600 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 4.708 ? ? ? ? 0.046 ? ? 15 1 0.997 ? 5.300 5.930 ? 27.490 ? 3425 732 ? 730 99.700 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 4.692 ? ? ? ? 0.049 ? ? 16 1 0.998 ? 5.930 6.840 ? 29.290 ? 2904 639 ? 636 99.500 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 4.566 ? ? ? ? 0.046 ? ? 17 1 0.998 ? 6.840 8.380 ? 32.280 ? 2471 554 ? 551 99.500 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 4.485 ? ? ? ? 0.040 ? ? 18 1 0.998 ? 8.380 11.850 ? 36.010 ? 1883 443 ? 439 99.100 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 4.289 ? ? ? ? 0.039 ? ? 19 1 0.998 ? 11.850 48.700 ? 33.980 ? 999 270 ? 258 95.600 ? ? ? ? 0.034 ? ? ? ? ? ? ? ? 3.872 ? ? ? ? 0.038 ? ? 20 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 206.730 _refine.B_iso_mean 80.7365 _refine.B_iso_min 38.830 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6UDG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6500 _refine.ls_d_res_low 48.7000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19723 _refine.ls_number_reflns_R_free 2096 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5800 _refine.ls_percent_reflns_R_free 10.6300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2171 _refine.ls_R_factor_R_free 0.2805 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2095 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4je1A _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 35.8000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.6500 _refine_hist.d_res_low 48.7000 _refine_hist.number_atoms_solvent 11 _refine_hist.number_atoms_total 4557 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 648 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 56.50 _refine_hist.pdbx_number_atoms_protein 4546 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.004 ? ? 4612 'X-RAY DIFFRACTION' ? f_angle_d 0.733 ? ? 6327 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 13.449 ? ? 2738 'X-RAY DIFFRACTION' ? f_chiral_restr 0.048 ? ? 775 'X-RAY DIFFRACTION' ? f_plane_restr 0.006 ? ? 859 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 2619 12.011 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 2619 12.011 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 2619 12.011 ? 1 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 4 TORSIONAL ? D 2619 12.011 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6500 2.7100 1302 . 151 1151 100.0000 . . . 0.4076 0.0000 0.3540 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.7100 2.7800 1266 . 146 1120 100.0000 . . . 0.4365 0.0000 0.3262 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.7800 2.8500 1315 . 150 1165 100.0000 . . . 0.4275 0.0000 0.3142 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.8500 2.9400 1279 . 118 1161 100.0000 . . . 0.3831 0.0000 0.2914 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.9400 3.0300 1291 . 140 1151 99.0000 . . . 0.4115 0.0000 0.2855 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.0300 3.1400 1302 . 135 1167 100.0000 . . . 0.4183 0.0000 0.2703 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.1400 3.2700 1293 . 139 1154 100.0000 . . . 0.3199 0.0000 0.2651 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.2700 3.4200 1305 . 102 1203 100.0000 . . . 0.3319 0.0000 0.2420 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.4200 3.6000 1325 . 132 1193 100.0000 . . . 0.3063 0.0000 0.2083 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.6000 3.8200 1308 . 155 1153 100.0000 . . . 0.2568 0.0000 0.2010 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.8200 4.1200 1316 . 116 1200 100.0000 . . . 0.3276 0.0000 0.1956 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 4.1200 4.5300 1312 . 170 1142 99.0000 . . . 0.2253 0.0000 0.1680 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 4.5300 5.1900 1335 . 138 1197 100.0000 . . . 0.2366 0.0000 0.1608 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 5.1900 6.5300 1353 . 156 1197 100.0000 . . . 0.2285 0.0000 0.2094 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 6.5300 48.7000 1421 . 148 1273 98.0000 . . . 0.2253 0.0000 0.1686 . . . . . . 15 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 5 or (resid 6 through 7 and (name N or name CA or name C or name O or name CB )) or resid 8 or (resid 9 through 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resid 15 or (resid 16 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 66 or (resid 67 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 through 157 or (resid 158 through 164 and (name N or name CA or name C or name O or name CB )) or (resid 165 and (name N or name CA or name C or name O or name CB or name OXT)))) ; 1 2 ;(chain B and (resid 5 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resid 15 through 65 or (resid 66 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 152 or (resid 153 through 154 and (name N or name CA or name C or name O or name CB )) or resid 155 through 157 or (resid 158 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; 1 3 ;(chain C and (resid 5 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or (resid 15 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 44 or (resid 45 through 46 and (name N or name CA or name C or name O or name CB )) or resid 47 through 67 or (resid 68 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 through 160 or (resid 161 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; 1 4 ;(chain D and (resid 5 through 8 or (resid 9 through 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 15 or (resid 16 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 66 or (resid 67 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 157 or (resid 158 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A THR 13 . A THR 13 . A THR 5 A THR 5 ? ;(chain A and (resid 5 or (resid 6 through 7 and (name N or name CA or name C or name O or name CB )) or resid 8 or (resid 9 through 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resid 15 or (resid 16 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 66 or (resid 67 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 through 157 or (resid 158 through 164 and (name N or name CA or name C or name O or name CB )) or (resid 165 and (name N or name CA or name C or name O or name CB or name OXT)))) ; 1 1 2 A LEU 14 . A LYS 15 . A LEU 6 A LYS 7 ? ;(chain A and (resid 5 or (resid 6 through 7 and (name N or name CA or name C or name O or name CB )) or resid 8 or (resid 9 through 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resid 15 or (resid 16 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 66 or (resid 67 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 through 157 or (resid 158 through 164 and (name N or name CA or name C or name O or name CB )) or (resid 165 and (name N or name CA or name C or name O or name CB or name OXT)))) ; 1 1 3 A ASN 11 . A LYS 173 . A ASN 3 A LYS 165 ? ;(chain A and (resid 5 or (resid 6 through 7 and (name N or name CA or name C or name O or name CB )) or resid 8 or (resid 9 through 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resid 15 or (resid 16 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 66 or (resid 67 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 through 157 or (resid 158 through 164 and (name N or name CA or name C or name O or name CB )) or (resid 165 and (name N or name CA or name C or name O or name CB or name OXT)))) ; 1 1 4 A ASN 11 . A LYS 173 . A ASN 3 A LYS 165 ? ;(chain A and (resid 5 or (resid 6 through 7 and (name N or name CA or name C or name O or name CB )) or resid 8 or (resid 9 through 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resid 15 or (resid 16 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 66 or (resid 67 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 through 157 or (resid 158 through 164 and (name N or name CA or name C or name O or name CB )) or (resid 165 and (name N or name CA or name C or name O or name CB or name OXT)))) ; 1 1 5 A ASN 11 . A LYS 173 . A ASN 3 A LYS 165 ? ;(chain A and (resid 5 or (resid 6 through 7 and (name N or name CA or name C or name O or name CB )) or resid 8 or (resid 9 through 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resid 15 or (resid 16 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 66 or (resid 67 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 through 157 or (resid 158 through 164 and (name N or name CA or name C or name O or name CB )) or (resid 165 and (name N or name CA or name C or name O or name CB or name OXT)))) ; 1 2 1 B THR 13 . B THR 21 . B THR 5 B THR 13 ? ;(chain B and (resid 5 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resid 15 through 65 or (resid 66 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 152 or (resid 153 through 154 and (name N or name CA or name C or name O or name CB )) or resid 155 through 157 or (resid 158 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; 1 2 2 B VAL 22 . B VAL 22 . B VAL 14 B VAL 14 ? ;(chain B and (resid 5 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resid 15 through 65 or (resid 66 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 152 or (resid 153 through 154 and (name N or name CA or name C or name O or name CB )) or resid 155 through 157 or (resid 158 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; 1 2 3 B THR 13 . B LYS 173 . B THR 5 B LYS 165 ? ;(chain B and (resid 5 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resid 15 through 65 or (resid 66 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 152 or (resid 153 through 154 and (name N or name CA or name C or name O or name CB )) or resid 155 through 157 or (resid 158 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; 1 3 1 C THR 13 . C THR 21 . C THR 5 C THR 13 ? ;(chain C and (resid 5 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or (resid 15 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 44 or (resid 45 through 46 and (name N or name CA or name C or name O or name CB )) or resid 47 through 67 or (resid 68 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 through 160 or (resid 161 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; 1 3 2 C VAL 22 . C VAL 22 . C VAL 14 C VAL 14 ? ;(chain C and (resid 5 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or (resid 15 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 44 or (resid 45 through 46 and (name N or name CA or name C or name O or name CB )) or resid 47 through 67 or (resid 68 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 through 160 or (resid 161 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; 1 3 3 C ILE 12 . C LYS 173 . C ILE 4 C LYS 165 ? ;(chain C and (resid 5 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or (resid 15 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 44 or (resid 45 through 46 and (name N or name CA or name C or name O or name CB )) or resid 47 through 67 or (resid 68 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 through 160 or (resid 161 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; 1 3 4 C ILE 12 . C LYS 173 . C ILE 4 C LYS 165 ? ;(chain C and (resid 5 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or (resid 15 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 44 or (resid 45 through 46 and (name N or name CA or name C or name O or name CB )) or resid 47 through 67 or (resid 68 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 through 160 or (resid 161 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; 1 3 5 C ILE 12 . C LYS 173 . C ILE 4 C LYS 165 ? ;(chain C and (resid 5 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or (resid 15 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 44 or (resid 45 through 46 and (name N or name CA or name C or name O or name CB )) or resid 47 through 67 or (resid 68 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 through 160 or (resid 161 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; 1 3 6 C ILE 12 . C LYS 173 . C ILE 4 C LYS 165 ? ;(chain C and (resid 5 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or (resid 15 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 44 or (resid 45 through 46 and (name N or name CA or name C or name O or name CB )) or resid 47 through 67 or (resid 68 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 through 160 or (resid 161 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; 1 4 1 D THR 13 . D GLY 16 . D THR 5 D GLY 8 ? ;(chain D and (resid 5 through 8 or (resid 9 through 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 15 or (resid 16 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 66 or (resid 67 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 157 or (resid 158 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; 1 4 2 D ASN 17 . D ILE 19 . D ASN 9 D ILE 11 ? ;(chain D and (resid 5 through 8 or (resid 9 through 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 15 or (resid 16 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 66 or (resid 67 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 157 or (resid 158 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; 1 4 3 D ILE 12 . D LYS 173 . D ILE 4 D LYS 165 ? ;(chain D and (resid 5 through 8 or (resid 9 through 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 15 or (resid 16 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 66 or (resid 67 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 157 or (resid 158 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; 1 4 4 D ILE 12 . D LYS 173 . D ILE 4 D LYS 165 ? ;(chain D and (resid 5 through 8 or (resid 9 through 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 15 or (resid 16 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 66 or (resid 67 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 157 or (resid 158 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; 1 4 5 D ILE 12 . D LYS 173 . D ILE 4 D LYS 165 ? ;(chain D and (resid 5 through 8 or (resid 9 through 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 15 or (resid 16 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 66 or (resid 67 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 157 or (resid 158 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; 1 4 6 D ILE 12 . D LYS 173 . D ILE 4 D LYS 165 ? ;(chain D and (resid 5 through 8 or (resid 9 through 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 15 or (resid 16 through 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 66 or (resid 67 through 71 and (name N or name CA or name C or name O or name CB )) or resid 72 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 157 or (resid 158 through 164 and (name N or name CA or name C or name O or name CB )) or resid 165)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 6UDG _struct.title 'Crystal structure of a Probable thiol peroxidase from Elizabethkingia anophelis NUHP1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6UDG _struct_keywords.text ;SSGCID, Structural Genomics, Elizabethkingia anophelis, tpx, Thiol peroxidase, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE ; _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A077EJK0_9FLAO _struct_ref.pdbx_db_accession A0A077EJK0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MANITLKGNAISTVGNLPNIGEQLKDFTLVNADLSEKTLADYKGKKVVLNIFPSIDTGVCAASARKFNQEASNLDNTVVV NVSKDLPFALGRFCAAEGLNNVDTLSDFRGHFGDDYGVTLADSPLQGLLSRAVVVADENGNVVYTEQVPEIAQEPNYDAA LAALK ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6UDG A 9 ? 173 ? A0A077EJK0 1 ? 165 ? 1 165 2 1 6UDG B 9 ? 173 ? A0A077EJK0 1 ? 165 ? 1 165 3 1 6UDG C 9 ? 173 ? A0A077EJK0 1 ? 165 ? 1 165 4 1 6UDG D 9 ? 173 ? A0A077EJK0 1 ? 165 ? 1 165 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6UDG MET A 1 ? UNP A0A077EJK0 ? ? 'expression tag' -7 1 1 6UDG ALA A 2 ? UNP A0A077EJK0 ? ? 'expression tag' -6 2 1 6UDG HIS A 3 ? UNP A0A077EJK0 ? ? 'expression tag' -5 3 1 6UDG HIS A 4 ? UNP A0A077EJK0 ? ? 'expression tag' -4 4 1 6UDG HIS A 5 ? UNP A0A077EJK0 ? ? 'expression tag' -3 5 1 6UDG HIS A 6 ? UNP A0A077EJK0 ? ? 'expression tag' -2 6 1 6UDG HIS A 7 ? UNP A0A077EJK0 ? ? 'expression tag' -1 7 1 6UDG HIS A 8 ? UNP A0A077EJK0 ? ? 'expression tag' 0 8 2 6UDG MET B 1 ? UNP A0A077EJK0 ? ? 'expression tag' -7 9 2 6UDG ALA B 2 ? UNP A0A077EJK0 ? ? 'expression tag' -6 10 2 6UDG HIS B 3 ? UNP A0A077EJK0 ? ? 'expression tag' -5 11 2 6UDG HIS B 4 ? UNP A0A077EJK0 ? ? 'expression tag' -4 12 2 6UDG HIS B 5 ? UNP A0A077EJK0 ? ? 'expression tag' -3 13 2 6UDG HIS B 6 ? UNP A0A077EJK0 ? ? 'expression tag' -2 14 2 6UDG HIS B 7 ? UNP A0A077EJK0 ? ? 'expression tag' -1 15 2 6UDG HIS B 8 ? UNP A0A077EJK0 ? ? 'expression tag' 0 16 3 6UDG MET C 1 ? UNP A0A077EJK0 ? ? 'expression tag' -7 17 3 6UDG ALA C 2 ? UNP A0A077EJK0 ? ? 'expression tag' -6 18 3 6UDG HIS C 3 ? UNP A0A077EJK0 ? ? 'expression tag' -5 19 3 6UDG HIS C 4 ? UNP A0A077EJK0 ? ? 'expression tag' -4 20 3 6UDG HIS C 5 ? UNP A0A077EJK0 ? ? 'expression tag' -3 21 3 6UDG HIS C 6 ? UNP A0A077EJK0 ? ? 'expression tag' -2 22 3 6UDG HIS C 7 ? UNP A0A077EJK0 ? ? 'expression tag' -1 23 3 6UDG HIS C 8 ? UNP A0A077EJK0 ? ? 'expression tag' 0 24 4 6UDG MET D 1 ? UNP A0A077EJK0 ? ? 'expression tag' -7 25 4 6UDG ALA D 2 ? UNP A0A077EJK0 ? ? 'expression tag' -6 26 4 6UDG HIS D 3 ? UNP A0A077EJK0 ? ? 'expression tag' -5 27 4 6UDG HIS D 4 ? UNP A0A077EJK0 ? ? 'expression tag' -4 28 4 6UDG HIS D 5 ? UNP A0A077EJK0 ? ? 'expression tag' -3 29 4 6UDG HIS D 6 ? UNP A0A077EJK0 ? ? 'expression tag' -2 30 4 6UDG HIS D 7 ? UNP A0A077EJK0 ? ? 'expression tag' -1 31 4 6UDG HIS D 8 ? UNP A0A077EJK0 ? ? 'expression tag' 0 32 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4640 ? 1 MORE -31 ? 1 'SSA (A^2)' 25570 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 48 ? LYS A 51 ? ALA A 40 LYS A 43 5 ? 4 HELX_P HELX_P2 AA2 ALA A 69 ? LEU A 82 ? ALA A 61 LEU A 74 1 ? 14 HELX_P HELX_P3 AA3 LEU A 94 ? GLU A 105 ? LEU A 86 GLU A 97 5 ? 12 HELX_P HELX_P4 AA4 HIS A 119 ? TYR A 124 ? HIS A 111 TYR A 116 1 ? 6 HELX_P HELX_P5 AA5 ASN A 164 ? LYS A 173 ? ASN A 156 LYS A 165 1 ? 10 HELX_P HELX_P6 AA6 ALA B 48 ? LYS B 51 ? ALA B 40 LYS B 43 5 ? 4 HELX_P HELX_P7 AA7 ALA B 69 ? LEU B 82 ? ALA B 61 LEU B 74 1 ? 14 HELX_P HELX_P8 AA8 LEU B 94 ? GLY B 99 ? LEU B 86 GLY B 91 1 ? 6 HELX_P HELX_P9 AA9 ARG B 100 ? GLU B 105 ? ARG B 92 GLU B 97 5 ? 6 HELX_P HELX_P10 AB1 HIS B 119 ? TYR B 124 ? HIS B 111 TYR B 116 1 ? 6 HELX_P HELX_P11 AB2 ASN B 164 ? LYS B 173 ? ASN B 156 LYS B 165 1 ? 10 HELX_P HELX_P12 AB3 ALA C 48 ? LYS C 51 ? ALA C 40 LYS C 43 5 ? 4 HELX_P HELX_P13 AB4 ALA C 69 ? LEU C 82 ? ALA C 61 LEU C 74 1 ? 14 HELX_P HELX_P14 AB5 ALA C 97 ? GLU C 105 ? ALA C 89 GLU C 97 5 ? 9 HELX_P HELX_P15 AB6 HIS C 119 ? TYR C 124 ? HIS C 111 TYR C 116 1 ? 6 HELX_P HELX_P16 AB7 ASN C 164 ? LYS C 173 ? ASN C 156 LYS C 165 1 ? 10 HELX_P HELX_P17 AB8 ALA D 48 ? LYS D 51 ? ALA D 40 LYS D 43 5 ? 4 HELX_P HELX_P18 AB9 ALA D 69 ? LEU D 82 ? ALA D 61 LEU D 74 1 ? 14 HELX_P HELX_P19 AC1 LEU D 94 ? GLU D 105 ? LEU D 86 GLU D 97 5 ? 12 HELX_P HELX_P20 AC2 HIS D 119 ? TYR D 124 ? HIS D 111 TYR D 116 1 ? 6 HELX_P HELX_P21 AC3 ASN D 164 ? LYS D 173 ? ASN D 156 LYS D 165 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 68 SG ? ? ? 1_555 A CYS 102 SG ? ? A CYS 60 A CYS 94 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf2 disulf ? ? B CYS 68 SG ? ? ? 1_555 B CYS 102 SG ? ? B CYS 60 B CYS 94 1_555 ? ? ? ? ? ? ? 2.037 ? ? disulf3 disulf ? ? C CYS 68 SG ? ? ? 1_555 D CYS 102 SG ? ? C CYS 60 D CYS 94 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf4 disulf ? ? C CYS 102 SG ? ? ? 1_555 D CYS 68 SG ? ? C CYS 94 D CYS 60 1_555 ? ? ? ? ? ? ? 2.030 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 5 ? AA4 ? 2 ? AA5 ? 5 ? AA6 ? 2 ? AA7 ? 2 ? AA8 ? 5 ? AA9 ? 2 ? AB1 ? 2 ? AB2 ? 2 ? AB3 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? parallel AA5 2 3 ? parallel AA5 3 4 ? anti-parallel AA5 4 5 ? anti-parallel AA6 1 2 ? anti-parallel AA7 1 2 ? anti-parallel AA8 1 2 ? parallel AA8 2 3 ? parallel AA8 3 4 ? anti-parallel AA8 4 5 ? anti-parallel AA9 1 2 ? anti-parallel AB1 1 2 ? anti-parallel AB2 1 2 ? anti-parallel AB3 1 2 ? parallel AB3 2 3 ? parallel AB3 3 4 ? anti-parallel AB3 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 12 ? LEU A 14 ? ILE A 4 LEU A 6 AA1 2 ASN A 17 ? ILE A 19 ? ASN A 9 ILE A 11 AA2 1 THR A 36 ? VAL A 38 ? THR A 28 VAL A 30 AA2 2 GLU A 44 ? THR A 46 ? GLU A 36 THR A 38 AA3 1 VAL A 110 ? SER A 114 ? VAL A 102 SER A 106 AA3 2 THR A 85 ? SER A 91 ? THR A 77 SER A 83 AA3 3 LYS A 54 ? ILE A 59 ? LYS A 46 ILE A 51 AA3 4 ALA A 140 ? ALA A 144 ? ALA A 132 ALA A 136 AA3 5 VAL A 150 ? GLN A 155 ? VAL A 142 GLN A 147 AA4 1 THR B 36 ? VAL B 38 ? THR B 28 VAL B 30 AA4 2 GLU B 44 ? THR B 46 ? GLU B 36 THR B 38 AA5 1 VAL B 110 ? SER B 114 ? VAL B 102 SER B 106 AA5 2 THR B 85 ? SER B 91 ? THR B 77 SER B 83 AA5 3 LYS B 54 ? ILE B 59 ? LYS B 46 ILE B 51 AA5 4 ALA B 140 ? ALA B 144 ? ALA B 132 ALA B 136 AA5 5 VAL B 150 ? GLN B 155 ? VAL B 142 GLN B 147 AA6 1 THR C 13 ? LEU C 14 ? THR C 5 LEU C 6 AA6 2 ASN C 17 ? ALA C 18 ? ASN C 9 ALA C 10 AA7 1 THR C 36 ? VAL C 38 ? THR C 28 VAL C 30 AA7 2 GLU C 44 ? THR C 46 ? GLU C 36 THR C 38 AA8 1 VAL C 110 ? SER C 114 ? VAL C 102 SER C 106 AA8 2 THR C 85 ? SER C 91 ? THR C 77 SER C 83 AA8 3 LYS C 54 ? ILE C 59 ? LYS C 46 ILE C 51 AA8 4 ALA C 140 ? ALA C 144 ? ALA C 132 ALA C 136 AA8 5 VAL C 150 ? GLN C 155 ? VAL C 142 GLN C 147 AA9 1 THR D 13 ? LEU D 14 ? THR D 5 LEU D 6 AA9 2 ASN D 17 ? ALA D 18 ? ASN D 9 ALA D 10 AB1 1 THR D 21 ? VAL D 22 ? THR D 13 VAL D 14 AB1 2 THR D 127 ? LEU D 128 ? THR D 119 LEU D 120 AB2 1 THR D 36 ? VAL D 38 ? THR D 28 VAL D 30 AB2 2 GLU D 44 ? THR D 46 ? GLU D 36 THR D 38 AB3 1 VAL D 110 ? SER D 114 ? VAL D 102 SER D 106 AB3 2 THR D 85 ? SER D 91 ? THR D 77 SER D 83 AB3 3 LYS D 54 ? PHE D 60 ? LYS D 46 PHE D 52 AB3 4 ALA D 140 ? ALA D 144 ? ALA D 132 ALA D 136 AB3 5 VAL D 150 ? GLN D 155 ? VAL D 142 GLN D 147 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 14 ? N LEU A 6 O ASN A 17 ? O ASN A 9 AA2 1 2 N LEU A 37 ? N LEU A 29 O LYS A 45 ? O LYS A 37 AA3 1 2 O LEU A 113 ? O LEU A 105 N ASN A 89 ? N ASN A 81 AA3 2 3 O VAL A 88 ? O VAL A 80 N VAL A 56 ? N VAL A 48 AA3 3 4 N LEU A 57 ? N LEU A 49 O VAL A 142 ? O VAL A 134 AA3 4 5 N VAL A 143 ? N VAL A 135 O TYR A 152 ? O TYR A 144 AA4 1 2 N LEU B 37 ? N LEU B 29 O LYS B 45 ? O LYS B 37 AA5 1 2 O LEU B 113 ? O LEU B 105 N ASN B 89 ? N ASN B 81 AA5 2 3 O VAL B 86 ? O VAL B 78 N LYS B 54 ? N LYS B 46 AA5 3 4 N LEU B 57 ? N LEU B 49 O VAL B 142 ? O VAL B 134 AA5 4 5 N VAL B 143 ? N VAL B 135 O TYR B 152 ? O TYR B 144 AA6 1 2 N LEU C 14 ? N LEU C 6 O ASN C 17 ? O ASN C 9 AA7 1 2 N LEU C 37 ? N LEU C 29 O LYS C 45 ? O LYS C 37 AA8 1 2 O LEU C 113 ? O LEU C 105 N ASN C 89 ? N ASN C 81 AA8 2 3 O VAL C 88 ? O VAL C 80 N VAL C 56 ? N VAL C 48 AA8 3 4 N LEU C 57 ? N LEU C 49 O VAL C 142 ? O VAL C 134 AA8 4 5 N VAL C 141 ? N VAL C 133 O GLU C 154 ? O GLU C 146 AA9 1 2 N LEU D 14 ? N LEU D 6 O ASN D 17 ? O ASN D 9 AB1 1 2 N VAL D 22 ? N VAL D 14 O THR D 127 ? O THR D 119 AB2 1 2 N LEU D 37 ? N LEU D 29 O LYS D 45 ? O LYS D 37 AB3 1 2 O LEU D 113 ? O LEU D 105 N ASN D 89 ? N ASN D 81 AB3 2 3 O VAL D 88 ? O VAL D 80 N VAL D 56 ? N VAL D 48 AB3 3 4 N LEU D 57 ? N LEU D 49 O VAL D 142 ? O VAL D 134 AB3 4 5 N VAL D 143 ? N VAL D 135 O VAL D 151 ? O VAL D 143 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 56 ? ? -102.26 40.85 2 1 CYS A 60 ? ? -73.69 -169.67 3 1 SER A 123 ? ? 70.60 164.51 4 1 ASP B 56 ? ? -96.61 45.06 5 1 VAL B 59 ? ? -157.77 77.72 6 1 ALA B 96 ? ? -98.33 31.10 7 1 ASP B 122 ? ? -136.45 -158.52 8 1 SER B 123 ? ? 71.52 164.45 9 1 ASP C 56 ? ? -105.37 45.01 10 1 SER C 123 ? ? 72.68 162.47 11 1 ASP D 56 ? ? -104.64 46.14 12 1 SER D 123 ? ? 70.10 163.43 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -15.2366 9.1545 -27.6511 0.3885 ? 0.0141 ? 0.0515 ? 0.4363 ? 0.0298 ? 0.7449 ? 4.5441 ? -1.5821 ? 0.1403 ? 3.0687 ? 0.9935 ? 4.0256 ? -0.1512 ? -0.1669 ? 0.4489 ? 0.0686 ? 0.1145 ? 0.2444 ? -0.1719 ? -0.2316 ? 0.0720 ? 2 'X-RAY DIFFRACTION' ? refined 9.8124 28.2507 -16.4513 0.4582 ? 0.0885 ? 0.0826 ? 0.4549 ? 0.0524 ? 0.6555 ? 2.7793 ? 0.4151 ? 0.3599 ? 5.9109 ? -0.8658 ? 5.6570 ? -0.1348 ? -0.3619 ? -0.6231 ? 0.3929 ? 0.2524 ? -0.0208 ? 0.1878 ? 0.0999 ? -0.1708 ? 3 'X-RAY DIFFRACTION' ? refined 5.9899 36.3675 -45.6495 0.6632 ? -0.1430 ? -0.1183 ? 0.5499 ? 0.1312 ? 0.7609 ? 3.4765 ? 0.4837 ? -0.5206 ? 3.4750 ? -1.8376 ? 6.2630 ? -0.2762 ? 0.5261 ? 0.3000 ? -0.8453 ? 0.4518 ? 0.7997 ? 0.0387 ? -0.3571 ? -0.1748 ? 4 'X-RAY DIFFRACTION' ? refined 10.0676 0.4480 -42.8723 0.5277 ? -0.0780 ? 0.1526 ? 0.5174 ? -0.1632 ? 0.9573 ? 5.3304 ? -1.8524 ? -0.7933 ? 1.9227 ? 0.6430 ? 1.4332 ? 0.1026 ? 0.3425 ? -0.0864 ? -0.3808 ? 0.0801 ? -0.6969 ? 0.0063 ? 0.2465 ? -0.2080 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 3 ? ? A 165 ? ;(chain 'A' and resid 3 through 165) ; 2 'X-RAY DIFFRACTION' 2 ? ? B 5 ? ? B 165 ? ;(chain 'B' and resid 5 through 165) ; 3 'X-RAY DIFFRACTION' 3 ? ? C 4 ? ? C 165 ? ;(chain 'C' and resid 4 through 165) ; 4 'X-RAY DIFFRACTION' 4 ? ? D 4 ? ? D 165 ? ;(chain 'D' and resid 4 through 165) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -7 ? A MET 1 2 1 Y 1 A ALA -6 ? A ALA 2 3 1 Y 1 A HIS -5 ? A HIS 3 4 1 Y 1 A HIS -4 ? A HIS 4 5 1 Y 1 A HIS -3 ? A HIS 5 6 1 Y 1 A HIS -2 ? A HIS 6 7 1 Y 1 A HIS -1 ? A HIS 7 8 1 Y 1 A HIS 0 ? A HIS 8 9 1 Y 1 A MET 1 ? A MET 9 10 1 Y 1 A ALA 2 ? A ALA 10 11 1 Y 1 B MET -7 ? B MET 1 12 1 Y 1 B ALA -6 ? B ALA 2 13 1 Y 1 B HIS -5 ? B HIS 3 14 1 Y 1 B HIS -4 ? B HIS 4 15 1 Y 1 B HIS -3 ? B HIS 5 16 1 Y 1 B HIS -2 ? B HIS 6 17 1 Y 1 B HIS -1 ? B HIS 7 18 1 Y 1 B HIS 0 ? B HIS 8 19 1 Y 1 B MET 1 ? B MET 9 20 1 Y 1 B ALA 2 ? B ALA 10 21 1 Y 1 B ASN 3 ? B ASN 11 22 1 Y 1 B ILE 4 ? B ILE 12 23 1 Y 1 C MET -7 ? C MET 1 24 1 Y 1 C ALA -6 ? C ALA 2 25 1 Y 1 C HIS -5 ? C HIS 3 26 1 Y 1 C HIS -4 ? C HIS 4 27 1 Y 1 C HIS -3 ? C HIS 5 28 1 Y 1 C HIS -2 ? C HIS 6 29 1 Y 1 C HIS -1 ? C HIS 7 30 1 Y 1 C HIS 0 ? C HIS 8 31 1 Y 1 C MET 1 ? C MET 9 32 1 Y 1 C ALA 2 ? C ALA 10 33 1 Y 1 C ASN 3 ? C ASN 11 34 1 Y 1 D MET -7 ? D MET 1 35 1 Y 1 D ALA -6 ? D ALA 2 36 1 Y 1 D HIS -5 ? D HIS 3 37 1 Y 1 D HIS -4 ? D HIS 4 38 1 Y 1 D HIS -3 ? D HIS 5 39 1 Y 1 D HIS -2 ? D HIS 6 40 1 Y 1 D HIS -1 ? D HIS 7 41 1 Y 1 D HIS 0 ? D HIS 8 42 1 Y 1 D MET 1 ? D MET 9 43 1 Y 1 D ALA 2 ? D ALA 10 44 1 Y 1 D ASN 3 ? D ASN 11 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TYR N N N N 321 TYR CA C N S 322 TYR C C N N 323 TYR O O N N 324 TYR CB C N N 325 TYR CG C Y N 326 TYR CD1 C Y N 327 TYR CD2 C Y N 328 TYR CE1 C Y N 329 TYR CE2 C Y N 330 TYR CZ C Y N 331 TYR OH O N N 332 TYR OXT O N N 333 TYR H H N N 334 TYR H2 H N N 335 TYR HA H N N 336 TYR HB2 H N N 337 TYR HB3 H N N 338 TYR HD1 H N N 339 TYR HD2 H N N 340 TYR HE1 H N N 341 TYR HE2 H N N 342 TYR HH H N N 343 TYR HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _pdbx_initial_refinement_model.accession_code 4JE1 _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.details 4je1A # _atom_sites.entry_id 6UDG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018660 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009276 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008795 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_