data_6UEJ # _entry.id 6UEJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6UEJ pdb_00006uej 10.2210/pdb6uej/pdb WWPDB D_1000244481 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6UEJ _pdbx_database_status.recvd_initial_deposition_date 2019-09-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Meagher, J.L.' 1 0000-0003-1250-4575 'Smith, J.L.' 2 0000-0002-0664-9228 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 116 _citation.language ? _citation.page_first 24303 _citation.page_last 24309 _citation.title ;Structure of the zinc-finger antiviral protein in complex with RNA reveals a mechanism for selective targeting of CG-rich viral sequences. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1913232116 _citation.pdbx_database_id_PubMed 31719195 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Meagher, J.L.' 1 ? primary 'Takata, M.' 2 ? primary 'Goncalves-Carneiro, D.' 3 ? primary 'Keane, S.C.' 4 ? primary 'Rebendenne, A.' 5 ? primary 'Ong, H.' 6 ? primary 'Orr, V.K.' 7 ? primary 'MacDonald, M.R.' 8 ? primary 'Stuckey, J.A.' 9 ? primary 'Bieniasz, P.D.' 10 ? primary 'Smith, J.L.' 11 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6UEJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 123.090 _cell.length_a_esd ? _cell.length_b 123.090 _cell.length_b_esd ? _cell.length_c 40.670 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6UEJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger CCCH-type antiviral protein 1' 25991.076 1 ? ? ? ? 2 polymer syn ;RNA (5'-R(P*UP*CP*G)-3') ; 911.596 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 4 ? ? ? ? 4 non-polymer syn SPERMINE 202.340 1 ? ? ? ? 5 water nat water 18.015 93 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;ADP-ribosyltransferase diphtheria toxin-like 13,ARTD13,Inactive Poly [ADP-ribose] polymerase 13,PARP13,Zinc finger CCCH domain-containing protein 2,Zinc finger antiviral protein,ZAP ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;SNAADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGITRSVVATTRARVCRRKYC QRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKVLKNHELSGLNKEELAVLLLQSDPFFMPEICKSYKGEGR QQICNQQPPCSRLHICDHFTRGNCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQKN ; ;SNAADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGITRSVVATTRARVCRRKYC QRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKVLKNHELSGLNKEELAVLLLQSDPFFMPEICKSYKGEGR QQICNQQPPCSRLHICDHFTRGNCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQKN ; A ? 2 polyribonucleotide no no UCG UCG B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 ALA n 1 5 ASP n 1 6 PRO n 1 7 GLU n 1 8 VAL n 1 9 CYS n 1 10 CYS n 1 11 PHE n 1 12 ILE n 1 13 THR n 1 14 LYS n 1 15 ILE n 1 16 LEU n 1 17 CYS n 1 18 ALA n 1 19 HIS n 1 20 GLY n 1 21 GLY n 1 22 ARG n 1 23 MET n 1 24 ALA n 1 25 LEU n 1 26 ASP n 1 27 ALA n 1 28 LEU n 1 29 LEU n 1 30 GLN n 1 31 GLU n 1 32 ILE n 1 33 ALA n 1 34 LEU n 1 35 SER n 1 36 GLU n 1 37 PRO n 1 38 GLN n 1 39 LEU n 1 40 CYS n 1 41 GLU n 1 42 VAL n 1 43 LEU n 1 44 GLN n 1 45 VAL n 1 46 ALA n 1 47 GLY n 1 48 PRO n 1 49 ASP n 1 50 ARG n 1 51 PHE n 1 52 VAL n 1 53 VAL n 1 54 LEU n 1 55 GLU n 1 56 THR n 1 57 GLY n 1 58 GLY n 1 59 GLU n 1 60 ALA n 1 61 GLY n 1 62 ILE n 1 63 THR n 1 64 ARG n 1 65 SER n 1 66 VAL n 1 67 VAL n 1 68 ALA n 1 69 THR n 1 70 THR n 1 71 ARG n 1 72 ALA n 1 73 ARG n 1 74 VAL n 1 75 CYS n 1 76 ARG n 1 77 ARG n 1 78 LYS n 1 79 TYR n 1 80 CYS n 1 81 GLN n 1 82 ARG n 1 83 PRO n 1 84 CYS n 1 85 ASP n 1 86 ASN n 1 87 LEU n 1 88 HIS n 1 89 LEU n 1 90 CYS n 1 91 LYS n 1 92 LEU n 1 93 ASN n 1 94 LEU n 1 95 LEU n 1 96 GLY n 1 97 ARG n 1 98 CYS n 1 99 ASN n 1 100 TYR n 1 101 SER n 1 102 GLN n 1 103 SER n 1 104 GLU n 1 105 ARG n 1 106 ASN n 1 107 LEU n 1 108 CYS n 1 109 LYS n 1 110 TYR n 1 111 SER n 1 112 HIS n 1 113 GLU n 1 114 VAL n 1 115 LEU n 1 116 SER n 1 117 GLU n 1 118 GLU n 1 119 ASN n 1 120 PHE n 1 121 LYS n 1 122 VAL n 1 123 LEU n 1 124 LYS n 1 125 ASN n 1 126 HIS n 1 127 GLU n 1 128 LEU n 1 129 SER n 1 130 GLY n 1 131 LEU n 1 132 ASN n 1 133 LYS n 1 134 GLU n 1 135 GLU n 1 136 LEU n 1 137 ALA n 1 138 VAL n 1 139 LEU n 1 140 LEU n 1 141 LEU n 1 142 GLN n 1 143 SER n 1 144 ASP n 1 145 PRO n 1 146 PHE n 1 147 PHE n 1 148 MET n 1 149 PRO n 1 150 GLU n 1 151 ILE n 1 152 CYS n 1 153 LYS n 1 154 SER n 1 155 TYR n 1 156 LYS n 1 157 GLY n 1 158 GLU n 1 159 GLY n 1 160 ARG n 1 161 GLN n 1 162 GLN n 1 163 ILE n 1 164 CYS n 1 165 ASN n 1 166 GLN n 1 167 GLN n 1 168 PRO n 1 169 PRO n 1 170 CYS n 1 171 SER n 1 172 ARG n 1 173 LEU n 1 174 HIS n 1 175 ILE n 1 176 CYS n 1 177 ASP n 1 178 HIS n 1 179 PHE n 1 180 THR n 1 181 ARG n 1 182 GLY n 1 183 ASN n 1 184 CYS n 1 185 ARG n 1 186 PHE n 1 187 PRO n 1 188 ASN n 1 189 CYS n 1 190 LEU n 1 191 ARG n 1 192 SER n 1 193 HIS n 1 194 ASN n 1 195 LEU n 1 196 MET n 1 197 ASP n 1 198 ARG n 1 199 LYS n 1 200 VAL n 1 201 LEU n 1 202 ALA n 1 203 ILE n 1 204 MET n 1 205 ARG n 1 206 GLU n 1 207 HIS n 1 208 GLY n 1 209 LEU n 1 210 ASN n 1 211 PRO n 1 212 ASP n 1 213 VAL n 1 214 VAL n 1 215 GLN n 1 216 ASN n 1 217 ILE n 1 218 GLN n 1 219 ASP n 1 220 ILE n 1 221 CYS n 1 222 ASN n 1 223 SER n 1 224 LYS n 1 225 HIS n 1 226 MET n 1 227 GLN n 1 228 LYS n 1 229 ASN n 2 1 U n 2 2 C n 2 3 G n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 229 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ZC3HAV1, ZC3HDC2, PRO1677' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 3 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP ZCCHV_HUMAN Q7Z2W4 ? 1 ;ADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGITRSVVATTRARVCRRKYCQRP CDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKVLKNHELSGLNKEELAVLLLQSDPFFMPEICKSYKGEGRQQI CNQQPPCSRLHICDHFTRGNCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQKN ; 2 2 PDB 6UEJ 6UEJ ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6UEJ A 4 ? 229 ? Q7Z2W4 2 ? 227 ? 2 227 2 2 6UEJ B 1 ? 3 ? 6UEJ 1 ? 3 ? 1 3 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6UEJ SER A 1 ? UNP Q7Z2W4 ? ? 'expression tag' -1 1 1 6UEJ ASN A 2 ? UNP Q7Z2W4 ? ? 'expression tag' 0 2 1 6UEJ ALA A 3 ? UNP Q7Z2W4 ? ? 'expression tag' 1 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C 'RNA linking' y "CYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O8 P' 323.197 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 G 'RNA linking' y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SPM non-polymer . SPERMINE ? 