data_6UZF # _entry.id 6UZF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6UZF pdb_00006uzf 10.2210/pdb6uzf/pdb WWPDB D_1000242895 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6UZF _pdbx_database_status.recvd_initial_deposition_date 2019-11-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Karim, M.R.' 1 0000-0002-0424-127X 'Chan, A.' 2 0000-0001-6913-6764 'Schonbrunn, E.' 3 0000-0002-3589-3510 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 63 _citation.language ? _citation.page_first 3227 _citation.page_last 3237 _citation.title 'Structural Basis of Inhibitor Selectivity in the BRD7/9 Subfamily of Bromodomains.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.9b01980 _citation.pdbx_database_id_PubMed 32091206 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Karim, R.M.' 1 ? primary 'Chan, A.' 2 ? primary 'Zhu, J.Y.' 3 ? primary 'Schonbrunn, E.' 4 0000-0002-3589-3510 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6UZF _cell.details ? _cell.formula_units_Z ? _cell.length_a 34.270 _cell.length_a_esd ? _cell.length_b 55.510 _cell.length_b_esd ? _cell.length_c 58.410 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6UZF _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bromodomain-containing protein 9' 14249.763 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer nat 1,2-ETHANEDIOL 62.068 2 ? ? ? ? 4 non-polymer syn 'DIMETHYL SULFOXIDE' 78.133 1 ? ? ? ? 5 water nat water 18.015 151 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Rhabdomyosarcoma antigen MU-RMS-40.8' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMLKLSAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKL MCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS ; _entity_poly.pdbx_seq_one_letter_code_can ;SMLKLSAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKL MCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 LEU n 1 4 LYS n 1 5 LEU n 1 6 SER n 1 7 ALA n 1 8 GLU n 1 9 ASN n 1 10 GLU n 1 11 SER n 1 12 THR n 1 13 PRO n 1 14 ILE n 1 15 GLN n 1 16 GLN n 1 17 LEU n 1 18 LEU n 1 19 GLU n 1 20 HIS n 1 21 PHE n 1 22 LEU n 1 23 ARG n 1 24 GLN n 1 25 LEU n 1 26 GLN n 1 27 ARG n 1 28 LYS n 1 29 ASP n 1 30 PRO n 1 31 HIS n 1 32 GLY n 1 33 PHE n 1 34 PHE n 1 35 ALA n 1 36 PHE n 1 37 PRO n 1 38 VAL n 1 39 THR n 1 40 ASP n 1 41 ALA n 1 42 ILE n 1 43 ALA n 1 44 PRO n 1 45 GLY n 1 46 TYR n 1 47 SER n 1 48 MET n 1 49 ILE n 1 50 ILE n 1 51 LYS n 1 52 HIS n 1 53 PRO n 1 54 MET n 1 55 ASP n 1 56 PHE n 1 57 GLY n 1 58 THR n 1 59 MET n 1 60 LYS n 1 61 ASP n 1 62 LYS n 1 63 ILE n 1 64 VAL n 1 65 ALA n 1 66 ASN n 1 67 GLU n 1 68 TYR n 1 69 LYS n 1 70 SER n 1 71 VAL n 1 72 THR n 1 73 GLU n 1 74 PHE n 1 75 LYS n 1 76 ALA n 1 77 ASP n 1 78 PHE n 1 79 LYS n 1 80 LEU n 1 81 MET n 1 82 CYS n 1 83 ASP n 1 84 ASN n 1 85 ALA n 1 86 MET n 1 87 THR n 1 88 TYR n 1 89 ASN n 1 90 ARG n 1 91 PRO n 1 92 ASP n 1 93 THR n 1 94 VAL n 1 95 TYR n 1 96 TYR n 1 97 LYS n 1 98 LEU n 1 99 ALA n 1 100 LYS n 1 101 LYS n 1 102 ILE n 1 103 LEU n 1 104 HIS n 1 105 ALA n 1 106 GLY n 1 107 PHE n 1 108 LYS n 1 109 MET n 1 110 MET n 1 111 SER n 1 112 LYS n 1 113 GLU n 1 114 ARG n 1 115 LEU n 1 116 LEU n 1 117 ALA n 1 118 LEU n 1 119 LYS n 1 120 ARG n 1 121 SER n 1 122 MET n 1 123 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 123 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BRD9, UNQ3040/PRO9856' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details pNIC28-Bsa4 _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pNIC28 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BRD9_HUMAN _struct_ref.pdbx_db_accession Q9H8M2 _struct_ref.pdbx_db_isoform Q9H8M2-1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LKLSAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMC DNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS ; _struct_ref.pdbx_align_begin 14 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6UZF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 123 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H8M2 _struct_ref_seq.db_align_beg 14 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 134 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 130 _struct_ref_seq.pdbx_auth_seq_align_end 250 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6UZF SER A 1 ? UNP Q9H8M2 ? ? 'expression tag' 128 1 1 6UZF MET A 2 ? UNP Q9H8M2 ? ? 'expression tag' 129 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DMS non-polymer . 'DIMETHYL SULFOXIDE' ? 'C2 H6 O S' 78.133 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6UZF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.38 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.36 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.05 M (NH4)2SO4, 0.05 M Bis-Tris (pH 6.5), 30% Pentaerythritol ethoxylate (15/4 EO/OH)' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-11-30 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si filter' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 24.067 _reflns.entry_id 6UZF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.750 _reflns.d_resolution_low 40.238 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11749 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.093 _reflns.pdbx_Rmerge_I_obs 0.063 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.960 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.974 _reflns.pdbx_scaling_rejects 10 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.068 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 83340 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.750 1.800 ? 3.270 ? 6239 870 ? 870 100.000 ? ? ? ? 0.598 ? ? ? ? ? ? ? ? 7.171 ? ? ? ? 0.644 ? ? 1 1 0.880 ? ? 1.800 1.840 ? 4.590 ? 5801 804 ? 802 99.800 ? ? ? ? 0.436 ? ? ? ? ? ? ? ? 7.233 ? ? ? ? 0.469 ? ? 2 1 0.912 ? ? 1.840 1.900 ? 5.540 ? 5845 813 ? 813 100.000 ? ? ? ? 0.351 ? ? ? ? ? ? ? ? 7.189 ? ? ? ? 0.378 ? ? 3 1 0.947 ? ? 1.900 1.960 ? 6.860 ? 5631 782 ? 781 99.900 ? ? ? ? 0.287 ? ? ? ? ? ? ? ? 7.210 ? ? ? ? 0.309 ? ? 4 1 0.968 ? ? 1.960 2.020 ? 9.080 ? 5467 770 ? 767 99.600 ? ? ? ? 0.214 ? ? ? ? ? ? ? ? 7.128 ? ? ? ? 0.230 ? ? 5 1 0.983 ? ? 2.020 2.090 ? 13.000 ? 5316 736 ? 736 100.000 ? ? ? ? 0.147 ? ? ? ? ? ? ? ? 7.223 ? ? ? ? 0.159 ? ? 6 1 0.993 ? ? 2.090 2.170 ? 15.790 ? 5155 720 ? 719 99.900 ? ? ? ? 0.122 ? ? ? ? ? ? ? ? 7.170 ? ? ? ? 0.131 ? ? 7 1 0.992 ? ? 2.170 2.260 ? 18.020 ? 4945 692 ? 692 100.000 ? ? ? ? 0.102 ? ? ? ? ? ? ? ? 7.146 ? ? ? ? 0.109 ? ? 8 1 0.995 ? ? 2.260 2.360 ? 20.250 ? 4711 652 ? 652 100.000 ? ? ? ? 0.092 ? ? ? ? ? ? ? ? 7.225 ? ? ? ? 0.099 ? ? 9 1 0.995 ? ? 2.360 2.480 ? 23.400 ? 4509 630 ? 630 100.000 ? ? ? ? 0.077 ? ? ? ? ? ? ? ? 7.157 ? ? ? ? 0.083 ? ? 10 1 0.997 ? ? 2.480 2.610 ? 25.980 ? 4392 615 ? 615 100.000 ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 7.141 ? ? ? ? 0.075 ? ? 11 1 0.998 ? ? 2.610 2.770 ? 30.480 ? 4085 572 ? 572 100.000 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 7.142 ? ? ? ? 0.062 ? ? 12 1 0.998 ? ? 2.770 2.960 ? 36.220 ? 3813 545 ? 543 99.600 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 7.022 ? ? ? ? 0.052 ? ? 13 1 0.999 ? ? 2.960 3.200 ? 44.150 ? 3559 504 ? 504 100.000 ? ? ? ? 0.039 ? ? ? ? ? ? ? ? 7.062 ? ? ? ? 0.042 ? ? 14 1 0.999 ? ? 3.200 3.500 ? 51.780 ? 3334 480 ? 480 100.000 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 6.946 ? ? ? ? 0.035 ? ? 15 1 0.998 ? ? 3.500 3.910 ? 59.940 ? 2950 429 ? 429 100.000 ? ? ? ? 0.026 ? ? ? ? ? ? ? ? 6.876 ? ? ? ? 0.029 ? ? 16 1 1.000 ? ? 3.910 4.520 ? 63.910 ? 2642 385 ? 385 100.000 ? ? ? ? 0.021 ? ? ? ? ? ? ? ? 6.862 ? ? ? ? 0.023 ? ? 17 1 1.000 ? ? 4.520 5.530 ? 62.820 ? 2276 332 ? 332 100.000 ? ? ? ? 0.022 ? ? ? ? ? ? ? ? 6.855 ? ? ? ? 0.024 ? ? 18 1 0.999 ? ? 5.530 7.830 ? 56.090 ? 1713 262 ? 262 100.000 ? ? ? ? 0.023 ? ? ? ? ? ? ? ? 6.538 ? ? ? ? 0.025 ? ? 19 1 0.999 ? ? 7.830 40.238 ? 65.370 ? 957 165 ? 165 100.000 ? ? ? ? 0.018 ? ? ? ? ? ? ? ? 5.800 ? ? ? ? 0.020 ? ? 20 1 1.000 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 55.790 _refine.B_iso_mean 18.8779 _refine.B_iso_min 7.410 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6UZF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.7500 _refine.ls_d_res_low 40.2380 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11748 _refine.ls_number_reflns_R_free 588 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9100 _refine.ls_percent_reflns_R_free 5.0100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1799 _refine.ls_R_factor_R_free 0.2193 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1778 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3HME _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.0200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.7500 _refine_hist.d_res_low 40.2380 _refine_hist.number_atoms_solvent 151 _refine_hist.number_atoms_total 1016 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 104 _refine_hist.pdbx_B_iso_mean_ligand 36.87 _refine_hist.pdbx_B_iso_mean_solvent 29.06 _refine_hist.pdbx_number_atoms_protein 848 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 17 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.7501 1.9262 . . 144 2733 100.0000 . . . 0.2467 0.0000 0.2050 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9262 2.2049 . . 144 2742 100.0000 . . . 0.2423 0.0000 0.1801 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2049 2.7779 . . 146 2776 100.0000 . . . 0.2186 0.0000 0.1783 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7779 40.23 . . 154 2909 100.0000 . . . 0.2034 0.0000 0.1709 . . . . . . . . . . . # _struct.entry_id 6UZF _struct.title 'Crystal structure of the unliganded bromodomain of human BRD9' _struct.pdbx_model_details APO _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6UZF _struct_keywords.text 'BRD9, BAF, PBAF, mSWI/SNF, GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 12 ? LYS A 28 ? THR A 139 LYS A 155 1 ? 17 HELX_P HELX_P2 AA2 GLY A 45 ? ILE A 50 ? GLY A 172 ILE A 177 1 ? 6 HELX_P HELX_P3 AA3 ASP A 55 ? ALA A 65 ? ASP A 182 ALA A 192 1 ? 11 HELX_P HELX_P4 AA4 SER A 70 ? ASN A 89 ? SER A 197 ASN A 216 1 ? 20 HELX_P HELX_P5 AA5 THR A 93 ? SER A 111 ? THR A 220 SER A 238 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 301 ? 6 'binding site for residue SO4 A 301' AC2 Software A EDO 302 ? 4 'binding site for residue EDO A 302' AC3 Software A DMS 304 ? 4 'binding site for residue DMS A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 20 ? HIS A 147 . ? 1_555 ? 2 AC1 6 ARG A 23 ? ARG A 150 . ? 1_555 ? 3 AC1 6 ARG A 27 ? ARG A 154 . ? 1_555 ? 4 AC1 6 HOH F . ? HOH A 406 . ? 1_555 ? 5 AC1 6 HOH F . ? HOH A 457 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 493 . ? 1_555 ? 7 AC2 4 LYS A 62 ? LYS A 189 . ? 1_555 ? 8 AC2 4 LYS A 100 ? LYS A 227 . ? 2_455 ? 9 AC2 4 HOH F . ? HOH A 410 . ? 2_455 ? 10 AC2 4 HOH F . ? HOH A 450 . ? 1_555 ? 11 AC3 4 PHE A 34 ? PHE A 161 . ? 1_555 ? 12 AC3 4 MET A 48 ? MET A 175 . ? 4_445 ? 13 AC3 4 ASN A 89 ? ASN A 216 . ? 1_555 ? 14 AC3 4 HOH F . ? HOH A 409 . ? 1_555 ? # _atom_sites.entry_id 6UZF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.029180 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018015 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017120 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 128 ? ? ? A . n A 1 2 MET 2 129 ? ? ? A . n A 1 3 LEU 3 130 ? ? ? A . n A 1 4 LYS 4 131 ? ? ? A . n A 1 5 LEU 5 132 ? ? ? A . n A 1 6 SER 6 133 ? ? ? A . n A 1 7 ALA 7 134 ? ? ? A . n A 1 8 GLU 8 135 ? ? ? A . n A 1 9 ASN 9 136 ? ? ? A . n A 1 10 GLU 10 137 137 GLU GLU A . n A 1 11 SER 11 138 138 SER SER A . n A 1 12 THR 12 139 139 THR THR A . n A 1 13 PRO 13 140 140 PRO PRO A . n A 1 14 ILE 14 141 141 ILE ILE A . n A 1 15 GLN 15 142 142 GLN GLN A . n A 1 16 GLN 16 143 143 GLN GLN A . n A 1 17 LEU 17 144 144 LEU LEU A . n A 1 18 LEU 18 145 145 LEU LEU A . n A 1 19 GLU 19 146 146 GLU GLU A . n A 1 20 HIS 20 147 147 HIS HIS A . n A 1 21 PHE 21 148 148 PHE PHE A . n A 1 22 LEU 22 149 149 LEU LEU A . n A 1 23 ARG 23 150 150 ARG ARG A . n A 1 24 GLN 24 151 151 GLN GLN A . n A 1 25 LEU 25 152 152 LEU LEU A . n A 1 26 GLN 26 153 153 GLN GLN A . n A 1 27 ARG 27 154 154 ARG ARG A . n A 1 28 LYS 28 155 155 LYS LYS A . n A 1 29 ASP 29 156 156 ASP ASP A . n A 1 30 PRO 30 157 157 PRO PRO A . n A 1 31 HIS 31 158 158 HIS HIS A . n A 1 32 GLY 32 159 159 GLY GLY A . n A 1 33 PHE 33 160 160 PHE PHE A . n A 1 34 PHE 34 161 161 PHE PHE A . n A 1 35 ALA 35 162 162 ALA ALA A . n A 1 36 PHE 36 163 163 PHE PHE A . n A 1 37 PRO 37 164 164 PRO PRO A . n A 1 38 VAL 38 165 165 VAL VAL A . n A 1 39 THR 39 166 166 THR THR A . n A 1 40 ASP 40 167 167 ASP ASP A . n A 1 41 ALA 41 168 168 ALA ALA A . n A 1 42 ILE 42 169 169 ILE ILE A . n A 1 43 ALA 43 170 170 ALA ALA A . n A 1 44 PRO 44 171 171 PRO PRO A . n A 1 45 GLY 45 172 172 GLY GLY A . n A 1 46 TYR 46 173 173 TYR TYR A . n A 1 47 SER 47 174 174 SER SER A . n A 1 48 MET 48 175 175 MET MET A . n A 1 49 ILE 49 176 176 ILE ILE A . n A 1 50 ILE 50 177 177 ILE ILE A . n A 1 51 LYS 51 178 178 LYS LYS A . n A 1 52 HIS 52 179 179 HIS HIS A . n A 1 53 PRO 53 180 180 PRO PRO A . n A 1 54 MET 54 181 181 MET MET A . n A 1 55 ASP 55 182 182 ASP ASP A . n A 1 56 PHE 56 183 183 PHE PHE A . n A 1 57 GLY 57 184 184 GLY GLY A . n A 1 58 THR 58 185 185 THR THR A . n A 1 59 MET 59 186 186 MET MET A . n A 1 60 LYS 60 187 187 LYS LYS A . n A 1 61 ASP 61 188 188 ASP ASP A . n A 1 62 LYS 62 189 189 LYS LYS A . n A 1 63 ILE 63 190 190 ILE ILE A . n A 1 64 VAL 64 191 191 VAL VAL A . n A 1 65 ALA 65 192 192 ALA ALA A . n A 1 66 ASN 66 193 193 ASN ASN A . n A 1 67 GLU 67 194 194 GLU GLU A . n A 1 68 TYR 68 195 195 TYR TYR A . n A 1 69 LYS 69 196 196 LYS LYS A . n A 1 70 SER 70 197 197 SER SER A . n A 1 71 VAL 71 198 198 VAL VAL A . n A 1 72 THR 72 199 199 THR THR A . n A 1 73 GLU 73 200 200 GLU GLU A . n A 1 74 PHE 74 201 201 PHE PHE A . n A 1 75 LYS 75 202 202 LYS LYS A . n A 1 76 ALA 76 203 203 ALA ALA A . n A 1 77 ASP 77 204 204 ASP ASP A . n A 1 78 PHE 78 205 205 PHE PHE A . n A 1 79 LYS 79 206 206 LYS LYS A . n A 1 80 LEU 80 207 207 LEU LEU A . n A 1 81 MET 81 208 208 MET MET A . n A 1 82 CYS 82 209 209 CYS CYS A . n A 1 83 ASP 83 210 210 ASP ASP A . n A 1 84 ASN 84 211 211 ASN ASN A . n A 1 85 ALA 85 212 212 ALA ALA A . n A 1 86 MET 86 213 213 MET MET A . n A 1 87 THR 87 214 214 THR THR A . n A 1 88 TYR 88 215 215 TYR TYR A . n A 1 89 ASN 89 216 216 ASN ASN A . n A 1 90 ARG 90 217 217 ARG ARG A . n A 1 91 PRO 91 218 218 PRO PRO A . n A 1 92 ASP 92 219 219 ASP ASP A . n A 1 93 THR 93 220 220 THR THR A . n A 1 94 VAL 94 221 221 VAL VAL A . n A 1 95 TYR 95 222 222 TYR TYR A . n A 1 96 TYR 96 223 223 TYR TYR A . n A 1 97 LYS 97 224 224 LYS LYS A . n A 1 98 LEU 98 225 225 LEU LEU A . n A 1 99 ALA 99 226 226 ALA ALA A . n A 1 100 LYS 100 227 227 LYS LYS A . n A 1 101 LYS 101 228 228 LYS LYS A . n A 1 102 ILE 102 229 229 ILE ILE A . n A 1 103 LEU 103 230 230 LEU LEU A . n A 1 104 HIS 104 231 231 HIS HIS A . n A 1 105 ALA 105 232 232 ALA ALA A . n A 1 106 GLY 106 233 233 GLY GLY A . n A 1 107 PHE 107 234 234 PHE PHE A . n A 1 108 LYS 108 235 235 LYS LYS A . n A 1 109 MET 109 236 236 MET MET A . n A 1 110 MET 110 237 237 MET MET A . n A 1 111 SER 111 238 238 SER SER A . n A 1 112 LYS 112 239 239 LYS LYS A . n A 1 113 GLU 113 240 240 GLU GLU A . n A 1 114 ARG 114 241 ? ? ? A . n A 1 115 LEU 115 242 ? ? ? A . n A 1 116 LEU 116 243 ? ? ? A . n A 1 117 ALA 117 244 ? ? ? A . n A 1 118 LEU 118 245 ? ? ? A . n A 1 119 LYS 119 246 ? ? ? A . n A 1 120 ARG 120 247 ? ? ? A . n A 1 121 SER 121 248 ? ? ? A . n A 1 122 MET 122 249 ? ? ? A . n A 1 123 SER 123 250 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 301 1 SO4 SO4 A . C 3 EDO 1 302 1 EDO EDO A . D 3 EDO 1 303 2 EDO EDO A . E 4 DMS 1 304 1 DMS DMS A . F 5 HOH 1 401 47 HOH HOH A . F 5 HOH 2 402 140 HOH HOH A . F 5 HOH 3 403 117 HOH HOH A . F 5 HOH 4 404 115 HOH HOH A . F 5 HOH 5 405 57 HOH HOH A . F 5 HOH 6 406 113 HOH HOH A . F 5 HOH 7 407 16 HOH HOH A . F 5 HOH 8 408 61 HOH HOH A . F 5 HOH 9 409 6 HOH HOH A . F 5 HOH 10 410 133 HOH HOH A . F 5 HOH 11 411 137 HOH HOH A . F 5 HOH 12 412 74 HOH HOH A . F 5 HOH 13 413 119 HOH HOH A . F 5 HOH 14 414 3 HOH HOH A . F 5 HOH 15 415 10 HOH HOH A . F 5 HOH 16 416 150 HOH HOH A . F 5 HOH 17 417 2 HOH HOH A . F 5 HOH 18 418 84 HOH HOH A . F 5 HOH 19 419 146 HOH HOH A . F 5 HOH 20 420 128 HOH HOH A . F 5 HOH 21 421 22 HOH HOH A . F 5 HOH 22 422 13 HOH HOH A . F 5 HOH 23 423 90 HOH HOH A . F 5 HOH 24 424 73 HOH HOH A . F 5 HOH 25 425 12 HOH HOH A . F 5 HOH 26 426 77 HOH HOH A . F 5 HOH 27 427 42 HOH HOH A . F 5 HOH 28 428 1 HOH HOH A . F 5 HOH 29 429 29 HOH HOH A . F 5 HOH 30 430 123 HOH HOH A . F 5 HOH 31 431 45 HOH HOH A . F 5 HOH 32 432 83 HOH HOH A . F 5 HOH 33 433 7 HOH HOH A . F 5 HOH 34 434 23 HOH HOH A . F 5 HOH 35 435 54 HOH HOH A . F 5 HOH 36 436 27 HOH HOH A . F 5 HOH 37 437 25 HOH HOH A . F 5 HOH 38 438 44 HOH HOH A . F 5 HOH 39 439 20 HOH HOH A . F 5 HOH 40 440 149 HOH HOH A . F 5 HOH 41 441 14 HOH HOH A . F 5 HOH 42 442 68 HOH HOH A . F 5 HOH 43 443 30 HOH HOH A . F 5 HOH 44 444 152 HOH HOH A . F 5 HOH 45 445 145 HOH HOH A . F 5 HOH 46 446 11 HOH HOH A . F 5 HOH 47 447 40 HOH HOH A . F 5 HOH 48 448 9 HOH HOH A . F 5 HOH 49 449 17 HOH HOH A . F 5 HOH 50 450 49 HOH HOH A . F 5 HOH 51 451 70 HOH HOH A . F 5 HOH 52 452 56 HOH HOH A . F 5 HOH 53 453 18 HOH HOH A . F 5 HOH 54 454 78 HOH HOH A . F 5 HOH 55 455 52 HOH HOH A . F 5 HOH 56 456 31 HOH HOH A . F 5 HOH 57 457 38 HOH HOH A . F 5 HOH 58 458 24 HOH HOH A . F 5 HOH 59 459 130 HOH HOH A . F 5 HOH 60 460 33 HOH HOH A . F 5 HOH 61 461 141 HOH HOH A . F 5 HOH 62 462 120 HOH HOH A . F 5 HOH 63 463 21 HOH HOH A . F 5 HOH 64 464 53 HOH HOH A . F 5 HOH 65 465 55 HOH HOH A . F 5 HOH 66 466 107 HOH HOH A . F 5 HOH 67 467 48 HOH HOH A . F 5 HOH 68 468 8 HOH HOH A . F 5 HOH 69 469 80 HOH HOH A . F 5 HOH 70 470 67 HOH HOH A . F 5 HOH 71 471 62 HOH HOH A . F 5 HOH 72 472 59 HOH HOH A . F 5 HOH 73 473 5 HOH HOH A . F 5 HOH 74 474 99 HOH HOH A . F 5 HOH 75 475 50 HOH HOH A . F 5 HOH 76 476 19 HOH HOH A . F 5 HOH 77 477 63 HOH HOH A . F 5 HOH 78 478 64 HOH HOH A . F 5 HOH 79 479 4 HOH HOH A . F 5 HOH 80 480 87 HOH HOH A . F 5 HOH 81 481 144 HOH HOH A . F 5 HOH 82 482 112 HOH HOH A . F 5 HOH 83 483 92 HOH HOH A . F 5 HOH 84 484 94 HOH HOH A . F 5 HOH 85 485 139 HOH HOH A . F 5 HOH 86 486 75 HOH HOH A . F 5 HOH 87 487 125 HOH HOH A . F 5 HOH 88 488 118 HOH HOH A . F 5 HOH 89 489 46 HOH HOH A . F 5 HOH 90 490 89 HOH HOH A . F 5 HOH 91 491 26 HOH HOH A . F 5 HOH 92 492 102 HOH HOH A . F 5 HOH 93 493 132 HOH HOH A . F 5 HOH 94 494 28 HOH HOH A . F 5 HOH 95 495 15 HOH HOH A . F 5 HOH 96 496 96 HOH HOH A . F 5 HOH 97 497 124 HOH HOH A . F 5 HOH 98 498 35 HOH HOH A . F 5 HOH 99 499 151 HOH HOH A . F 5 HOH 100 500 110 HOH HOH A . F 5 HOH 101 501 104 HOH HOH A . F 5 HOH 102 502 116 HOH HOH A . F 5 HOH 103 503 121 HOH HOH A . F 5 HOH 104 504 79 HOH HOH A . F 5 HOH 105 505 81 HOH HOH A . F 5 HOH 106 506 39 HOH HOH A . F 5 HOH 107 507 71 HOH HOH A . F 5 HOH 108 508 114 HOH HOH A . F 5 HOH 109 509 34 HOH HOH A . F 5 HOH 110 510 72 HOH HOH A . F 5 HOH 111 511 135 HOH HOH A . F 5 HOH 112 512 66 HOH HOH A . F 5 HOH 113 513 51 HOH HOH A . F 5 HOH 114 514 43 HOH HOH A . F 5 HOH 115 515 136 HOH HOH A . F 5 HOH 116 516 91 HOH HOH A . F 5 HOH 117 517 95 HOH HOH A . F 5 HOH 118 518 127 HOH HOH A . F 5 HOH 119 519 103 HOH HOH A . F 5 HOH 120 520 126 HOH HOH A . F 5 HOH 121 521 148 HOH HOH A . F 5 HOH 122 522 129 HOH HOH A . F 5 HOH 123 523 100 HOH HOH A . F 5 HOH 124 524 32 HOH HOH A . F 5 HOH 125 525 101 HOH HOH A . F 5 HOH 126 526 122 HOH HOH A . F 5 HOH 127 527 111 HOH HOH A . F 5 HOH 128 528 82 HOH HOH A . F 5 HOH 129 529 143 HOH HOH A . F 5 HOH 130 530 142 HOH HOH A . F 5 HOH 131 531 93 HOH HOH A . F 5 HOH 132 532 69 HOH HOH A . F 5 HOH 133 533 58 HOH HOH A . F 5 HOH 134 534 138 HOH HOH A . F 5 HOH 135 535 65 HOH HOH A . F 5 HOH 136 536 131 HOH HOH A . F 5 HOH 137 537 37 HOH HOH A . F 5 HOH 138 538 88 HOH HOH A . F 5 HOH 139 539 108 HOH HOH A . F 5 HOH 140 540 134 HOH HOH A . F 5 HOH 141 541 86 HOH HOH A . F 5 HOH 142 542 109 HOH HOH A . F 5 HOH 143 543 106 HOH HOH A . F 5 HOH 144 544 36 HOH HOH A . F 5 HOH 145 545 85 HOH HOH A . F 5 HOH 146 546 41 HOH HOH A . F 5 HOH 147 547 105 HOH HOH A . F 5 HOH 148 548 60 HOH HOH A . F 5 HOH 149 549 97 HOH HOH A . F 5 HOH 150 550 147 HOH HOH A . F 5 HOH 151 551 98 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-03-11 2 'Structure model' 1 1 2020-04-08 3 'Structure model' 1 2 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -21.8684 8.0792 0.8573 0.1211 ? 0.0262 ? -0.0234 ? 0.1304 ? 0.0007 ? 0.1263 ? 1.5744 ? -1.7470 ? -1.8532 ? 3.9833 ? 4.5254 ? 5.5350 ? -0.0048 ? -0.0035 ? -0.0797 ? -0.1985 ? -0.2182 ? 0.1782 ? -0.2512 ? -0.2197 ? 0.2495 ? 2 'X-RAY DIFFRACTION' ? refined -11.1276 -10.8982 0.3738 0.1130 ? -0.0084 ? -0.0120 ? 0.1294 ? -0.0077 ? 0.1170 ? 4.5622 ? -3.0101 ? 1.2225 ? 3.7777 ? -1.7065 ? 0.6778 ? 0.0656 ? -0.0860 ? -0.2963 ? -0.0949 ? 0.0783 ? 0.1745 ? 0.0765 ? -0.0450 ? -0.1207 ? 3 'X-RAY DIFFRACTION' ? refined -12.9321 -0.5356 6.1280 0.1228 ? 0.0126 ? -0.0231 ? 0.1533 ? 0.0228 ? 0.0823 ? 1.2284 ? -1.4999 ? -1.2472 ? 4.4480 ? 1.8998 ? 2.2286 ? -0.1390 ? -0.2268 ? 0.1109 ? 0.2020 ? 0.1196 ? -0.0149 ? 0.1504 ? 0.0334 ? 0.0171 ? 4 'X-RAY DIFFRACTION' ? refined -9.5539 3.7666 2.0092 0.0649 ? -0.0137 ? -0.0153 ? 0.1188 ? 0.0091 ? 0.0873 ? 2.4571 ? -1.8232 ? -0.2701 ? 2.9117 ? -0.3053 ? 0.6891 ? 0.0109 ? -0.1090 ? 0.1808 ? 0.0246 ? 0.0338 ? -0.2047 ? -0.1266 ? -0.0079 ? -0.0568 ? 5 'X-RAY DIFFRACTION' ? refined -4.4870 -11.6713 -10.8842 0.2541 ? 0.0890 ? 0.0436 ? 0.2093 ? -0.0228 ? 0.1399 ? 5.2979 ? 1.0139 ? -2.8921 ? 5.1270 ? 3.0823 ? 4.5204 ? 0.0787 ? 0.5627 ? -0.7839 ? -0.6532 ? 0.2285 ? -0.6222 ? 0.8524 ? 0.5975 ? 0.0488 ? 6 'X-RAY DIFFRACTION' ? refined -12.0124 3.0739 -9.8570 0.1441 ? 0.0127 ? -0.0065 ? 0.1592 ? 0.0171 ? 0.1061 ? 2.9281 ? -2.0982 ? -1.1744 ? 2.3177 ? 1.9302 ? 2.9114 ? 0.1590 ? 0.2996 ? 0.1976 ? -0.3866 ? -0.2076 ? -0.0806 ? -0.1962 ? -0.1590 ? 0.0643 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 137 ? ? A 155 ? ;chain 'A' and (resid 137 through 155 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 156 ? ? A 176 ? ;chain 'A' and (resid 156 through 176 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 177 ? ? A 191 ? ;chain 'A' and (resid 177 through 191 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 192 ? ? A 215 ? ;chain 'A' and (resid 192 through 215 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 216 ? ? A 220 ? ;chain 'A' and (resid 216 through 220 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 221 ? ? A 240 ? ;chain 'A' and (resid 221 through 240 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14-3260_3260 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 6UZF _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 128 ? A SER 1 2 1 Y 1 A MET 129 ? A MET 2 3 1 Y 1 A LEU 130 ? A LEU 3 4 1 Y 1 A LYS 131 ? A LYS 4 5 1 Y 1 A LEU 132 ? A LEU 5 6 1 Y 1 A SER 133 ? A SER 6 7 1 Y 1 A ALA 134 ? A ALA 7 8 1 Y 1 A GLU 135 ? A GLU 8 9 1 Y 1 A ASN 136 ? A ASN 9 10 1 Y 1 A ARG 241 ? A ARG 114 11 1 Y 1 A LEU 242 ? A LEU 115 12 1 Y 1 A LEU 243 ? A LEU 116 13 1 Y 1 A ALA 244 ? A ALA 117 14 1 Y 1 A LEU 245 ? A LEU 118 15 1 Y 1 A LYS 246 ? A LYS 119 16 1 Y 1 A ARG 247 ? A ARG 120 17 1 Y 1 A SER 248 ? A SER 121 18 1 Y 1 A MET 249 ? A MET 122 19 1 Y 1 A SER 250 ? A SER 123 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DMS S S N N 88 DMS O O N N 89 DMS C1 C N N 90 DMS C2 C N N 91 DMS H11 H N N 92 DMS H12 H N N 93 DMS H13 H N N 94 DMS H21 H N N 95 DMS H22 H N N 96 DMS H23 H N N 97 EDO C1 C N N 98 EDO O1 O N N 99 EDO C2 C N N 100 EDO O2 O N N 101 EDO H11 H N N 102 EDO H12 H N N 103 EDO HO1 H N N 104 EDO H21 H N N 105 EDO H22 H N N 106 EDO HO2 H N N 107 GLN N N N N 108 GLN CA C N S 109 GLN C C N N 110 GLN O O N N 111 GLN CB C N N 112 GLN CG C N N 113 GLN CD C N N 114 GLN OE1 O N N 115 GLN NE2 N N N 116 GLN OXT O N N 117 GLN H H N N 118 GLN H2 H N N 119 GLN HA H N N 120 GLN HB2 H N N 121 GLN HB3 H N N 122 GLN HG2 H N N 123 GLN HG3 H N N 124 GLN HE21 H N N 125 GLN HE22 H N N 126 GLN HXT H N N 127 GLU N N N N 128 GLU CA C N S 129 GLU C C N N 130 GLU O O N N 131 GLU CB C N N 132 GLU CG C N N 133 GLU CD C N N 134 GLU OE1 O N N 135 GLU OE2 O N N 136 GLU OXT O N N 137 GLU H H N N 138 GLU H2 H N N 139 GLU HA H N N 140 GLU HB2 H N N 141 GLU HB3 H N N 142 GLU HG2 H N N 143 GLU HG3 H N N 144 GLU HE2 H N N 145 GLU HXT H N N 146 GLY N N N N 147 GLY CA C N N 148 GLY C C N N 149 GLY O O N N 150 GLY OXT O N N 151 GLY H H N N 152 GLY H2 H N N 153 GLY HA2 H N N 154 GLY HA3 H N N 155 GLY HXT H N N 156 HIS N N N N 157 HIS CA C N S 158 HIS C C N N 159 HIS O O N N 160 HIS CB C N N 161 HIS CG C Y N 162 HIS ND1 N Y N 163 HIS CD2 C Y N 164 HIS CE1 C Y N 165 HIS NE2 N Y N 166 HIS OXT O N N 167 HIS H H N N 168 HIS H2 H N N 169 HIS HA H N N 170 HIS HB2 H N N 171 HIS HB3 H N N 172 HIS HD1 H N N 173 HIS HD2 H N N 174 HIS HE1 H N N 175 HIS HE2 H N N 176 HIS HXT H N N 177 HOH O O N N 178 HOH H1 H N N 179 HOH H2 H N N 180 ILE N N N N 181 ILE CA C N S 182 ILE C C N N 183 ILE O O N N 184 ILE CB C N S 185 ILE CG1 C N N 186 ILE CG2 C N N 187 ILE CD1 C N N 188 ILE OXT O N N 189 ILE H H N N 190 ILE H2 H N N 191 ILE HA H N N 192 ILE HB H N N 193 ILE HG12 H N N 194 ILE HG13 H N N 195 ILE HG21 H N N 196 ILE HG22 H N N 197 ILE HG23 H N N 198 ILE HD11 H N N 199 ILE HD12 H N N 200 ILE HD13 H N N 201 ILE HXT H N N 202 LEU N N N N 203 LEU CA C N S 204 LEU C C N N 205 LEU O O N N 206 LEU CB C N N 207 LEU CG C N N 208 LEU CD1 C N N 209 LEU CD2 C N N 210 LEU OXT O N N 211 LEU H H N N 212 LEU H2 H N N 213 LEU HA H N N 214 LEU HB2 H N N 215 LEU HB3 H N N 216 LEU HG H N N 217 LEU HD11 H N N 218 LEU HD12 H N N 219 LEU HD13 H N N 220 LEU HD21 H N N 221 LEU HD22 H N N 222 LEU HD23 H N N 223 LEU HXT H N N 224 LYS N N N N 225 LYS CA C N S 226 LYS C C N N 227 LYS O O N N 228 LYS CB C N N 229 LYS CG C N N 230 LYS CD C N N 231 LYS CE C N N 232 LYS NZ N N N 233 LYS OXT O N N 234 LYS H H N N 235 LYS H2 H N N 236 LYS HA H N N 237 LYS HB2 H N N 238 LYS HB3 H N N 239 LYS HG2 H N N 240 LYS HG3 H N N 241 LYS HD2 H N N 242 LYS HD3 H N N 243 LYS HE2 H N N 244 LYS HE3 H N N 245 LYS HZ1 H N N 246 LYS HZ2 H N N 247 LYS HZ3 H N N 248 LYS HXT H N N 249 MET N N N N 250 MET CA C N S 251 MET C C N N 252 MET O O N N 253 MET CB C N N 254 MET CG C N N 255 MET SD S N N 256 MET CE C N N 257 MET OXT O N N 258 MET H H N N 259 MET H2 H N N 260 MET HA H N N 261 MET HB2 H N N 262 MET HB3 H N N 263 MET HG2 H N N 264 MET HG3 H N N 265 MET HE1 H N N 266 MET HE2 H N N 267 MET HE3 H N N 268 MET HXT H N N 269 PHE N N N N 270 PHE CA C N S 271 PHE C C N N 272 PHE O O N N 273 PHE CB C N N 274 PHE CG C Y N 275 PHE CD1 C Y N 276 PHE CD2 C Y N 277 PHE CE1 C Y N 278 PHE CE2 C Y N 279 PHE CZ C Y N 280 PHE OXT O N N 281 PHE H H N N 282 PHE H2 H N N 283 PHE HA H N N 284 PHE HB2 H N N 285 PHE HB3 H N N 286 PHE HD1 H N N 287 PHE HD2 H N N 288 PHE HE1 H N N 289 PHE HE2 H N N 290 PHE HZ H N N 291 PHE HXT H N N 292 PRO N N N N 293 PRO CA C N S 294 PRO C C N N 295 PRO O O N N 296 PRO CB C N N 297 PRO CG C N N 298 PRO CD C N N 299 PRO OXT O N N 300 PRO H H N N 301 PRO HA H N N 302 PRO HB2 H N N 303 PRO HB3 H N N 304 PRO HG2 H N N 305 PRO HG3 H N N 306 PRO HD2 H N N 307 PRO HD3 H N N 308 PRO HXT H N N 309 SER N N N N 310 SER CA C N S 311 SER C C N N 312 SER O O N N 313 SER CB C N N 314 SER OG O N N 315 SER OXT O N N 316 SER H H N N 317 SER H2 H N N 318 SER HA H N N 319 SER HB2 H N N 320 SER HB3 H N N 321 SER HG H N N 322 SER HXT H N N 323 SO4 S S N N 324 SO4 O1 O N N 325 SO4 O2 O N N 326 SO4 O3 O N N 327 SO4 O4 O N N 328 THR N N N N 329 THR CA C N S 330 THR C C N N 331 THR O O N N 332 THR CB C N R 333 THR OG1 O N N 334 THR CG2 C N N 335 THR OXT O N N 336 THR H H N N 337 THR H2 H N N 338 THR HA H N N 339 THR HB H N N 340 THR HG1 H N N 341 THR HG21 H N N 342 THR HG22 H N N 343 THR HG23 H N N 344 THR HXT H N N 345 TYR N N N N 346 TYR CA C N S 347 TYR C C N N 348 TYR O O N N 349 TYR CB C N N 350 TYR CG C Y N 351 TYR CD1 C Y N 352 TYR CD2 C Y N 353 TYR CE1 C Y N 354 TYR CE2 C Y N 355 TYR CZ C Y N 356 TYR OH O N N 357 TYR OXT O N N 358 TYR H H N N 359 TYR H2 H N N 360 TYR HA H N N 361 TYR HB2 H N N 362 TYR HB3 H N N 363 TYR HD1 H N N 364 TYR HD2 H N N 365 TYR HE1 H N N 366 TYR HE2 H N N 367 TYR HH H N N 368 TYR HXT H N N 369 VAL N N N N 370 VAL CA C N S 371 VAL C C N N 372 VAL O O N N 373 VAL CB C N N 374 VAL CG1 C N N 375 VAL CG2 C N N 376 VAL OXT O N N 377 VAL H H N N 378 VAL H2 H N N 379 VAL HA H N N 380 VAL HB H N N 381 VAL HG11 H N N 382 VAL HG12 H N N 383 VAL HG13 H N N 384 VAL HG21 H N N 385 VAL HG22 H N N 386 VAL HG23 H N N 387 VAL HXT H N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DMS S O doub N N 83 DMS S C1 sing N N 84 DMS S C2 sing N N 85 DMS C1 H11 sing N N 86 DMS C1 H12 sing N N 87 DMS C1 H13 sing N N 88 DMS C2 H21 sing N N 89 DMS C2 H22 sing N N 90 DMS C2 H23 sing N N 91 EDO C1 O1 sing N N 92 EDO C1 C2 sing N N 93 EDO C1 H11 sing N N 94 EDO C1 H12 sing N N 95 EDO O1 HO1 sing N N 96 EDO C2 O2 sing N N 97 EDO C2 H21 sing N N 98 EDO C2 H22 sing N N 99 EDO O2 HO2 sing N N 100 GLN N CA sing N N 101 GLN N H sing N N 102 GLN N H2 sing N N 103 GLN CA C sing N N 104 GLN CA CB sing N N 105 GLN CA HA sing N N 106 GLN C O doub N N 107 GLN C OXT sing N N 108 GLN CB CG sing N N 109 GLN CB HB2 sing N N 110 GLN CB HB3 sing N N 111 GLN CG CD sing N N 112 GLN CG HG2 sing N N 113 GLN CG HG3 sing N N 114 GLN CD OE1 doub N N 115 GLN CD NE2 sing N N 116 GLN NE2 HE21 sing N N 117 GLN NE2 HE22 sing N N 118 GLN OXT HXT sing N N 119 GLU N CA sing N N 120 GLU N H sing N N 121 GLU N H2 sing N N 122 GLU CA C sing N N 123 GLU CA CB sing N N 124 GLU CA HA sing N N 125 GLU C O doub N N 126 GLU C OXT sing N N 127 GLU CB CG sing N N 128 GLU CB HB2 sing N N 129 GLU CB HB3 sing N N 130 GLU CG CD sing N N 131 GLU CG HG2 sing N N 132 GLU CG HG3 sing N N 133 GLU CD OE1 doub N N 134 GLU CD OE2 sing N N 135 GLU OE2 HE2 sing N N 136 GLU OXT HXT sing N N 137 GLY N CA sing N N 138 GLY N H sing N N 139 GLY N H2 sing N N 140 GLY CA C sing N N 141 GLY CA HA2 sing N N 142 GLY CA HA3 sing N N 143 GLY C O doub N N 144 GLY C OXT sing N N 145 GLY OXT HXT sing N N 146 HIS N CA sing N N 147 HIS N H sing N N 148 HIS N H2 sing N N 149 HIS CA C sing N N 150 HIS CA CB sing N N 151 HIS CA HA sing N N 152 HIS C O doub N N 153 HIS C OXT sing N N 154 HIS CB CG sing N N 155 HIS CB HB2 sing N N 156 HIS CB HB3 sing N N 157 HIS CG ND1 sing Y N 158 HIS CG CD2 doub Y N 159 HIS ND1 CE1 doub Y N 160 HIS ND1 HD1 sing N N 161 HIS CD2 NE2 sing Y N 162 HIS CD2 HD2 sing N N 163 HIS CE1 NE2 sing Y N 164 HIS CE1 HE1 sing N N 165 HIS NE2 HE2 sing N N 166 HIS OXT HXT sing N N 167 HOH O H1 sing N N 168 HOH O H2 sing N N 169 ILE N CA sing N N 170 ILE N H sing N N 171 ILE N H2 sing N N 172 ILE CA C sing N N 173 ILE CA CB sing N N 174 ILE CA HA sing N N 175 ILE C O doub N N 176 ILE C OXT sing N N 177 ILE CB CG1 sing N N 178 ILE CB CG2 sing N N 179 ILE CB HB sing N N 180 ILE CG1 CD1 sing N N 181 ILE CG1 HG12 sing N N 182 ILE CG1 HG13 sing N N 183 ILE CG2 HG21 sing N N 184 ILE CG2 HG22 sing N N 185 ILE CG2 HG23 sing N N 186 ILE CD1 HD11 sing N N 187 ILE CD1 HD12 sing N N 188 ILE CD1 HD13 sing N N 189 ILE OXT HXT sing N N 190 LEU N CA sing N N 191 LEU N H sing N N 192 LEU N H2 sing N N 193 LEU CA C sing N N 194 LEU CA CB sing N N 195 LEU CA HA sing N N 196 LEU C O doub N N 197 LEU C OXT sing N N 198 LEU CB CG sing N N 199 LEU CB HB2 sing N N 200 LEU CB HB3 sing N N 201 LEU CG CD1 sing N N 202 LEU CG CD2 sing N N 203 LEU CG HG sing N N 204 LEU CD1 HD11 sing N N 205 LEU CD1 HD12 sing N N 206 LEU CD1 HD13 sing N N 207 LEU CD2 HD21 sing N N 208 LEU CD2 HD22 sing N N 209 LEU CD2 HD23 sing N N 210 LEU OXT HXT sing N N 211 LYS N CA sing N N 212 LYS N H sing N N 213 LYS N H2 sing N N 214 LYS CA C sing N N 215 LYS CA CB sing N N 216 LYS CA HA sing N N 217 LYS C O doub N N 218 LYS C OXT sing N N 219 LYS CB CG sing N N 220 LYS CB HB2 sing N N 221 LYS CB HB3 sing N N 222 LYS CG CD sing N N 223 LYS CG HG2 sing N N 224 LYS CG HG3 sing N N 225 LYS CD CE sing N N 226 LYS CD HD2 sing N N 227 LYS CD HD3 sing N N 228 LYS CE NZ sing N N 229 LYS CE HE2 sing N N 230 LYS CE HE3 sing N N 231 LYS NZ HZ1 sing N N 232 LYS NZ HZ2 sing N N 233 LYS NZ HZ3 sing N N 234 LYS OXT HXT sing N N 235 MET N CA sing N N 236 MET N H sing N N 237 MET N H2 sing N N 238 MET CA C sing N N 239 MET CA CB sing N N 240 MET CA HA sing N N 241 MET C O doub N N 242 MET C OXT sing N N 243 MET CB CG sing N N 244 MET CB HB2 sing N N 245 MET CB HB3 sing N N 246 MET CG SD sing N N 247 MET CG HG2 sing N N 248 MET CG HG3 sing N N 249 MET SD CE sing N N 250 MET CE HE1 sing N N 251 MET CE HE2 sing N N 252 MET CE HE3 sing N N 253 MET OXT HXT sing N N 254 PHE N CA sing N N 255 PHE N H sing N N 256 PHE N H2 sing N N 257 PHE CA C sing N N 258 PHE CA CB sing N N 259 PHE CA HA sing N N 260 PHE C O doub N N 261 PHE C OXT sing N N 262 PHE CB CG sing N N 263 PHE CB HB2 sing N N 264 PHE CB HB3 sing N N 265 PHE CG CD1 doub Y N 266 PHE CG CD2 sing Y N 267 PHE CD1 CE1 sing Y N 268 PHE CD1 HD1 sing N N 269 PHE CD2 CE2 doub Y N 270 PHE CD2 HD2 sing N N 271 PHE CE1 CZ doub Y N 272 PHE CE1 HE1 sing N N 273 PHE CE2 CZ sing Y N 274 PHE CE2 HE2 sing N N 275 PHE CZ HZ sing N N 276 PHE OXT HXT sing N N 277 PRO N CA sing N N 278 PRO N CD sing N N 279 PRO N H sing N N 280 PRO CA C sing N N 281 PRO CA CB sing N N 282 PRO CA HA sing N N 283 PRO C O doub N N 284 PRO C OXT sing N N 285 PRO CB CG sing N N 286 PRO CB HB2 sing N N 287 PRO CB HB3 sing N N 288 PRO CG CD sing N N 289 PRO CG HG2 sing N N 290 PRO CG HG3 sing N N 291 PRO CD HD2 sing N N 292 PRO CD HD3 sing N N 293 PRO OXT HXT sing N N 294 SER N CA sing N N 295 SER N H sing N N 296 SER N H2 sing N N 297 SER CA C sing N N 298 SER CA CB sing N N 299 SER CA HA sing N N 300 SER C O doub N N 301 SER C OXT sing N N 302 SER CB OG sing N N 303 SER CB HB2 sing N N 304 SER CB HB3 sing N N 305 SER OG HG sing N N 306 SER OXT HXT sing N N 307 SO4 S O1 doub N N 308 SO4 S O2 doub N N 309 SO4 S O3 sing N N 310 SO4 S O4 sing N N 311 THR N CA sing N N 312 THR N H sing N N 313 THR N H2 sing N N 314 THR CA C sing N N 315 THR CA CB sing N N 316 THR CA HA sing N N 317 THR C O doub N N 318 THR C OXT sing N N 319 THR CB OG1 sing N N 320 THR CB CG2 sing N N 321 THR CB HB sing N N 322 THR OG1 HG1 sing N N 323 THR CG2 HG21 sing N N 324 THR CG2 HG22 sing N N 325 THR CG2 HG23 sing N N 326 THR OXT HXT sing N N 327 TYR N CA sing N N 328 TYR N H sing N N 329 TYR N H2 sing N N 330 TYR CA C sing N N 331 TYR CA CB sing N N 332 TYR CA HA sing N N 333 TYR C O doub N N 334 TYR C OXT sing N N 335 TYR CB CG sing N N 336 TYR CB HB2 sing N N 337 TYR CB HB3 sing N N 338 TYR CG CD1 doub Y N 339 TYR CG CD2 sing Y N 340 TYR CD1 CE1 sing Y N 341 TYR CD1 HD1 sing N N 342 TYR CD2 CE2 doub Y N 343 TYR CD2 HD2 sing N N 344 TYR CE1 CZ doub Y N 345 TYR CE1 HE1 sing N N 346 TYR CE2 CZ sing Y N 347 TYR CE2 HE2 sing N N 348 TYR CZ OH sing N N 349 TYR OH HH sing N N 350 TYR OXT HXT sing N N 351 VAL N CA sing N N 352 VAL N H sing N N 353 VAL N H2 sing N N 354 VAL CA C sing N N 355 VAL CA CB sing N N 356 VAL CA HA sing N N 357 VAL C O doub N N 358 VAL C OXT sing N N 359 VAL CB CG1 sing N N 360 VAL CB CG2 sing N N 361 VAL CB HB sing N N 362 VAL CG1 HG11 sing N N 363 VAL CG1 HG12 sing N N 364 VAL CG1 HG13 sing N N 365 VAL CG2 HG21 sing N N 366 VAL CG2 HG22 sing N N 367 VAL CG2 HG23 sing N N 368 VAL OXT HXT sing N N 369 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 1,2-ETHANEDIOL EDO 4 'DIMETHYL SULFOXIDE' DMS 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3HME _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #