data_6UF2 # _entry.id 6UF2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6UF2 pdb_00006uf2 10.2210/pdb6uf2/pdb WWPDB D_1000244099 ? ? BMRB 30676 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of biofilm-related EbsA from Synechococcus elongatus' _pdbx_database_related.db_id 30676 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6UF2 _pdbx_database_status.recvd_initial_deposition_date 2019-09-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhang, N.' 1 0000-0002-3590-3774 'LiWang, A.L.' 2 0000-0003-4741-6946 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Sci.' _citation.journal_id_ASTM PRCIEI _citation.journal_id_CSD 0795 _citation.journal_id_ISSN 1469-896X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 2274 _citation.page_last 2280 _citation.title 'Solution NMR structure of Se0862, a highly conserved cyanobacterial protein involved in biofilm formation.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pro.3952 _citation.pdbx_database_id_PubMed 32949024 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, N.' 1 0000-0002-3590-3774 primary 'Chang, Y.G.' 2 ? primary 'Tseng, R.' 3 ? primary 'Ovchinnikov, S.' 4 ? primary 'Schwarz, R.' 5 ? primary 'LiWang, A.' 6 0000-0003-4741-6946 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Biofilm-related protein' _entity.formula_weight 14425.336 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDA ELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS ; _entity_poly.pdbx_seq_one_letter_code_can ;MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDA ELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 ILE n 1 4 ASP n 1 5 GLU n 1 6 LEU n 1 7 VAL n 1 8 PRO n 1 9 ALA n 1 10 ASP n 1 11 PRO n 1 12 ARG n 1 13 ALA n 1 14 VAL n 1 15 SER n 1 16 LEU n 1 17 TYR n 1 18 THR n 1 19 PRO n 1 20 TYR n 1 21 TYR n 1 22 SER n 1 23 GLN n 1 24 ALA n 1 25 ASN n 1 26 ARG n 1 27 ARG n 1 28 ARG n 1 29 TYR n 1 30 LEU n 1 31 PRO n 1 32 TYR n 1 33 ALA n 1 34 LEU n 1 35 SER n 1 36 LEU n 1 37 TYR n 1 38 GLN n 1 39 GLY n 1 40 SER n 1 41 SER n 1 42 ILE n 1 43 GLU n 1 44 GLY n 1 45 SER n 1 46 ARG n 1 47 ALA n 1 48 VAL n 1 49 GLU n 1 50 GLY n 1 51 GLY n 1 52 ALA n 1 53 PRO n 1 54 ILE n 1 55 SER n 1 56 PHE n 1 57 VAL n 1 58 ALA n 1 59 THR n 1 60 TRP n 1 61 THR n 1 62 VAL n 1 63 THR n 1 64 PRO n 1 65 LEU n 1 66 PRO n 1 67 ALA n 1 68 ASP n 1 69 MET n 1 70 THR n 1 71 ARG n 1 72 CYS n 1 73 HIS n 1 74 LEU n 1 75 GLN n 1 76 PHE n 1 77 ASN n 1 78 ASN n 1 79 ASP n 1 80 ALA n 1 81 GLU n 1 82 LEU n 1 83 THR n 1 84 TYR n 1 85 GLU n 1 86 ILE n 1 87 LEU n 1 88 LEU n 1 89 PRO n 1 90 ASN n 1 91 HIS n 1 92 GLU n 1 93 PHE n 1 94 LEU n 1 95 GLU n 1 96 TYR n 1 97 LEU n 1 98 ILE n 1 99 ASP n 1 100 MET n 1 101 LEU n 1 102 MET n 1 103 GLY n 1 104 TYR n 1 105 GLN n 1 106 ARG n 1 107 MET n 1 108 GLN n 1 109 LYS n 1 110 THR n 1 111 ASP n 1 112 PHE n 1 113 PRO n 1 114 GLY n 1 115 ALA n 1 116 PHE n 1 117 TYR n 1 118 ARG n 1 119 ARG n 1 120 LEU n 1 121 LEU n 1 122 GLY n 1 123 TYR n 1 124 ASP n 1 125 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 125 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Synpcc7942_0862 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'PCC 7942' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Synechococcus elongatus (strain PCC 7942)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1140 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q31PX7_SYNE7 _struct_ref.pdbx_db_accession Q31PX7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDA ELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6UF2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 125 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q31PX7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 125 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 125 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '3D HNCACB' 1 isotropic 4 1 1 '3D CBCA(CO)NH' 1 isotropic 5 1 1 '3D HNCO' 1 isotropic 6 1 1 '3D HN(CA)CO' 1 isotropic 17 1 1 '3D HBHA(CO)NH' 1 isotropic 16 1 1 '3D HCCH(CO)NH' 1 isotropic 15 1 1 '3D CC(CO)NH' 1 isotropic 14 1 1 '2D (HB)CB(CDCG)HG' 1 isotropic 13 1 1 '2D (HB)CB(CDCGCE)HE' 1 isotropic 12 1 1 '3D IPAP-HNCO' 1 isotropic 11 1 1 '3D 1H-15N NOESY' 1 isotropic 10 1 1 '3D 1H-13C NOESY' 1 isotropic 9 1 1 '3D HCCH-COSY' 1 isotropic 8 1 1 '3D HCCH-COSY' 1 isotropic 7 1 1 '3D HCCH-TOCSY' 1 isotropic 18 1 1 '4D 13C-13C NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 295 _pdbx_nmr_exptl_sample_conditions.pressure_units mbar _pdbx_nmr_exptl_sample_conditions.pressure 1013.25 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 125 _pdbx_nmr_exptl_sample_conditions.details '20 mM Tris, 100 mM NaCl, 5 mM TCEP,' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 15N_13C_Se0862 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.6 mM [U-99% 13C; U-99% 15N] Se0862, 20 mM Tris, 100 mM NaCl, 5 mM TCEP, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 15N_13C_Se0862 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details 'TCI cryoprobe' # _pdbx_nmr_refine.entry_id 6UF2 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6UF2 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6UF2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement 'X-PLOR NIH' 2.51 'Schwieters, Kuszewski, Tjandra and Clore' 2 'structure calculation' 'X-PLOR NIH' 2.51 'Schwieters, Kuszewski, Tjandra and Clore' 3 'chemical shift assignment' NMRFAM-SPARKY 1.414 'Woonghee Lee, Marco Tonelli, and John L. Markley' 4 'peak picking' NMRFAM-SPARKY 1.414 'Woonghee Lee, Marco Tonelli, and John L. Markley' 5 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6UF2 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6UF2 _struct.title 'NMR structure of biofilm-related Se0862 from Synechococcus elongatus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6UF2 _struct_keywords.text 'secretion, biofilm, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 2 ? LEU A 6 ? ARG A 2 LEU A 6 5 ? 5 HELX_P HELX_P2 AA2 ASP A 10 ? THR A 18 ? ASP A 10 THR A 18 1 ? 9 HELX_P HELX_P3 AA3 ARG A 28 ? GLN A 38 ? ARG A 28 GLN A 38 1 ? 11 HELX_P HELX_P4 AA4 PRO A 64 ? ALA A 67 ? PRO A 64 ALA A 67 5 ? 4 HELX_P HELX_P5 AA5 ASN A 90 ? GLN A 105 ? ASN A 90 GLN A 105 1 ? 16 HELX_P HELX_P6 AA6 PRO A 113 ? GLY A 122 ? PRO A 113 GLY A 122 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 42 ? ARG A 46 ? ILE A 42 ARG A 46 AA1 2 ILE A 54 ? THR A 59 ? ILE A 54 THR A 59 AA1 3 MET A 69 ? PHE A 76 ? MET A 69 PHE A 76 AA1 4 ASP A 79 ? PRO A 89 ? ASP A 79 PRO A 89 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 42 ? N ILE A 42 O ALA A 58 ? O ALA A 58 AA1 2 3 N VAL A 57 ? N VAL A 57 O HIS A 73 ? O HIS A 73 AA1 3 4 N LEU A 74 ? N LEU A 74 O TYR A 84 ? O TYR A 84 # _atom_sites.entry_id 6UF2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 TRP 60 60 60 TRP TRP A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 HIS 91 91 91 HIS HIS A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 MET 107 107 107 MET MET A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 SER 125 125 125 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-09-30 2 'Structure model' 1 1 2021-07-28 3 'Structure model' 1 2 2021-08-18 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' 15 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Se0862 0.6 ? mM '[U-99% 13C; U-99% 15N]' 1 Tris 20 ? mM 'natural abundance' 1 NaCl 100 ? mM 'natural abundance' 1 TCEP 5 ? mM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 6 ? ? -103.87 -114.58 2 1 ALA A 24 ? ? -157.27 -73.51 3 1 ASN A 25 ? ? -137.00 -76.75 4 1 SER A 41 ? ? 65.72 177.91 5 1 ASP A 68 ? ? -68.54 64.80 6 1 THR A 110 ? ? -109.85 55.53 7 2 LEU A 6 ? ? -106.84 -108.67 8 2 SER A 41 ? ? 67.33 179.77 9 3 LEU A 6 ? ? -102.77 -120.45 10 3 ASN A 25 ? ? 67.60 -121.23 11 3 SER A 41 ? ? 65.28 173.94 12 4 LEU A 6 ? ? -106.37 -107.44 13 4 ALA A 24 ? ? -162.77 -86.58 14 4 SER A 41 ? ? 64.83 -175.90 15 4 THR A 110 ? ? -95.83 56.34 16 5 LEU A 6 ? ? -107.16 -114.25 17 5 ALA A 24 ? ? -172.11 -176.58 18 5 SER A 41 ? ? 66.56 177.17 19 5 THR A 110 ? ? -94.45 56.31 20 6 LEU A 6 ? ? -104.27 -114.66 21 6 SER A 41 ? ? 65.58 176.03 22 6 PRO A 64 ? ? -49.87 155.59 23 7 LEU A 6 ? ? -104.70 -105.37 24 7 TYR A 21 ? ? -170.16 -174.37 25 7 ALA A 24 ? ? -158.77 -78.29 26 7 ASN A 25 ? ? -170.84 -54.33 27 7 SER A 41 ? ? 68.91 175.79 28 8 LEU A 6 ? ? -105.96 -112.93 29 8 ASN A 25 ? ? 75.01 175.74 30 8 SER A 41 ? ? 63.31 -178.34 31 9 LEU A 6 ? ? -107.10 -112.26 32 9 SER A 22 ? ? -161.52 71.38 33 9 ASN A 25 ? ? 60.52 -121.76 34 9 SER A 41 ? ? 66.18 -178.89 35 10 LEU A 6 ? ? -101.67 -104.14 36 10 SER A 41 ? ? 67.79 178.27 37 10 PRO A 64 ? ? -46.69 152.33 # _pdbx_audit_support.funding_organization 'Department of Defense (DOD, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number FA9550-17-1-0447 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support immunoprecipitation _pdbx_struct_assembly_auth_evidence.details ? #