'C10 H26 N4' 202.340 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6UEJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.03 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.4 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '7% Peg 8000, 30mM magnesium chloride, 10mM spermine, 50mM HEPES pH 7.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-02-07 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9762 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9762 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 64.210 _reflns.entry_id 6UEJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.200 _reflns.d_resolution_low 40.668 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18081 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.564 _reflns.pdbx_Rmerge_I_obs 0.079 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.690 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.087 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.081 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 371826 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.200 2.340 ? 2.080 ? 59456 2898 ? 2858 98.600 ? ? ? ? 1.375 ? ? ? ? ? ? ? ? 20.803 ? ? ? ? 1.409 ? ? 1 1 0.886 ? ? 2.340 2.500 ? 3.690 ? 58295 2716 ? 2716 100.000 ? ? ? ? 0.846 ? ? ? ? ? ? ? ? 21.464 ? ? ? ? 0.867 ? ? 2 1 0.956 ? ? 2.500 2.700 ? 7.300 ? 53817 2553 ? 2553 100.000 ? ? ? ? 0.424 ? ? ? ? ? ? ? ? 21.080 ? ? ? ? 0.434 ? ? 3 1 0.987 ? ? 2.700 2.950 ? 12.770 ? 47780 2335 ? 2335 100.000 ? ? ? ? 0.226 ? ? ? ? ? ? ? ? 20.463 ? ? ? ? 0.231 ? ? 4 1 0.996 ? ? 2.950 3.300 ? 22.580 ? 41373 2106 ? 2106 100.000 ? ? ? ? 0.119 ? ? ? ? ? ? ? ? 19.645 ? ? ? ? 0.122 ? ? 5 1 0.998 ? ? 3.300 3.810 ? 38.610 ? 40729 1895 ? 1895 100.000 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 21.493 ? ? ? ? 0.078 ? ? 6 1 0.999 ? ? 3.810 4.650 ? 49.440 ? 33323 1610 ? 1610 100.000 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 20.698 ? ? ? ? 0.059 ? ? 7 1 0.999 ? ? 4.650 6.530 ? 52.310 ? 22946 1263 ? 1263 100.000 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 18.168 ? ? ? ? 0.057 ? ? 8 1 0.999 ? ? 6.530 40.668 ? 58.110 ? 14106 749 ? 744 99.300 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 18.960 ? ? ? ? 0.054 ? ? 9 1 0.999 ? ? # _refine.aniso_B[1][1] 13.2494 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 13.2494 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -26.4987 _refine.B_iso_max 167.220 _refine.B_iso_mean 75.6700 _refine.B_iso_min 43.740 _refine.correlation_coeff_Fo_to_Fc 0.9340 _refine.correlation_coeff_Fo_to_Fc_free 0.9190 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6UEJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2100 _refine.ls_d_res_low 38.0000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18076 _refine.ls_number_reflns_R_free 957 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9000 _refine.ls_percent_reflns_R_free 5.2900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2130 _refine.ls_R_factor_R_free 0.2550 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2110 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3U9G _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.1770 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.1800 _refine.pdbx_overall_SU_R_Blow_DPI 0.1960 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.1900 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 6UEJ _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.320 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2100 _refine_hist.d_res_low 38.0000 _refine_hist.number_atoms_solvent 93 _refine_hist.number_atoms_total 1816 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 215 _refine_hist.pdbx_B_iso_mean_ligand 87.67 _refine_hist.pdbx_B_iso_mean_solvent 73.92 _refine_hist.pdbx_number_atoms_protein 1646 _refine_hist.pdbx_number_atoms_nucleic_acid 63 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 619 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_trig_c_planes ? ? 'X-RAY DIFFRACTION' ? ? ? 288 ? t_gen_planes 5.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1748 ? t_it 20.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1 ? t_nbd 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 227 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? 16 ? t_utility_distance 1.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 24 ? t_utility_angle 1.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1972 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.010 ? 1748 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 1.050 ? 2361 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 2.610 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 18.500 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.2100 _refine_ls_shell.d_res_low 2.2200 _refine_ls_shell.number_reflns_all 385 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 19 _refine_ls_shell.number_reflns_R_work 366 _refine_ls_shell.percent_reflns_obs 96.3000 _refine_ls_shell.percent_reflns_R_free 4.9400 _refine_ls_shell.R_factor_all 0.2448 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4125 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2354 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 47 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6UEJ _struct.title 'Crystal structure of human zinc finger antiviral protein bound to RNA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6UEJ _struct_keywords.text 'Zinc Finger Antiviral protein, ZAP, RNA binding domain, ANTIVIRAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIVIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? H N N 5 ? I N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 5 ? HIS A 19 ? ASP A 3 HIS A 17 1 ? 15 HELX_P HELX_P2 AA2 LEU A 25 ? ALA A 33 ? LEU A 23 ALA A 31 1 ? 9 HELX_P HELX_P3 AA3 SER A 35 ? GLY A 47 ? SER A 33 GLY A 45 1 ? 13 HELX_P HELX_P4 AA4 CYS A 90 ? LEU A 95 ? CYS A 88 LEU A 93 1 ? 6 HELX_P HELX_P5 AA5 SER A 116 ? HIS A 126 ? SER A 114 HIS A 124 1 ? 11 HELX_P HELX_P6 AA6 ASN A 132 ? ASP A 144 ? ASN A 130 ASP A 142 1 ? 13 HELX_P HELX_P7 AA7 PRO A 145 ? MET A 148 ? PRO A 143 MET A 146 5 ? 4 HELX_P HELX_P8 AA8 CYS A 176 ? ARG A 181 ? CYS A 174 ARG A 179 1 ? 6 HELX_P HELX_P9 AA9 ASP A 197 ? HIS A 207 ? ASP A 195 HIS A 205 1 ? 11 HELX_P HELX_P10 AB1 ASN A 210 ? GLN A 227 ? ASN A 208 GLN A 225 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 75 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 73 A ZN 501 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc2 metalc ? ? A CYS 80 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 78 A ZN 501 1_555 ? ? ? ? ? ? ? 2.295 ? ? metalc3 metalc ? ? A CYS 84 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 82 A ZN 501 1_555 ? ? ? ? ? ? ? 2.296 ? ? metalc4 metalc ? ? A HIS 88 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 86 A ZN 501 1_555 ? ? ? ? ? ? ? 2.166 ? ? metalc5 metalc ? ? A CYS 90 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 88 A ZN 502 1_555 ? ? ? ? ? ? ? 2.322 ? ? metalc6 metalc ? ? A CYS 98 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 96 A ZN 502 1_555 ? ? ? ? ? ? ? 2.256 ? ? metalc7 metalc ? ? A CYS 108 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 106 A ZN 502 1_555 ? ? ? ? ? ? ? 2.268 ? ? metalc8 metalc ? ? A HIS 112 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 110 A ZN 502 1_555 ? ? ? ? ? ? ? 2.153 ? ? metalc9 metalc ? ? A CYS 152 SG ? ? ? 1_555 F ZN . ZN ? ? A CYS 150 A ZN 504 1_555 ? ? ? ? ? ? ? 2.272 ? ? metalc10 metalc ? ? A CYS 164 SG ? ? ? 1_555 F ZN . ZN ? ? A CYS 162 A ZN 504 1_555 ? ? ? ? ? ? ? 2.557 ? ? metalc11 metalc ? ? A CYS 170 SG ? ? ? 1_555 F ZN . ZN ? ? A CYS 168 A ZN 504 1_555 ? ? ? ? ? ? ? 2.378 ? ? metalc12 metalc ? ? A HIS 174 NE2 ? ? ? 1_555 F ZN . ZN ? ? A HIS 172 A ZN 504 1_555 ? ? ? ? ? ? ? 2.067 ? ? metalc13 metalc ? ? A CYS 176 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 174 A ZN 503 1_555 ? ? ? ? ? ? ? 2.291 ? ? metalc14 metalc ? ? A CYS 184 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 182 A ZN 503 1_555 ? ? ? ? ? ? ? 2.180 ? ? metalc15 metalc ? ? A CYS 189 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 187 A ZN 503 1_555 ? ? ? ? ? ? ? 2.469 ? ? metalc16 metalc ? ? A HIS 193 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 191 A ZN 503 1_555 ? ? ? ? ? ? ? 2.105 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 82 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 80 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 83 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 81 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.73 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 22 ? ALA A 24 ? ARG A 20 ALA A 22 AA1 2 SER A 65 ? ALA A 68 ? SER A 63 ALA A 66 AA1 3 PHE A 51 ? LEU A 54 ? PHE A 49 LEU A 52 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N MET A 23 ? N MET A 21 O VAL A 66 ? O VAL A 64 AA1 2 3 O VAL A 67 ? O VAL A 65 N VAL A 52 ? N VAL A 50 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 501 ? 4 'binding site for residue ZN A 501' AC2 Software A ZN 502 ? 4 'binding site for residue ZN A 502' AC3 Software A ZN 503 ? 4 'binding site for residue ZN A 503' AC4 Software A ZN 504 ? 4 'binding site for residue ZN A 504' AC5 Software B SPM 101 ? 3 'binding site for residue SPM B 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 75 ? CYS A 73 . ? 1_555 ? 2 AC1 4 CYS A 80 ? CYS A 78 . ? 1_555 ? 3 AC1 4 CYS A 84 ? CYS A 82 . ? 1_555 ? 4 AC1 4 HIS A 88 ? HIS A 86 . ? 1_555 ? 5 AC2 4 CYS A 90 ? CYS A 88 . ? 1_555 ? 6 AC2 4 CYS A 98 ? CYS A 96 . ? 1_555 ? 7 AC2 4 CYS A 108 ? CYS A 106 . ? 1_555 ? 8 AC2 4 HIS A 112 ? HIS A 110 . ? 1_555 ? 9 AC3 4 CYS A 176 ? CYS A 174 . ? 1_555 ? 10 AC3 4 CYS A 184 ? CYS A 182 . ? 1_555 ? 11 AC3 4 CYS A 189 ? CYS A 187 . ? 1_555 ? 12 AC3 4 HIS A 193 ? HIS A 191 . ? 1_555 ? 13 AC4 4 CYS A 152 ? CYS A 150 . ? 1_555 ? 14 AC4 4 CYS A 164 ? CYS A 162 . ? 1_555 ? 15 AC4 4 CYS A 170 ? CYS A 168 . ? 1_555 ? 16 AC4 4 HIS A 174 ? HIS A 172 . ? 1_555 ? 17 AC5 3 U B 1 ? U B 1 . ? 1_555 ? 18 AC5 3 C B 2 ? C B 2 . ? 1_555 ? 19 AC5 3 G B 3 ? G B 3 . ? 1_555 ? # _atom_sites.entry_id 6UEJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008124 _atom_sites.fract_transf_matrix[1][2] 0.004690 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009381 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024588 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -1 ? ? ? A . n A 1 2 ASN 2 0 ? ? ? A . n A 1 3 ALA 3 1 ? ? ? A . n A 1 4 ALA 4 2 2 ALA ALA A . n A 1 5 ASP 5 3 3 ASP ASP A . n A 1 6 PRO 6 4 4 PRO PRO A . n A 1 7 GLU 7 5 5 GLU GLU A . n A 1 8 VAL 8 6 6 VAL VAL A . n A 1 9 CYS 9 7 7 CYS CYS A . n A 1 10 CYS 10 8 8 CYS CYS A . n A 1 11 PHE 11 9 9 PHE PHE A . n A 1 12 ILE 12 10 10 ILE ILE A . n A 1 13 THR 13 11 11 THR THR A . n A 1 14 LYS 14 12 12 LYS LYS A . n A 1 15 ILE 15 13 13 ILE ILE A . n A 1 16 LEU 16 14 14 LEU LEU A . n A 1 17 CYS 17 15 15 CYS CYS A . n A 1 18 ALA 18 16 16 ALA ALA A . n A 1 19 HIS 19 17 17 HIS HIS A . n A 1 20 GLY 20 18 18 GLY GLY A . n A 1 21 GLY 21 19 19 GLY GLY A . n A 1 22 ARG 22 20 20 ARG ARG A . n A 1 23 MET 23 21 21 MET MET A . n A 1 24 ALA 24 22 22 ALA ALA A . n A 1 25 LEU 25 23 23 LEU LEU A . n A 1 26 ASP 26 24 24 ASP ASP A . n A 1 27 ALA 27 25 25 ALA ALA A . n A 1 28 LEU 28 26 26 LEU LEU A . n A 1 29 LEU 29 27 27 LEU LEU A . n A 1 30 GLN 30 28 28 GLN GLN A . n A 1 31 GLU 31 29 29 GLU GLU A . n A 1 32 ILE 32 30 30 ILE ILE A . n A 1 33 ALA 33 31 31 ALA ALA A . n A 1 34 LEU 34 32 32 LEU LEU A . n A 1 35 SER 35 33 33 SER SER A . n A 1 36 GLU 36 34 34 GLU GLU A . n A 1 37 PRO 37 35 35 PRO PRO A . n A 1 38 GLN 38 36 36 GLN GLN A . n A 1 39 LEU 39 37 37 LEU LEU A . n A 1 40 CYS 40 38 38 CYS CYS A . n A 1 41 GLU 41 39 39 GLU GLU A . n A 1 42 VAL 42 40 40 VAL VAL A . n A 1 43 LEU 43 41 41 LEU LEU A . n A 1 44 GLN 44 42 42 GLN GLN A . n A 1 45 VAL 45 43 43 VAL VAL A . n A 1 46 ALA 46 44 44 ALA ALA A . n A 1 47 GLY 47 45 45 GLY GLY A . n A 1 48 PRO 48 46 46 PRO PRO A . n A 1 49 ASP 49 47 47 ASP ASP A . n A 1 50 ARG 50 48 48 ARG ARG A . n A 1 51 PHE 51 49 49 PHE PHE A . n A 1 52 VAL 52 50 50 VAL VAL A . n A 1 53 VAL 53 51 51 VAL VAL A . n A 1 54 LEU 54 52 52 LEU LEU A . n A 1 55 GLU 55 53 53 GLU GLU A . n A 1 56 THR 56 54 ? ? ? A . n A 1 57 GLY 57 55 ? ? ? A . n A 1 58 GLY 58 56 ? ? ? A . n A 1 59 GLU 59 57 ? ? ? A . n A 1 60 ALA 60 58 ? ? ? A . n A 1 61 GLY 61 59 ? ? ? A . n A 1 62 ILE 62 60 60 ILE ILE A . n A 1 63 THR 63 61 61 THR THR A . n A 1 64 ARG 64 62 62 ARG ARG A . n A 1 65 SER 65 63 63 SER SER A . n A 1 66 VAL 66 64 64 VAL VAL A . n A 1 67 VAL 67 65 65 VAL VAL A . n A 1 68 ALA 68 66 66 ALA ALA A . n A 1 69 THR 69 67 67 THR THR A . n A 1 70 THR 70 68 68 THR THR A . n A 1 71 ARG 71 69 69 ARG ARG A . n A 1 72 ALA 72 70 70 ALA ALA A . n A 1 73 ARG 73 71 71 ARG ARG A . n A 1 74 VAL 74 72 72 VAL VAL A . n A 1 75 CYS 75 73 73 CYS CYS A . n A 1 76 ARG 76 74 74 ARG ARG A . n A 1 77 ARG 77 75 75 ARG ARG A . n A 1 78 LYS 78 76 76 LYS LYS A . n A 1 79 TYR 79 77 77 TYR TYR A . n A 1 80 CYS 80 78 78 CYS CYS A . n A 1 81 GLN 81 79 79 GLN GLN A . n A 1 82 ARG 82 80 80 ARG ARG A . n A 1 83 PRO 83 81 81 PRO PRO A . n A 1 84 CYS 84 82 82 CYS CYS A . n A 1 85 ASP 85 83 83 ASP ASP A . n A 1 86 ASN 86 84 84 ASN ASN A . n A 1 87 LEU 87 85 85 LEU LEU A . n A 1 88 HIS 88 86 86 HIS HIS A . n A 1 89 LEU 89 87 87 LEU LEU A . n A 1 90 CYS 90 88 88 CYS CYS A . n A 1 91 LYS 91 89 89 LYS LYS A . n A 1 92 LEU 92 90 90 LEU LEU A . n A 1 93 ASN 93 91 91 ASN ASN A . n A 1 94 LEU 94 92 92 LEU LEU A . n A 1 95 LEU 95 93 93 LEU LEU A . n A 1 96 GLY 96 94 94 GLY GLY A . n A 1 97 ARG 97 95 95 ARG ARG A . n A 1 98 CYS 98 96 96 CYS CYS A . n A 1 99 ASN 99 97 97 ASN ASN A . n A 1 100 TYR 100 98 98 TYR TYR A . n A 1 101 SER 101 99 99 SER SER A . n A 1 102 GLN 102 100 ? ? ? A . n A 1 103 SER 103 101 ? ? ? A . n A 1 104 GLU 104 102 ? ? ? A . n A 1 105 ARG 105 103 ? ? ? A . n A 1 106 ASN 106 104 104 ASN ASN A . n A 1 107 LEU 107 105 105 LEU LEU A . n A 1 108 CYS 108 106 106 CYS CYS A . n A 1 109 LYS 109 107 107 LYS LYS A . n A 1 110 TYR 110 108 108 TYR TYR A . n A 1 111 SER 111 109 109 SER SER A . n A 1 112 HIS 112 110 110 HIS HIS A . n A 1 113 GLU 113 111 111 GLU GLU A . n A 1 114 VAL 114 112 112 VAL VAL A . n A 1 115 LEU 115 113 113 LEU LEU A . n A 1 116 SER 116 114 114 SER SER A . n A 1 117 GLU 117 115 115 GLU GLU A . n A 1 118 GLU 118 116 116 GLU GLU A . n A 1 119 ASN 119 117 117 ASN ASN A . n A 1 120 PHE 120 118 118 PHE PHE A . n A 1 121 LYS 121 119 119 LYS LYS A . n A 1 122 VAL 122 120 120 VAL VAL A . n A 1 123 LEU 123 121 121 LEU LEU A . n A 1 124 LYS 124 122 122 LYS LYS A . n A 1 125 ASN 125 123 123 ASN ASN A . n A 1 126 HIS 126 124 124 HIS HIS A . n A 1 127 GLU 127 125 125 GLU GLU A . n A 1 128 LEU 128 126 126 LEU LEU A . n A 1 129 SER 129 127 127 SER SER A . n A 1 130 GLY 130 128 128 GLY GLY A . n A 1 131 LEU 131 129 129 LEU LEU A . n A 1 132 ASN 132 130 130 ASN ASN A . n A 1 133 LYS 133 131 131 LYS LYS A . n A 1 134 GLU 134 132 132 GLU GLU A . n A 1 135 GLU 135 133 133 GLU GLU A . n A 1 136 LEU 136 134 134 LEU LEU A . n A 1 137 ALA 137 135 135 ALA ALA A . n A 1 138 VAL 138 136 136 VAL VAL A . n A 1 139 LEU 139 137 137 LEU LEU A . n A 1 140 LEU 140 138 138 LEU LEU A . n A 1 141 LEU 141 139 139 LEU LEU A . n A 1 142 GLN 142 140 140 GLN GLN A . n A 1 143 SER 143 141 141 SER SER A . n A 1 144 ASP 144 142 142 ASP ASP A . n A 1 145 PRO 145 143 143 PRO PRO A . n A 1 146 PHE 146 144 144 PHE PHE A . n A 1 147 PHE 147 145 145 PHE PHE A . n A 1 148 MET 148 146 146 MET MET A . n A 1 149 PRO 149 147 147 PRO PRO A . n A 1 150 GLU 150 148 148 GLU GLU A . n A 1 151 ILE 151 149 149 ILE ILE A . n A 1 152 CYS 152 150 150 CYS CYS A . n A 1 153 LYS 153 151 151 LYS LYS A . n A 1 154 SER 154 152 152 SER SER A . n A 1 155 TYR 155 153 153 TYR TYR A . n A 1 156 LYS 156 154 154 LYS LYS A . n A 1 157 GLY 157 155 155 GLY GLY A . n A 1 158 GLU 158 156 156 GLU GLU A . n A 1 159 GLY 159 157 157 GLY GLY A . n A 1 160 ARG 160 158 158 ARG ARG A . n A 1 161 GLN 161 159 159 GLN GLN A . n A 1 162 GLN 162 160 160 GLN GLN A . n A 1 163 ILE 163 161 161 ILE ILE A . n A 1 164 CYS 164 162 162 CYS CYS A . n A 1 165 ASN 165 163 163 ASN ASN A . n A 1 166 GLN 166 164 164 GLN GLN A . n A 1 167 GLN 167 165 ? ? ? A . n A 1 168 PRO 168 166 ? ? ? A . n A 1 169 PRO 169 167 ? ? ? A . n A 1 170 CYS 170 168 168 CYS CYS A . n A 1 171 SER 171 169 169 SER SER A . n A 1 172 ARG 172 170 170 ARG ARG A . n A 1 173 LEU 173 171 171 LEU LEU A . n A 1 174 HIS 174 172 172 HIS HIS A . n A 1 175 ILE 175 173 173 ILE ILE A . n A 1 176 CYS 176 174 174 CYS CYS A . n A 1 177 ASP 177 175 175 ASP ASP A . n A 1 178 HIS 178 176 176 HIS HIS A . n A 1 179 PHE 179 177 177 PHE PHE A . n A 1 180 THR 180 178 178 THR THR A . n A 1 181 ARG 181 179 179 ARG ARG A . n A 1 182 GLY 182 180 180 GLY GLY A . n A 1 183 ASN 183 181 181 ASN ASN A . n A 1 184 CYS 184 182 182 CYS CYS A . n A 1 185 ARG 185 183 183 ARG ARG A . n A 1 186 PHE 186 184 184 PHE PHE A . n A 1 187 PRO 187 185 185 PRO PRO A . n A 1 188 ASN 188 186 186 ASN ASN A . n A 1 189 CYS 189 187 187 CYS CYS A . n A 1 190 LEU 190 188 188 LEU LEU A . n A 1 191 ARG 191 189 189 ARG ARG A . n A 1 192 SER 192 190 190 SER SER A . n A 1 193 HIS 193 191 191 HIS HIS A . n A 1 194 ASN 194 192 192 ASN ASN A . n A 1 195 LEU 195 193 193 LEU LEU A . n A 1 196 MET 196 194 194 MET MET A . n A 1 197 ASP 197 195 195 ASP ASP A . n A 1 198 ARG 198 196 196 ARG ARG A . n A 1 199 LYS 199 197 197 LYS LYS A . n A 1 200 VAL 200 198 198 VAL VAL A . n A 1 201 LEU 201 199 199 LEU LEU A . n A 1 202 ALA 202 200 200 ALA ALA A . n A 1 203 ILE 203 201 201 ILE ILE A . n A 1 204 MET 204 202 202 MET MET A . n A 1 205 ARG 205 203 203 ARG ARG A . n A 1 206 GLU 206 204 204 GLU GLU A . n A 1 207 HIS 207 205 205 HIS HIS A . n A 1 208 GLY 208 206 206 GLY GLY A . n A 1 209 LEU 209 207 207 LEU LEU A . n A 1 210 ASN 210 208 208 ASN ASN A . n A 1 211 PRO 211 209 209 PRO PRO A . n A 1 212 ASP 212 210 210 ASP ASP A . n A 1 213 VAL 213 211 211 VAL VAL A . n A 1 214 VAL 214 212 212 VAL VAL A . n A 1 215 GLN 215 213 213 GLN GLN A . n A 1 216 ASN 216 214 214 ASN ASN A . n A 1 217 ILE 217 215 215 ILE ILE A . n A 1 218 GLN 218 216 216 GLN GLN A . n A 1 219 ASP 219 217 217 ASP ASP A . n A 1 220 ILE 220 218 218 ILE ILE A . n A 1 221 CYS 221 219 219 CYS CYS A . n A 1 222 ASN 222 220 220 ASN ASN A . n A 1 223 SER 223 221 221 SER SER A . n A 1 224 LYS 224 222 222 LYS LYS A . n A 1 225 HIS 225 223 223 HIS HIS A . n A 1 226 MET 226 224 224 MET MET A . n A 1 227 GLN 227 225 225 GLN GLN A . n A 1 228 LYS 228 226 226 LYS LYS A . n A 1 229 ASN 229 227 ? ? ? A . n B 2 1 U 1 1 1 U U B . n B 2 2 C 2 2 2 C C B . n B 2 3 G 3 3 3 G G B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 ZN 1 501 501 ZN ZN A . D 3 ZN 1 502 502 ZN ZN A . E 3 ZN 1 503 504 ZN ZN A . F 3 ZN 1 504 503 ZN ZN A . G 4 SPM 1 101 1 SPM SPM B . H 5 HOH 1 601 17 HOH HOH A . H 5 HOH 2 602 38 HOH HOH A . H 5 HOH 3 603 23 HOH HOH A . H 5 HOH 4 604 61 HOH HOH A . H 5 HOH 5 605 50 HOH HOH A . H 5 HOH 6 606 31 HOH HOH A . H 5 HOH 7 607 112 HOH HOH A . H 5 HOH 8 608 15 HOH HOH A . H 5 HOH 9 609 75 HOH HOH A . H 5 HOH 10 610 51 HOH HOH A . H 5 HOH 11 611 85 HOH HOH A . H 5 HOH 12 612 59 HOH HOH A . H 5 HOH 13 613 42 HOH HOH A . H 5 HOH 14 614 21 HOH HOH A . H 5 HOH 15 615 20 HOH HOH A . H 5 HOH 16 616 14 HOH HOH A . H 5 HOH 17 617 81 HOH HOH A . H 5 HOH 18 618 70 HOH HOH A . H 5 HOH 19 619 62 HOH HOH A . H 5 HOH 20 620 64 HOH HOH A . H 5 HOH 21 621 22 HOH HOH A . H 5 HOH 22 622 126 HOH HOH A . H 5 HOH 23 623 6 HOH HOH A . H 5 HOH 24 624 74 HOH HOH A . H 5 HOH 25 625 7 HOH HOH A . H 5 HOH 26 626 3 HOH HOH A . H 5 HOH 27 627 72 HOH HOH A . H 5 HOH 28 628 53 HOH HOH A . H 5 HOH 29 629 82 HOH HOH A . H 5 HOH 30 630 106 HOH HOH A . H 5 HOH 31 631 9 HOH HOH A . H 5 HOH 32 632 16 HOH HOH A . H 5 HOH 33 633 36 HOH HOH A . H 5 HOH 34 634 67 HOH HOH A . H 5 HOH 35 635 28 HOH HOH A . H 5 HOH 36 636 4 HOH HOH A . H 5 HOH 37 637 68 HOH HOH A . H 5 HOH 38 638 57 HOH HOH A . H 5 HOH 39 639 84 HOH HOH A . H 5 HOH 40 640 26 HOH HOH A . H 5 HOH 41 641 125 HOH HOH A . H 5 HOH 42 642 45 HOH HOH A . H 5 HOH 43 643 139 HOH HOH A . H 5 HOH 44 644 24 HOH HOH A . H 5 HOH 45 645 35 HOH HOH A . H 5 HOH 46 646 78 HOH HOH A . H 5 HOH 47 647 58 HOH HOH A . H 5 HOH 48 648 91 HOH HOH A . H 5 HOH 49 649 141 HOH HOH A . H 5 HOH 50 650 13 HOH HOH A . H 5 HOH 51 651 134 HOH HOH A . H 5 HOH 52 652 41 HOH HOH A . H 5 HOH 53 653 69 HOH HOH A . H 5 HOH 54 654 12 HOH HOH A . H 5 HOH 55 655 60 HOH HOH A . H 5 HOH 56 656 2 HOH HOH A . H 5 HOH 57 657 27 HOH HOH A . H 5 HOH 58 658 39 HOH HOH A . H 5 HOH 59 659 90 HOH HOH A . H 5 HOH 60 660 97 HOH HOH A . H 5 HOH 61 661 19 HOH HOH A . H 5 HOH 62 662 8 HOH HOH A . H 5 HOH 63 663 79 HOH HOH A . H 5 HOH 64 664 88 HOH HOH A . H 5 HOH 65 665 1 HOH HOH A . H 5 HOH 66 666 100 HOH HOH A . H 5 HOH 67 667 107 HOH HOH A . H 5 HOH 68 668 30 HOH HOH A . H 5 HOH 69 669 110 HOH HOH A . H 5 HOH 70 670 93 HOH HOH A . H 5 HOH 71 671 34 HOH HOH A . H 5 HOH 72 672 25 HOH HOH A . H 5 HOH 73 673 11 HOH HOH A . H 5 HOH 74 674 37 HOH HOH A . H 5 HOH 75 675 122 HOH HOH A . H 5 HOH 76 676 10 HOH HOH A . H 5 HOH 77 677 76 HOH HOH A . H 5 HOH 78 678 131 HOH HOH A . H 5 HOH 79 679 98 HOH HOH A . H 5 HOH 80 680 40 HOH HOH A . H 5 HOH 81 681 140 HOH HOH A . H 5 HOH 82 682 94 HOH HOH A . H 5 HOH 83 683 52 HOH HOH A . H 5 HOH 84 684 101 HOH HOH A . H 5 HOH 85 685 104 HOH HOH A . H 5 HOH 86 686 128 HOH HOH A . H 5 HOH 87 687 109 HOH HOH A . H 5 HOH 88 688 138 HOH HOH A . H 5 HOH 89 689 80 HOH HOH A . I 5 HOH 1 201 77 HOH HOH B . I 5 HOH 2 202 47 HOH HOH B . I 5 HOH 3 203 65 HOH HOH B . I 5 HOH 4 204 32 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1250 ? 1 MORE -15 ? 1 'SSA (A^2)' 12020 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 75 ? A CYS 73 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 SG ? A CYS 80 ? A CYS 78 ? 1_555 110.6 ? 2 SG ? A CYS 75 ? A CYS 73 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 SG ? A CYS 84 ? A CYS 82 ? 1_555 117.1 ? 3 SG ? A CYS 80 ? A CYS 78 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 SG ? A CYS 84 ? A CYS 82 ? 1_555 110.4 ? 4 SG ? A CYS 75 ? A CYS 73 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 88 ? A HIS 86 ? 1_555 107.6 ? 5 SG ? A CYS 80 ? A CYS 78 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 88 ? A HIS 86 ? 1_555 108.1 ? 6 SG ? A CYS 84 ? A CYS 82 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 88 ? A HIS 86 ? 1_555 102.3 ? 7 SG ? A CYS 90 ? A CYS 88 ? 1_555 ZN ? D ZN . ? A ZN 502 ? 1_555 SG ? A CYS 98 ? A CYS 96 ? 1_555 105.6 ? 8 SG ? A CYS 90 ? A CYS 88 ? 1_555 ZN ? D ZN . ? A ZN 502 ? 1_555 SG ? A CYS 108 ? A CYS 106 ? 1_555 110.9 ? 9 SG ? A CYS 98 ? A CYS 96 ? 1_555 ZN ? D ZN . ? A ZN 502 ? 1_555 SG ? A CYS 108 ? A CYS 106 ? 1_555 117.9 ? 10 SG ? A CYS 90 ? A CYS 88 ? 1_555 ZN ? D ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 112 ? A HIS 110 ? 1_555 113.1 ? 11 SG ? A CYS 98 ? A CYS 96 ? 1_555 ZN ? D ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 112 ? A HIS 110 ? 1_555 102.2 ? 12 SG ? A CYS 108 ? A CYS 106 ? 1_555 ZN ? D ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 112 ? A HIS 110 ? 1_555 107.0 ? 13 SG ? A CYS 152 ? A CYS 150 ? 1_555 ZN ? F ZN . ? A ZN 504 ? 1_555 SG ? A CYS 164 ? A CYS 162 ? 1_555 111.1 ? 14 SG ? A CYS 152 ? A CYS 150 ? 1_555 ZN ? F ZN . ? A ZN 504 ? 1_555 SG ? A CYS 170 ? A CYS 168 ? 1_555 102.8 ? 15 SG ? A CYS 164 ? A CYS 162 ? 1_555 ZN ? F ZN . ? A ZN 504 ? 1_555 SG ? A CYS 170 ? A CYS 168 ? 1_555 112.2 ? 16 SG ? A CYS 152 ? A CYS 150 ? 1_555 ZN ? F ZN . ? A ZN 504 ? 1_555 NE2 ? A HIS 174 ? A HIS 172 ? 1_555 108.5 ? 17 SG ? A CYS 164 ? A CYS 162 ? 1_555 ZN ? F ZN . ? A ZN 504 ? 1_555 NE2 ? A HIS 174 ? A HIS 172 ? 1_555 97.5 ? 18 SG ? A CYS 170 ? A CYS 168 ? 1_555 ZN ? F ZN . ? A ZN 504 ? 1_555 NE2 ? A HIS 174 ? A HIS 172 ? 1_555 124.7 ? 19 SG ? A CYS 176 ? A CYS 174 ? 1_555 ZN ? E ZN . ? A ZN 503 ? 1_555 SG ? A CYS 184 ? A CYS 182 ? 1_555 114.0 ? 20 SG ? A CYS 176 ? A CYS 174 ? 1_555 ZN ? E ZN . ? A ZN 503 ? 1_555 SG ? A CYS 189 ? A CYS 187 ? 1_555 112.9 ? 21 SG ? A CYS 184 ? A CYS 182 ? 1_555 ZN ? E ZN . ? A ZN 503 ? 1_555 SG ? A CYS 189 ? A CYS 187 ? 1_555 103.3 ? 22 SG ? A CYS 176 ? A CYS 174 ? 1_555 ZN ? E ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 193 ? A HIS 191 ? 1_555 114.7 ? 23 SG ? A CYS 184 ? A CYS 182 ? 1_555 ZN ? E ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 193 ? A HIS 191 ? 1_555 108.4 ? 24 SG ? A CYS 189 ? A CYS 187 ? 1_555 ZN ? E ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 193 ? A HIS 191 ? 1_555 102.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-11-13 2 'Structure model' 1 1 2019-11-27 3 'Structure model' 1 2 2019-12-11 4 'Structure model' 1 3 2019-12-18 5 'Structure model' 1 4 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' pdbx_audit_support 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_citation_author.identifier_ORCID' 4 2 'Structure model' '_citation_author.name' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 4 'Structure model' '_pdbx_audit_support.funding_organization' 9 5 'Structure model' '_database_2.pdbx_DOI' 10 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.3 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 6UEJ _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 97 ? ? -94.56 34.77 2 1 LEU A 113 ? ? -97.86 51.21 3 1 HIS A 172 ? ? -102.84 74.65 4 1 ASN A 186 ? ? -111.55 66.83 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 5 ? CG ? A GLU 7 CG 2 1 Y 1 A GLU 5 ? CD ? A GLU 7 CD 3 1 Y 1 A GLU 5 ? OE1 ? A GLU 7 OE1 4 1 Y 1 A GLU 5 ? OE2 ? A GLU 7 OE2 5 1 Y 1 A GLN 28 ? CG ? A GLN 30 CG 6 1 Y 1 A GLN 28 ? CD ? A GLN 30 CD 7 1 Y 1 A GLN 28 ? OE1 ? A GLN 30 OE1 8 1 Y 1 A GLN 28 ? NE2 ? A GLN 30 NE2 9 1 Y 1 A ILE 60 ? CG1 ? A ILE 62 CG1 10 1 Y 1 A ILE 60 ? CG2 ? A ILE 62 CG2 11 1 Y 1 A ILE 60 ? CD1 ? A ILE 62 CD1 12 1 Y 1 A THR 61 ? OG1 ? A THR 63 OG1 13 1 Y 1 A THR 61 ? CG2 ? A THR 63 CG2 14 1 Y 1 A ASN 104 ? CG ? A ASN 106 CG 15 1 Y 1 A ASN 104 ? OD1 ? A ASN 106 OD1 16 1 Y 1 A ASN 104 ? ND2 ? A ASN 106 ND2 17 1 Y 1 A ASN 163 ? CG ? A ASN 165 CG 18 1 Y 1 A ASN 163 ? OD1 ? A ASN 165 OD1 19 1 Y 1 A ASN 163 ? ND2 ? A ASN 165 ND2 20 1 Y 1 A GLN 164 ? CG ? A GLN 166 CG 21 1 Y 1 A GLN 164 ? CD ? A GLN 166 CD 22 1 Y 1 A GLN 164 ? OE1 ? A GLN 166 OE1 23 1 Y 1 A GLN 164 ? NE2 ? A GLN 166 NE2 24 1 Y 1 A ARG 196 ? CG ? A ARG 198 CG 25 1 Y 1 A ARG 196 ? CD ? A ARG 198 CD 26 1 Y 1 A ARG 196 ? NE ? A ARG 198 NE 27 1 Y 1 A ARG 196 ? CZ ? A ARG 198 CZ 28 1 Y 1 A ARG 196 ? NH1 ? A ARG 198 NH1 29 1 Y 1 A ARG 196 ? NH2 ? A ARG 198 NH2 30 1 Y 1 A LYS 197 ? CG ? A LYS 199 CG 31 1 Y 1 A LYS 197 ? CD ? A LYS 199 CD 32 1 Y 1 A LYS 197 ? CE ? A LYS 199 CE 33 1 Y 1 A LYS 197 ? NZ ? A LYS 199 NZ 34 1 Y 1 A GLU 204 ? CG ? A GLU 206 CG 35 1 Y 1 A GLU 204 ? CD ? A GLU 206 CD 36 1 Y 1 A GLU 204 ? OE1 ? A GLU 206 OE1 37 1 Y 1 A GLU 204 ? OE2 ? A GLU 206 OE2 38 1 Y 1 A LYS 226 ? CG ? A LYS 228 CG 39 1 Y 1 A LYS 226 ? CD ? A LYS 228 CD 40 1 Y 1 A LYS 226 ? CE ? A LYS 228 CE 41 1 Y 1 A LYS 226 ? NZ ? A LYS 228 NZ 42 1 N 1 B SPM 101 ? N1 ? G SPM 1 N1 43 1 N 1 B SPM 101 ? C2 ? G SPM 1 C2 44 1 N 1 B SPM 101 ? C3 ? G SPM 1 C3 45 1 N 1 B SPM 101 ? C4 ? G SPM 1 C4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -1 ? A SER 1 2 1 Y 1 A ASN 0 ? A ASN 2 3 1 Y 1 A ALA 1 ? A ALA 3 4 1 Y 1 A THR 54 ? A THR 56 5 1 Y 1 A GLY 55 ? A GLY 57 6 1 Y 1 A GLY 56 ? A GLY 58 7 1 Y 1 A GLU 57 ? A GLU 59 8 1 Y 1 A ALA 58 ? A ALA 60 9 1 Y 1 A GLY 59 ? A GLY 61 10 1 Y 1 A GLN 100 ? A GLN 102 11 1 Y 1 A SER 101 ? A SER 103 12 1 Y 1 A GLU 102 ? A GLU 104 13 1 Y 1 A ARG 103 ? A ARG 105 14 1 Y 1 A GLN 165 ? A GLN 167 15 1 Y 1 A PRO 166 ? A PRO 168 16 1 Y 1 A PRO 167 ? A PRO 169 17 1 Y 1 A ASN 227 ? A ASN 229 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 C OP3 O N N 74 C P P N N 75 C OP1 O N N 76 C OP2 O N N 77 C "O5'" O N N 78 C "C5'" C N N 79 C "C4'" C N R 80 C "O4'" O N N 81 C "C3'" C N S 82 C "O3'" O N N 83 C "C2'" C N R 84 C "O2'" O N N 85 C "C1'" C N R 86 C N1 N N N 87 C C2 C N N 88 C O2 O N N 89 C N3 N N N 90 C C4 C N N 91 C N4 N N N 92 C C5 C N N 93 C C6 C N N 94 C HOP3 H N N 95 C HOP2 H N N 96 C "H5'" H N N 97 C "H5''" H N N 98 C "H4'" H N N 99 C "H3'" H N N 100 C "HO3'" H N N 101 C "H2'" H N N 102 C "HO2'" H N N 103 C "H1'" H N N 104 C H41 H N N 105 C H42 H N N 106 C H5 H N N 107 C H6 H N N 108 CYS N N N N 109 CYS CA C N R 110 CYS C C N N 111 CYS O O N N 112 CYS CB C N N 113 CYS SG S N N 114 CYS OXT O N N 115 CYS H H N N 116 CYS H2 H N N 117 CYS HA H N N 118 CYS HB2 H N N 119 CYS HB3 H N N 120 CYS HG H N N 121 CYS HXT H N N 122 G OP3 O N N 123 G P P N N 124 G OP1 O N N 125 G OP2 O N N 126 G "O5'" O N N 127 G "C5'" C N N 128 G "C4'" C N R 129 G "O4'" O N N 130 G "C3'" C N S 131 G "O3'" O N N 132 G "C2'" C N R 133 G "O2'" O N N 134 G "C1'" C N R 135 G N9 N Y N 136 G C8 C Y N 137 G N7 N Y N 138 G C5 C Y N 139 G C6 C N N 140 G O6 O N N 141 G N1 N N N 142 G C2 C N N 143 G N2 N N N 144 G N3 N N N 145 G C4 C Y N 146 G HOP3 H N N 147 G HOP2 H N N 148 G "H5'" H N N 149 G "H5''" H N N 150 G "H4'" H N N 151 G "H3'" H N N 152 G "HO3'" H N N 153 G "H2'" H N N 154 G "HO2'" H N N 155 G "H1'" H N N 156 G H8 H N N 157 G H1 H N N 158 G H21 H N N 159 G H22 H N N 160 GLN N N N N 161 GLN CA C N S 162 GLN C C N N 163 GLN O O N N 164 GLN CB C N N 165 GLN CG C N N 166 GLN CD C N N 167 GLN OE1 O N N 168 GLN NE2 N N N 169 GLN OXT O N N 170 GLN H H N N 171 GLN H2 H N N 172 GLN HA H N N 173 GLN HB2 H N N 174 GLN HB3 H N N 175 GLN HG2 H N N 176 GLN HG3 H N N 177 GLN HE21 H N N 178 GLN HE22 H N N 179 GLN HXT H N N 180 GLU N N N N 181 GLU CA C N S 182 GLU C C N N 183 GLU O O N N 184 GLU CB C N N 185 GLU CG C N N 186 GLU CD C N N 187 GLU OE1 O N N 188 GLU OE2 O N N 189 GLU OXT O N N 190 GLU H H N N 191 GLU H2 H N N 192 GLU HA H N N 193 GLU HB2 H N N 194 GLU HB3 H N N 195 GLU HG2 H N N 196 GLU HG3 H N N 197 GLU HE2 H N N 198 GLU HXT H N N 199 GLY N N N N 200 GLY CA C N N 201 GLY C C N N 202 GLY O O N N 203 GLY OXT O N N 204 GLY H H N N 205 GLY H2 H N N 206 GLY HA2 H N N 207 GLY HA3 H N N 208 GLY HXT H N N 209 HIS N N N N 210 HIS CA C N S 211 HIS C C N N 212 HIS O O N N 213 HIS CB C N N 214 HIS CG C Y N 215 HIS ND1 N Y N 216 HIS CD2 C Y N 217 HIS CE1 C Y N 218 HIS NE2 N Y N 219 HIS OXT O N N 220 HIS H H N N 221 HIS H2 H N N 222 HIS HA H N N 223 HIS HB2 H N N 224 HIS HB3 H N N 225 HIS HD1 H N N 226 HIS HD2 H N N 227 HIS HE1 H N N 228 HIS HE2 H N N 229 HIS HXT H N N 230 HOH O O N N 231 HOH H1 H N N 232 HOH H2 H N N 233 ILE N N N N 234 ILE CA C N S 235 ILE C C N N 236 ILE O O N N 237 ILE CB C N S 238 ILE CG1 C N N 239 ILE CG2 C N N 240 ILE CD1 C N N 241 ILE OXT O N N 242 ILE H H N N 243 ILE H2 H N N 244 ILE HA H N N 245 ILE HB H N N 246 ILE HG12 H N N 247 ILE HG13 H N N 248 ILE HG21 H N N 249 ILE HG22 H N N 250 ILE HG23 H N N 251 ILE HD11 H N N 252 ILE HD12 H N N 253 ILE HD13 H N N 254 ILE HXT H N N 255 LEU N N N N 256 LEU CA C N S 257 LEU C C N N 258 LEU O O N N 259 LEU CB C N N 260 LEU CG C N N 261 LEU CD1 C N N 262 LEU CD2 C N N 263 LEU OXT O N N 264 LEU H H N N 265 LEU H2 H N N 266 LEU HA H N N 267 LEU HB2 H N N 268 LEU HB3 H N N 269 LEU HG H N N 270 LEU HD11 H N N 271 LEU HD12 H N N 272 LEU HD13 H N N 273 LEU HD21 H N N 274 LEU HD22 H N N 275 LEU HD23 H N N 276 LEU HXT H N N 277 LYS N N N N 278 LYS CA C N S 279 LYS C C N N 280 LYS O O N N 281 LYS CB C N N 282 LYS CG C N N 283 LYS CD C N N 284 LYS CE C N N 285 LYS NZ N N N 286 LYS OXT O N N 287 LYS H H N N 288 LYS H2 H N N 289 LYS HA H N N 290 LYS HB2 H N N 291 LYS HB3 H N N 292 LYS HG2 H N N 293 LYS HG3 H N N 294 LYS HD2 H N N 295 LYS HD3 H N N 296 LYS HE2 H N N 297 LYS HE3 H N N 298 LYS HZ1 H N N 299 LYS HZ2 H N N 300 LYS HZ3 H N N 301 LYS HXT H N N 302 MET N N N N 303 MET CA C N S 304 MET C C N N 305 MET O O N N 306 MET CB C N N 307 MET CG C N N 308 MET SD S N N 309 MET CE C N N 310 MET OXT O N N 311 MET H H N N 312 MET H2 H N N 313 MET HA H N N 314 MET HB2 H N N 315 MET HB3 H N N 316 MET HG2 H N N 317 MET HG3 H N N 318 MET HE1 H N N 319 MET HE2 H N N 320 MET HE3 H N N 321 MET HXT H N N 322 PHE N N N N 323 PHE CA C N S 324 PHE C C N N 325 PHE O O N N 326 PHE CB C N N 327 PHE CG C Y N 328 PHE CD1 C Y N 329 PHE CD2 C Y N 330 PHE CE1 C Y N 331 PHE CE2 C Y N 332 PHE CZ C Y N 333 PHE OXT O N N 334 PHE H H N N 335 PHE H2 H N N 336 PHE HA H N N 337 PHE HB2 H N N 338 PHE HB3 H N N 339 PHE HD1 H N N 340 PHE HD2 H N N 341 PHE HE1 H N N 342 PHE HE2 H N N 343 PHE HZ H N N 344 PHE HXT H N N 345 PRO N N N N 346 PRO CA C N S 347 PRO C C N N 348 PRO O O N N 349 PRO CB C N N 350 PRO CG C N N 351 PRO CD C N N 352 PRO OXT O N N 353 PRO H H N N 354 PRO HA H N N 355 PRO HB2 H N N 356 PRO HB3 H N N 357 PRO HG2 H N N 358 PRO HG3 H N N 359 PRO HD2 H N N 360 PRO HD3 H N N 361 PRO HXT H N N 362 SER N N N N 363 SER CA C N S 364 SER C C N N 365 SER O O N N 366 SER CB C N N 367 SER OG O N N 368 SER OXT O N N 369 SER H H N N 370 SER H2 H N N 371 SER HA H N N 372 SER HB2 H N N 373 SER HB3 H N N 374 SER HG H N N 375 SER HXT H N N 376 SPM N1 N N N 377 SPM C2 C N N 378 SPM C3 C N N 379 SPM C4 C N N 380 SPM N5 N N N 381 SPM C6 C N N 382 SPM C7 C N N 383 SPM C8 C N N 384 SPM C9 C N N 385 SPM N10 N N N 386 SPM C11 C N N 387 SPM C12 C N N 388 SPM C13 C N N 389 SPM N14 N N N 390 SPM HN11 H N N 391 SPM HN12 H N N 392 SPM H21 H N N 393 SPM H22 H N N 394 SPM H31 H N N 395 SPM H32 H N N 396 SPM H41 H N N 397 SPM H42 H N N 398 SPM HN5 H N N 399 SPM H61 H N N 400 SPM H62 H N N 401 SPM H71 H N N 402 SPM H72 H N N 403 SPM H81 H N N 404 SPM H82 H N N 405 SPM H91 H N N 406 SPM H92 H N N 407 SPM HN0 H N N 408 SPM H111 H N N 409 SPM H112 H N N 410 SPM H121 H N N 411 SPM H122 H N N 412 SPM H131 H N N 413 SPM H132 H N N 414 SPM HN41 H N N 415 SPM HN42 H N N 416 THR N N N N 417 THR CA C N S 418 THR C C N N 419 THR O O N N 420 THR CB C N R 421 THR OG1 O N N 422 THR CG2 C N N 423 THR OXT O N N 424 THR H H N N 425 THR H2 H N N 426 THR HA H N N 427 THR HB H N N 428 THR HG1 H N N 429 THR HG21 H N N 430 THR HG22 H N N 431 THR HG23 H N N 432 THR HXT H N N 433 TYR N N N N 434 TYR CA C N S 435 TYR C C N N 436 TYR O O N N 437 TYR CB C N N 438 TYR CG C Y N 439 TYR CD1 C Y N 440 TYR CD2 C Y N 441 TYR CE1 C Y N 442 TYR CE2 C Y N 443 TYR CZ C Y N 444 TYR OH O N N 445 TYR OXT O N N 446 TYR H H N N 447 TYR H2 H N N 448 TYR HA H N N 449 TYR HB2 H N N 450 TYR HB3 H N N 451 TYR HD1 H N N 452 TYR HD2 H N N 453 TYR HE1 H N N 454 TYR HE2 H N N 455 TYR HH H N N 456 TYR HXT H N N 457 U OP3 O N N 458 U P P N N 459 U OP1 O N N 460 U OP2 O N N 461 U "O5'" O N N 462 U "C5'" C N N 463 U "C4'" C N R 464 U "O4'" O N N 465 U "C3'" C N S 466 U "O3'" O N N 467 U "C2'" C N R 468 U "O2'" O N N 469 U "C1'" C N R 470 U N1 N N N 471 U C2 C N N 472 U O2 O N N 473 U N3 N N N 474 U C4 C N N 475 U O4 O N N 476 U C5 C N N 477 U C6 C N N 478 U HOP3 H N N 479 U HOP2 H N N 480 U "H5'" H N N 481 U "H5''" H N N 482 U "H4'" H N N 483 U "H3'" H N N 484 U "HO3'" H N N 485 U "H2'" H N N 486 U "HO2'" H N N 487 U "H1'" H N N 488 U H3 H N N 489 U H5 H N N 490 U H6 H N N 491 VAL N N N N 492 VAL CA C N S 493 VAL C C N N 494 VAL O O N N 495 VAL CB C N N 496 VAL CG1 C N N 497 VAL CG2 C N N 498 VAL OXT O N N 499 VAL H H N N 500 VAL H2 H N N 501 VAL HA H N N 502 VAL HB H N N 503 VAL HG11 H N N 504 VAL HG12 H N N 505 VAL HG13 H N N 506 VAL HG21 H N N 507 VAL HG22 H N N 508 VAL HG23 H N N 509 VAL HXT H N N 510 ZN ZN ZN N N 511 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 C OP3 P sing N N 70 C OP3 HOP3 sing N N 71 C P OP1 doub N N 72 C P OP2 sing N N 73 C P "O5'" sing N N 74 C OP2 HOP2 sing N N 75 C "O5'" "C5'" sing N N 76 C "C5'" "C4'" sing N N 77 C "C5'" "H5'" sing N N 78 C "C5'" "H5''" sing N N 79 C "C4'" "O4'" sing N N 80 C "C4'" "C3'" sing N N 81 C "C4'" "H4'" sing N N 82 C "O4'" "C1'" sing N N 83 C "C3'" "O3'" sing N N 84 C "C3'" "C2'" sing N N 85 C "C3'" "H3'" sing N N 86 C "O3'" "HO3'" sing N N 87 C "C2'" "O2'" sing N N 88 C "C2'" "C1'" sing N N 89 C "C2'" "H2'" sing N N 90 C "O2'" "HO2'" sing N N 91 C "C1'" N1 sing N N 92 C "C1'" "H1'" sing N N 93 C N1 C2 sing N N 94 C N1 C6 sing N N 95 C C2 O2 doub N N 96 C C2 N3 sing N N 97 C N3 C4 doub N N 98 C C4 N4 sing N N 99 C C4 C5 sing N N 100 C N4 H41 sing N N 101 C N4 H42 sing N N 102 C C5 C6 doub N N 103 C C5 H5 sing N N 104 C C6 H6 sing N N 105 CYS N CA sing N N 106 CYS N H sing N N 107 CYS N H2 sing N N 108 CYS CA C sing N N 109 CYS CA CB sing N N 110 CYS CA HA sing N N 111 CYS C O doub N N 112 CYS C OXT sing N N 113 CYS CB SG sing N N 114 CYS CB HB2 sing N N 115 CYS CB HB3 sing N N 116 CYS SG HG sing N N 117 CYS OXT HXT sing N N 118 G OP3 P sing N N 119 G OP3 HOP3 sing N N 120 G P OP1 doub N N 121 G P OP2 sing N N 122 G P "O5'" sing N N 123 G OP2 HOP2 sing N N 124 G "O5'" "C5'" sing N N 125 G "C5'" "C4'" sing N N 126 G "C5'" "H5'" sing N N 127 G "C5'" "H5''" sing N N 128 G "C4'" "O4'" sing N N 129 G "C4'" "C3'" sing N N 130 G "C4'" "H4'" sing N N 131 G "O4'" "C1'" sing N N 132 G "C3'" "O3'" sing N N 133 G "C3'" "C2'" sing N N 134 G "C3'" "H3'" sing N N 135 G "O3'" "HO3'" sing N N 136 G "C2'" "O2'" sing N N 137 G "C2'" "C1'" sing N N 138 G "C2'" "H2'" sing N N 139 G "O2'" "HO2'" sing N N 140 G "C1'" N9 sing N N 141 G "C1'" "H1'" sing N N 142 G N9 C8 sing Y N 143 G N9 C4 sing Y N 144 G C8 N7 doub Y N 145 G C8 H8 sing N N 146 G N7 C5 sing Y N 147 G C5 C6 sing N N 148 G C5 C4 doub Y N 149 G C6 O6 doub N N 150 G C6 N1 sing N N 151 G N1 C2 sing N N 152 G N1 H1 sing N N 153 G C2 N2 sing N N 154 G C2 N3 doub N N 155 G N2 H21 sing N N 156 G N2 H22 sing N N 157 G N3 C4 sing N N 158 GLN N CA sing N N 159 GLN N H sing N N 160 GLN N H2 sing N N 161 GLN CA C sing N N 162 GLN CA CB sing N N 163 GLN CA HA sing N N 164 GLN C O doub N N 165 GLN C OXT sing N N 166 GLN CB CG sing N N 167 GLN CB HB2 sing N N 168 GLN CB HB3 sing N N 169 GLN CG CD sing N N 170 GLN CG HG2 sing N N 171 GLN CG HG3 sing N N 172 GLN CD OE1 doub N N 173 GLN CD NE2 sing N N 174 GLN NE2 HE21 sing N N 175 GLN NE2 HE22 sing N N 176 GLN OXT HXT sing N N 177 GLU N CA sing N N 178 GLU N H sing N N 179 GLU N H2 sing N N 180 GLU CA C sing N N 181 GLU CA CB sing N N 182 GLU CA HA sing N N 183 GLU C O doub N N 184 GLU C OXT sing N N 185 GLU CB CG sing N N 186 GLU CB HB2 sing N N 187 GLU CB HB3 sing N N 188 GLU CG CD sing N N 189 GLU CG HG2 sing N N 190 GLU CG HG3 sing N N 191 GLU CD OE1 doub N N 192 GLU CD OE2 sing N N 193 GLU OE2 HE2 sing N N 194 GLU OXT HXT sing N N 195 GLY N CA sing N N 196 GLY N H sing N N 197 GLY N H2 sing N N 198 GLY CA C sing N N 199 GLY CA HA2 sing N N 200 GLY CA HA3 sing N N 201 GLY C O doub N N 202 GLY C OXT sing N N 203 GLY OXT HXT sing N N 204 HIS N CA sing N N 205 HIS N H sing N N 206 HIS N H2 sing N N 207 HIS CA C sing N N 208 HIS CA CB sing N N 209 HIS CA HA sing N N 210 HIS C O doub N N 211 HIS C OXT sing N N 212 HIS CB CG sing N N 213 HIS CB HB2 sing N N 214 HIS CB HB3 sing N N 215 HIS CG ND1 sing Y N 216 HIS CG CD2 doub Y N 217 HIS ND1 CE1 doub Y N 218 HIS ND1 HD1 sing N N 219 HIS CD2 NE2 sing Y N 220 HIS CD2 HD2 sing N N 221 HIS CE1 NE2 sing Y N 222 HIS CE1 HE1 sing N N 223 HIS NE2 HE2 sing N N 224 HIS OXT HXT sing N N 225 HOH O H1 sing N N 226 HOH O H2 sing N N 227 ILE N CA sing N N 228 ILE N H sing N N 229 ILE N H2 sing N N 230 ILE CA C sing N N 231 ILE CA CB sing N N 232 ILE CA HA sing N N 233 ILE C O doub N N 234 ILE C OXT sing N N 235 ILE CB CG1 sing N N 236 ILE CB CG2 sing N N 237 ILE CB HB sing N N 238 ILE CG1 CD1 sing N N 239 ILE CG1 HG12 sing N N 240 ILE CG1 HG13 sing N N 241 ILE CG2 HG21 sing N N 242 ILE CG2 HG22 sing N N 243 ILE CG2 HG23 sing N N 244 ILE CD1 HD11 sing N N 245 ILE CD1 HD12 sing N N 246 ILE CD1 HD13 sing N N 247 ILE OXT HXT sing N N 248 LEU N CA sing N N 249 LEU N H sing N N 250 LEU N H2 sing N N 251 LEU CA C sing N N 252 LEU CA CB sing N N 253 LEU CA HA sing N N 254 LEU C O doub N N 255 LEU C OXT sing N N 256 LEU CB CG sing N N 257 LEU CB HB2 sing N N 258 LEU CB HB3 sing N N 259 LEU CG CD1 sing N N 260 LEU CG CD2 sing N N 261 LEU CG HG sing N N 262 LEU CD1 HD11 sing N N 263 LEU CD1 HD12 sing N N 264 LEU CD1 HD13 sing N N 265 LEU CD2 HD21 sing N N 266 LEU CD2 HD22 sing N N 267 LEU CD2 HD23 sing N N 268 LEU OXT HXT sing N N 269 LYS N CA sing N N 270 LYS N H sing N N 271 LYS N H2 sing N N 272 LYS CA C sing N N 273 LYS CA CB sing N N 274 LYS CA HA sing N N 275 LYS C O doub N N 276 LYS C OXT sing N N 277 LYS CB CG sing N N 278 LYS CB HB2 sing N N 279 LYS CB HB3 sing N N 280 LYS CG CD sing N N 281 LYS CG HG2 sing N N 282 LYS CG HG3 sing N N 283 LYS CD CE sing N N 284 LYS CD HD2 sing N N 285 LYS CD HD3 sing N N 286 LYS CE NZ sing N N 287 LYS CE HE2 sing N N 288 LYS CE HE3 sing N N 289 LYS NZ HZ1 sing N N 290 LYS NZ HZ2 sing N N 291 LYS NZ HZ3 sing N N 292 LYS OXT HXT sing N N 293 MET N CA sing N N 294 MET N H sing N N 295 MET N H2 sing N N 296 MET CA C sing N N 297 MET CA CB sing N N 298 MET CA HA sing N N 299 MET C O doub N N 300 MET C OXT sing N N 301 MET CB CG sing N N 302 MET CB HB2 sing N N 303 MET CB HB3 sing N N 304 MET CG SD sing N N 305 MET CG HG2 sing N N 306 MET CG HG3 sing N N 307 MET SD CE sing N N 308 MET CE HE1 sing N N 309 MET CE HE2 sing N N 310 MET CE HE3 sing N N 311 MET OXT HXT sing N N 312 PHE N CA sing N N 313 PHE N H sing N N 314 PHE N H2 sing N N 315 PHE CA C sing N N 316 PHE CA CB sing N N 317 PHE CA HA sing N N 318 PHE C O doub N N 319 PHE C OXT sing N N 320 PHE CB CG sing N N 321 PHE CB HB2 sing N N 322 PHE CB HB3 sing N N 323 PHE CG CD1 doub Y N 324 PHE CG CD2 sing Y N 325 PHE CD1 CE1 sing Y N 326 PHE CD1 HD1 sing N N 327 PHE CD2 CE2 doub Y N 328 PHE CD2 HD2 sing N N 329 PHE CE1 CZ doub Y N 330 PHE CE1 HE1 sing N N 331 PHE CE2 CZ sing Y N 332 PHE CE2 HE2 sing N N 333 PHE CZ HZ sing N N 334 PHE OXT HXT sing N N 335 PRO N CA sing N N 336 PRO N CD sing N N 337 PRO N H sing N N 338 PRO CA C sing N N 339 PRO CA CB sing N N 340 PRO CA HA sing N N 341 PRO C O doub N N 342 PRO C OXT sing N N 343 PRO CB CG sing N N 344 PRO CB HB2 sing N N 345 PRO CB HB3 sing N N 346 PRO CG CD sing N N 347 PRO CG HG2 sing N N 348 PRO CG HG3 sing N N 349 PRO CD HD2 sing N N 350 PRO CD HD3 sing N N 351 PRO OXT HXT sing N N 352 SER N CA sing N N 353 SER N H sing N N 354 SER N H2 sing N N 355 SER CA C sing N N 356 SER CA CB sing N N 357 SER CA HA sing N N 358 SER C O doub N N 359 SER C OXT sing N N 360 SER CB OG sing N N 361 SER CB HB2 sing N N 362 SER CB HB3 sing N N 363 SER OG HG sing N N 364 SER OXT HXT sing N N 365 SPM N1 C2 sing N N 366 SPM N1 HN11 sing N N 367 SPM N1 HN12 sing N N 368 SPM C2 C3 sing N N 369 SPM C2 H21 sing N N 370 SPM C2 H22 sing N N 371 SPM C3 C4 sing N N 372 SPM C3 H31 sing N N 373 SPM C3 H32 sing N N 374 SPM C4 N5 sing N N 375 SPM C4 H41 sing N N 376 SPM C4 H42 sing N N 377 SPM N5 C6 sing N N 378 SPM N5 HN5 sing N N 379 SPM C6 C7 sing N N 380 SPM C6 H61 sing N N 381 SPM C6 H62 sing N N 382 SPM C7 C8 sing N N 383 SPM C7 H71 sing N N 384 SPM C7 H72 sing N N 385 SPM C8 C9 sing N N 386 SPM C8 H81 sing N N 387 SPM C8 H82 sing N N 388 SPM C9 N10 sing N N 389 SPM C9 H91 sing N N 390 SPM C9 H92 sing N N 391 SPM N10 C11 sing N N 392 SPM N10 HN0 sing N N 393 SPM C11 C12 sing N N 394 SPM C11 H111 sing N N 395 SPM C11 H112 sing N N 396 SPM C12 C13 sing N N 397 SPM C12 H121 sing N N 398 SPM C12 H122 sing N N 399 SPM C13 N14 sing N N 400 SPM C13 H131 sing N N 401 SPM C13 H132 sing N N 402 SPM N14 HN41 sing N N 403 SPM N14 HN42 sing N N 404 THR N CA sing N N 405 THR N H sing N N 406 THR N H2 sing N N 407 THR CA C sing N N 408 THR CA CB sing N N 409 THR CA HA sing N N 410 THR C O doub N N 411 THR C OXT sing N N 412 THR CB OG1 sing N N 413 THR CB CG2 sing N N 414 THR CB HB sing N N 415 THR OG1 HG1 sing N N 416 THR CG2 HG21 sing N N 417 THR CG2 HG22 sing N N 418 THR CG2 HG23 sing N N 419 THR OXT HXT sing N N 420 TYR N CA sing N N 421 TYR N H sing N N 422 TYR N H2 sing N N 423 TYR CA C sing N N 424 TYR CA CB sing N N 425 TYR CA HA sing N N 426 TYR C O doub N N 427 TYR C OXT sing N N 428 TYR CB CG sing N N 429 TYR CB HB2 sing N N 430 TYR CB HB3 sing N N 431 TYR CG CD1 doub Y N 432 TYR CG CD2 sing Y N 433 TYR CD1 CE1 sing Y N 434 TYR CD1 HD1 sing N N 435 TYR CD2 CE2 doub Y N 436 TYR CD2 HD2 sing N N 437 TYR CE1 CZ doub Y N 438 TYR CE1 HE1 sing N N 439 TYR CE2 CZ sing Y N 440 TYR CE2 HE2 sing N N 441 TYR CZ OH sing N N 442 TYR OH HH sing N N 443 TYR OXT HXT sing N N 444 U OP3 P sing N N 445 U OP3 HOP3 sing N N 446 U P OP1 doub N N 447 U P OP2 sing N N 448 U P "O5'" sing N N 449 U OP2 HOP2 sing N N 450 U "O5'" "C5'" sing N N 451 U "C5'" "C4'" sing N N 452 U "C5'" "H5'" sing N N 453 U "C5'" "H5''" sing N N 454 U "C4'" "O4'" sing N N 455 U "C4'" "C3'" sing N N 456 U "C4'" "H4'" sing N N 457 U "O4'" "C1'" sing N N 458 U "C3'" "O3'" sing N N 459 U "C3'" "C2'" sing N N 460 U "C3'" "H3'" sing N N 461 U "O3'" "HO3'" sing N N 462 U "C2'" "O2'" sing N N 463 U "C2'" "C1'" sing N N 464 U "C2'" "H2'" sing N N 465 U "O2'" "HO2'" sing N N 466 U "C1'" N1 sing N N 467 U "C1'" "H1'" sing N N 468 U N1 C2 sing N N 469 U N1 C6 sing N N 470 U C2 O2 doub N N 471 U C2 N3 sing N N 472 U N3 C4 sing N N 473 U N3 H3 sing N N 474 U C4 O4 doub N N 475 U C4 C5 sing N N 476 U C5 C6 doub N N 477 U C5 H5 sing N N 478 U C6 H6 sing N N 479 VAL N CA sing N N 480 VAL N H sing N N 481 VAL N H2 sing N N 482 VAL CA C sing N N 483 VAL CA CB sing N N 484 VAL CA HA sing N N 485 VAL C O doub N N 486 VAL C OXT sing N N 487 VAL CB CG1 sing N N 488 VAL CB CG2 sing N N 489 VAL CB HB sing N N 490 VAL CG1 HG11 sing N N 491 VAL CG1 HG12 sing N N 492 VAL CG1 HG13 sing N N 493 VAL CG2 HG21 sing N N 494 VAL CG2 HG22 sing N N 495 VAL CG2 HG23 sing N N 496 VAL OXT HXT sing N N 497 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'U54 AI50470' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ZINC ION' ZN 4 SPERMINE SPM 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3U9G _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #