data_6VJI # _entry.id 6VJI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.337 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6VJI WWPDB D_1000246385 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6VJI _pdbx_database_status.recvd_initial_deposition_date 2020-01-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Eckenroth, B.E.' 1 ? 'Doublie, S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 0969-2126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 29 _citation.page_last 42.e4 _citation.title 'Unique Structural Features of Mammalian NEIL2 DNA Glycosylase Prime Its Activity for Diverse DNA Substrates and Environments.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2020.08.001 _citation.pdbx_database_id_PubMed 32846144 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Eckenroth, B.E.' 1 ? primary 'Cao, V.B.' 2 ? primary 'Averill, A.M.' 3 ? primary 'Dragon, J.A.' 4 ? primary 'Doublie, S.' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6VJI _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.887 _cell.length_a_esd ? _cell.length_b 67.887 _cell.length_b_esd ? _cell.length_c 149.130 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6VJI _symmetry.cell_setting ? _symmetry.Int_Tables_number 145 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nei like DNA glycosylase 2' 39433.578 2 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 water nat water 18.015 6 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)PEGPSLRKFHQLVAPFVGQLVVTVGGNSKKINPN(MSE)LE(MSE)LRLQDSQVHGKNLYLNFGLTEDLGLPESF LLPKHLQKKVRLPKEKSDHKLETTSRLDGQEVPGSSLAIKALELGEEEKETV(MSE)PWWLNTSQNSGLWLCFHFGLFGS VRASELSRATKANKRGDWKDPIPRLVLHFAKGFLAFYNCRIYWCLGPTVKPTSDILSEEFDRRQALEALKQASPVSYTLL DQRYFAGLGNIIKNEVLYLARIHPLSLGSCLTPLNLESLLDHVVSFSVGWLQKKLEGKPLHHLIYQKEQCPAGHQV (MSE)KDSFGPPGSFQRLTWWCPHCQPKAEEKVEVTQEQLLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MPEGPSLRKFHQLVAPFVGQLVVTVGGNSKKINPNMLEMLRLQDSQVHGKNLYLNFGLTEDLGLPESFLLPKHLQKKVRL PKEKSDHKLETTSRLDGQEVPGSSLAIKALELGEEEKETVMPWWLNTSQNSGLWLCFHFGLFGSVRASELSRATKANKRG DWKDPIPRLVLHFAKGFLAFYNCRIYWCLGPTVKPTSDILSEEFDRRQALEALKQASPVSYTLLDQRYFAGLGNIIKNEV LYLARIHPLSLGSCLTPLNLESLLDHVVSFSVGWLQKKLEGKPLHHLIYQKEQCPAGHQVMKDSFGPPGSFQRLTWWCPH CQPKAEEKVEVTQEQLLEHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 PRO n 1 3 GLU n 1 4 GLY n 1 5 PRO n 1 6 SER n 1 7 LEU n 1 8 ARG n 1 9 LYS n 1 10 PHE n 1 11 HIS n 1 12 GLN n 1 13 LEU n 1 14 VAL n 1 15 ALA n 1 16 PRO n 1 17 PHE n 1 18 VAL n 1 19 GLY n 1 20 GLN n 1 21 LEU n 1 22 VAL n 1 23 VAL n 1 24 THR n 1 25 VAL n 1 26 GLY n 1 27 GLY n 1 28 ASN n 1 29 SER n 1 30 LYS n 1 31 LYS n 1 32 ILE n 1 33 ASN n 1 34 PRO n 1 35 ASN n 1 36 MSE n 1 37 LEU n 1 38 GLU n 1 39 MSE n 1 40 LEU n 1 41 ARG n 1 42 LEU n 1 43 GLN n 1 44 ASP n 1 45 SER n 1 46 GLN n 1 47 VAL n 1 48 HIS n 1 49 GLY n 1 50 LYS n 1 51 ASN n 1 52 LEU n 1 53 TYR n 1 54 LEU n 1 55 ASN n 1 56 PHE n 1 57 GLY n 1 58 LEU n 1 59 THR n 1 60 GLU n 1 61 ASP n 1 62 LEU n 1 63 GLY n 1 64 LEU n 1 65 PRO n 1 66 GLU n 1 67 SER n 1 68 PHE n 1 69 LEU n 1 70 LEU n 1 71 PRO n 1 72 LYS n 1 73 HIS n 1 74 LEU n 1 75 GLN n 1 76 LYS n 1 77 LYS n 1 78 VAL n 1 79 ARG n 1 80 LEU n 1 81 PRO n 1 82 LYS n 1 83 GLU n 1 84 LYS n 1 85 SER n 1 86 ASP n 1 87 HIS n 1 88 LYS n 1 89 LEU n 1 90 GLU n 1 91 THR n 1 92 THR n 1 93 SER n 1 94 ARG n 1 95 LEU n 1 96 ASP n 1 97 GLY n 1 98 GLN n 1 99 GLU n 1 100 VAL n 1 101 PRO n 1 102 GLY n 1 103 SER n 1 104 SER n 1 105 LEU n 1 106 ALA n 1 107 ILE n 1 108 LYS n 1 109 ALA n 1 110 LEU n 1 111 GLU n 1 112 LEU n 1 113 GLY n 1 114 GLU n 1 115 GLU n 1 116 GLU n 1 117 LYS n 1 118 GLU n 1 119 THR n 1 120 VAL n 1 121 MSE n 1 122 PRO n 1 123 TRP n 1 124 TRP n 1 125 LEU n 1 126 ASN n 1 127 THR n 1 128 SER n 1 129 GLN n 1 130 ASN n 1 131 SER n 1 132 GLY n 1 133 LEU n 1 134 TRP n 1 135 LEU n 1 136 CYS n 1 137 PHE n 1 138 HIS n 1 139 PHE n 1 140 GLY n 1 141 LEU n 1 142 PHE n 1 143 GLY n 1 144 SER n 1 145 VAL n 1 146 ARG n 1 147 ALA n 1 148 SER n 1 149 GLU n 1 150 LEU n 1 151 SER n 1 152 ARG n 1 153 ALA n 1 154 THR n 1 155 LYS n 1 156 ALA n 1 157 ASN n 1 158 LYS n 1 159 ARG n 1 160 GLY n 1 161 ASP n 1 162 TRP n 1 163 LYS n 1 164 ASP n 1 165 PRO n 1 166 ILE n 1 167 PRO n 1 168 ARG n 1 169 LEU n 1 170 VAL n 1 171 LEU n 1 172 HIS n 1 173 PHE n 1 174 ALA n 1 175 LYS n 1 176 GLY n 1 177 PHE n 1 178 LEU n 1 179 ALA n 1 180 PHE n 1 181 TYR n 1 182 ASN n 1 183 CYS n 1 184 ARG n 1 185 ILE n 1 186 TYR n 1 187 TRP n 1 188 CYS n 1 189 LEU n 1 190 GLY n 1 191 PRO n 1 192 THR n 1 193 VAL n 1 194 LYS n 1 195 PRO n 1 196 THR n 1 197 SER n 1 198 ASP n 1 199 ILE n 1 200 LEU n 1 201 SER n 1 202 GLU n 1 203 GLU n 1 204 PHE n 1 205 ASP n 1 206 ARG n 1 207 ARG n 1 208 GLN n 1 209 ALA n 1 210 LEU n 1 211 GLU n 1 212 ALA n 1 213 LEU n 1 214 LYS n 1 215 GLN n 1 216 ALA n 1 217 SER n 1 218 PRO n 1 219 VAL n 1 220 SER n 1 221 TYR n 1 222 THR n 1 223 LEU n 1 224 LEU n 1 225 ASP n 1 226 GLN n 1 227 ARG n 1 228 TYR n 1 229 PHE n 1 230 ALA n 1 231 GLY n 1 232 LEU n 1 233 GLY n 1 234 ASN n 1 235 ILE n 1 236 ILE n 1 237 LYS n 1 238 ASN n 1 239 GLU n 1 240 VAL n 1 241 LEU n 1 242 TYR n 1 243 LEU n 1 244 ALA n 1 245 ARG n 1 246 ILE n 1 247 HIS n 1 248 PRO n 1 249 LEU n 1 250 SER n 1 251 LEU n 1 252 GLY n 1 253 SER n 1 254 CYS n 1 255 LEU n 1 256 THR n 1 257 PRO n 1 258 LEU n 1 259 ASN n 1 260 LEU n 1 261 GLU n 1 262 SER n 1 263 LEU n 1 264 LEU n 1 265 ASP n 1 266 HIS n 1 267 VAL n 1 268 VAL n 1 269 SER n 1 270 PHE n 1 271 SER n 1 272 VAL n 1 273 GLY n 1 274 TRP n 1 275 LEU n 1 276 GLN n 1 277 LYS n 1 278 LYS n 1 279 LEU n 1 280 GLU n 1 281 GLY n 1 282 LYS n 1 283 PRO n 1 284 LEU n 1 285 HIS n 1 286 HIS n 1 287 LEU n 1 288 ILE n 1 289 TYR n 1 290 GLN n 1 291 LYS n 1 292 GLU n 1 293 GLN n 1 294 CYS n 1 295 PRO n 1 296 ALA n 1 297 GLY n 1 298 HIS n 1 299 GLN n 1 300 VAL n 1 301 MSE n 1 302 LYS n 1 303 ASP n 1 304 SER n 1 305 PHE n 1 306 GLY n 1 307 PRO n 1 308 PRO n 1 309 GLY n 1 310 SER n 1 311 PHE n 1 312 GLN n 1 313 ARG n 1 314 LEU n 1 315 THR n 1 316 TRP n 1 317 TRP n 1 318 CYS n 1 319 PRO n 1 320 HIS n 1 321 CYS n 1 322 GLN n 1 323 PRO n 1 324 LYS n 1 325 ALA n 1 326 GLU n 1 327 GLU n 1 328 LYS n 1 329 VAL n 1 330 GLU n 1 331 VAL n 1 332 THR n 1 333 GLN n 1 334 GLU n 1 335 GLN n 1 336 LEU n 1 337 LEU n 1 338 GLU n 1 339 HIS n 1 340 HIS n 1 341 HIS n 1 342 HIS n 1 343 HIS n 1 344 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 344 _entity_src_gen.gene_src_common_name 'Gray short-tailed opossum' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene NEIL2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Monodelphis domestica' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 13616 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET30 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code F7AMK3_MONDO _struct_ref.pdbx_db_accession F7AMK3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPEGPSLRKFHQLVAPFVGQLVVTVGGNSKKINPNMLEMLRLQDSQVHGKNLYLNFGLTEDLGLPESFLLPKHLQKKVRL PKEKSDHKLETTSRLDGQEVPGSSLAIKALELGEEEKETVMPWWLNTSQNSGLWLCFHFGLFGSVRASELSRATKANKRG DWKDPIPRLVLHFAKGFLAFYNCRIYWCLGPTVKPTSDILSEEFDRRQALEALKQASPVSYTLLDQRYFAGLGNIIKNEV LYLARIHPLSLGSCLTPLNLESLLDHVVSFSVGWLQKKLEGKPLHHLIYQKEQCPAGHQVMKDSFGPPGSFQRLTWWCPH CQPKAEEKVEVTQEQL ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6VJI A 1 ? 336 ? F7AMK3 1 ? 336 ? 1 336 2 1 6VJI B 1 ? 336 ? F7AMK3 1 ? 336 ? 1 336 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6VJI LEU A 337 ? UNP F7AMK3 ? ? 'expression tag' 337 1 1 6VJI GLU A 338 ? UNP F7AMK3 ? ? 'expression tag' 338 2 1 6VJI HIS A 339 ? UNP F7AMK3 ? ? 'expression tag' 339 3 1 6VJI HIS A 340 ? UNP F7AMK3 ? ? 'expression tag' 340 4 1 6VJI HIS A 341 ? UNP F7AMK3 ? ? 'expression tag' 341 5 1 6VJI HIS A 342 ? UNP F7AMK3 ? ? 'expression tag' 342 6 1 6VJI HIS A 343 ? UNP F7AMK3 ? ? 'expression tag' 343 7 1 6VJI HIS A 344 ? UNP F7AMK3 ? ? 'expression tag' 344 8 2 6VJI LEU B 337 ? UNP F7AMK3 ? ? 'expression tag' 337 9 2 6VJI GLU B 338 ? UNP F7AMK3 ? ? 'expression tag' 338 10 2 6VJI HIS B 339 ? UNP F7AMK3 ? ? 'expression tag' 339 11 2 6VJI HIS B 340 ? UNP F7AMK3 ? ? 'expression tag' 340 12 2 6VJI HIS B 341 ? UNP F7AMK3 ? ? 'expression tag' 341 13 2 6VJI HIS B 342 ? UNP F7AMK3 ? ? 'expression tag' 342 14 2 6VJI HIS B 343 ? UNP F7AMK3 ? ? 'expression tag' 343 15 2 6VJI HIS B 344 ? UNP F7AMK3 ? ? 'expression tag' 344 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6VJI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.60 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.73 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;40 mM hepes pH 7.5, 50 mM sodium succinate, 1% propylene glycol, 1 mM TCEP, 14% PEG 3350 and cryoprotected with increase to 20% PEG 3350 and 30% glucose ; _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt _diffrn.pdbx_serial_crystal_experiment ? 100 ? ? 1 ? ? ? 1 ? ? ? ? ? ? N ? 100 ? ? 1 ? ? ? 3 ? ? ? ? ? ? N ? 100 ? ? 1 ? ? ? 4 ? ? ? ? ? ? N ? 100 ? ? 1 ? ? ? 6 ? ? ? ? ? ? N ? 100 ? ? 1 ? ? ? 2 ? ? ? ? ? ? N ? 100 ? ? 1 ? ? ? 5 ? ? ? ? ? ? N # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date _diffrn_detector.pdbx_frequency mirrors CCD 1 'MARMOSAIC 300 mm CCD' ? ? ? ? 2014-07-03 ? mirrors CCD 3 'MARMOSAIC 300 mm CCD' ? ? ? ? 2015-02-11 ? mirrors CCD 4 'MARMOSAIC 300 mm CCD' ? ? ? ? 2015-10-16 ? mirrors PIXEL 6 'DECTRIS PILATUS3 6M' ? ? ? ? 2016-06-30 ? mirrors CCD 2 'MARMOSAIC 300 mm CCD' ? ? ? ? 2015-02-11 ? mirrors PIXEL 5 'DECTRIS PILATUS3 6M' ? ? ? ? 2016-06-30 ? # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? ? ? ? ? ? ? 1 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 3 ? ? ? ? ? ? ? ? 2 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 4 ? ? ? ? ? ? ? ? 3 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 6 ? ? ? ? ? ? ? ? 4 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 2 ? ? ? ? ? ? ? ? 5 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 5 ? ? ? ? ? ? ? ? 6 M ? ? 'SINGLE WAVELENGTH' ? x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.281 1.0 2 1.771 1.0 3 0.9794 1.0 4 0.979 1.0 5 1.039 1.0 6 1.033 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? SYNCHROTRON ? 'APS BEAMLINE 23-ID-B' ? ? 1.281 ? 23-ID-B APS ? ? 3 ? ? SYNCHROTRON ? 'APS BEAMLINE 23-ID-B' ? ? 1.771 ? 23-ID-B APS ? ? 4 ? ? SYNCHROTRON ? 'APS BEAMLINE 23-ID-B' ? ? 0.9794 ? 23-ID-B APS ? ? 6 ? ? SYNCHROTRON ? 'APS BEAMLINE 23-ID-D' ? ? 0.979 ? 23-ID-D APS ? ? 2 ? ? SYNCHROTRON ? 'APS BEAMLINE 23-ID-B' ? ? 1.039 ? 23-ID-B APS ? ? 5 ? ? SYNCHROTRON ? 'APS BEAMLINE 23-ID-D' ? ? 1.033 ? 23-ID-D APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6VJI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.539 _reflns.d_resolution_low 59.154 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 50608 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.000 _reflns.pdbx_Rmerge_I_obs 0.124 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.130 _reflns.pdbx_Rpim_I_all 0.039 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 4 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.54 2.68 ? 0.9 ? ? ? ? 3715 99.9 ? ? ? ? 3.394 ? ? ? ? ? ? ? ? 9.0 ? ? ? ? 3.761 1.213 ? 1 4 0.468 ? ? 8.03 37.96 ? 56.0 ? ? ? ? 817 99.3 ? ? ? ? 0.069 ? ? ? ? ? ? ? ? 11.1 ? ? ? ? 0.072 0.022 ? 2 4 0.996 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 181.160 _refine.B_iso_mean 98.1896 _refine.B_iso_min 49.690 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6VJI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5400 _refine.ls_d_res_low 37.9600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 50608 _refine.ls_number_reflns_R_free 4926 _refine.ls_number_reflns_R_work 45682 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8400 _refine.ls_percent_reflns_R_free 9.7300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2527 _refine.ls_R_factor_R_free 0.2749 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2503 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.920 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct MIRAS _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.3700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1,3,4,6,2,5 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5400 _refine_hist.d_res_low 37.9600 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 3805 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 508 _refine_hist.pdbx_B_iso_mean_ligand 121.37 _refine_hist.pdbx_B_iso_mean_solvent 84.16 _refine_hist.pdbx_number_atoms_protein 3797 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 965 9.034 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 965 9.034 ? 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 3 TORSIONAL ? A 150 9.034 ? 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 4 TORSIONAL ? B 150 9.034 ? 2 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 5 TORSIONAL ? A 976 9.034 ? 3 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 6 TORSIONAL ? B 976 9.034 ? 3 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5404 2.5842 . . 164 2303 99.0000 . . . 0.3873 0.0000 0.3766 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5842 2.6312 . . 288 2329 100.0000 . . . 0.3471 0.0000 0.3764 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6312 2.6818 . . 188 2338 100.0000 . . . 0.4539 0.0000 0.3881 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6818 2.7365 . . 272 2236 100.0000 . . . 0.3782 0.0000 0.3780 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7365 2.7960 . . 244 2276 100.0000 . . . 0.3993 0.0000 0.3671 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7960 2.8610 . . 228 2293 100.0000 . . . 0.3358 0.0000 0.3681 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8610 2.9325 . . 256 2292 100.0000 . . . 0.4028 0.0000 0.3485 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9325 3.0118 . . 256 2260 100.0000 . . . 0.3772 0.0000 0.3596 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0118 3.1004 . . 331 2230 100.0000 . . . 0.3729 0.0000 0.3335 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1004 3.2004 . . 260 2217 100.0000 . . . 0.3229 0.0000 0.3137 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2004 3.3147 . . 252 2264 100.0000 . . . 0.2984 0.0000 0.3059 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3147 3.4473 . . 300 2290 100.0000 . . . 0.3779 0.0000 0.2932 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4473 3.6041 . . 280 2256 100.0000 . . . 0.3133 0.0000 0.2890 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6041 3.7940 . . 186 2358 100.0000 . . . 0.3455 0.0000 0.2536 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7940 4.0314 . . 176 2339 100.0000 . . . 0.2632 0.0000 0.2505 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0314 4.3423 . . 232 2262 100.0000 . . . 0.2139 0.0000 0.2217 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.3423 4.7785 . . 252 2320 100.0000 . . . 0.2688 0.0000 0.1979 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.7785 5.4682 . . 216 2296 100.0000 . . . 0.2299 0.0000 0.2121 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.4682 6.8827 . . 296 2248 100.0000 . . . 0.2724 0.0000 0.2423 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.8827 37.96 . . 249 2275 100.0000 . . . 0.1982 0.0000 0.1968 . . . . . . . . . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 5 through 38 or resid 40 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 154 or resid 163 through 187)) ; 1 2 ;(chain B and (resid 5 through 38 or resid 40 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG )) or resid 153 through 154 or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 187)) ; 2 1 ;(chain A and (resid 188 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205)) ; 2 2 ;(chain B and (resid 188 through 193 or (resid 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 205)) ; 3 1 ;(chain A and (resid 206 through 210 or (resid 211 through 212 and (name N or name CA or name C or name O or name CB )) or resid 213 through 244 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 253 or (resid 254 and (name N or name CA or name C or name O or name CB )) or resid 255 through 284 or (resid 285 and (name N or name CA or name C or name O or name CB )) or resid 286 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )))) ; 3 2 ;(chain B and (resid 206 through 260 or (resid 261 and (name N or name CA or name C or name O or name CB )) or resid 262 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 319 or (resid 320 and (name N or name CA or name C or name O or name CB )) or resid 321 through 324)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id 1 1 1 ? A 5 A 38 ;(chain A and (resid 5 through 38 or resid 40 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 154 or resid 163 through 187)) ; ? ? ? ? ? ? ? ? 1 1 2 ? A 40 A 65 ;(chain A and (resid 5 through 38 or resid 40 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 154 or resid 163 through 187)) ; ? ? ? ? ? ? ? ? 1 1 3 ? A 66 A 66 ;(chain A and (resid 5 through 38 or resid 40 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 154 or resid 163 through 187)) ; ? ? ? ? ? ? ? ? 1 1 4 ? A 5 A 401 ;(chain A and (resid 5 through 38 or resid 40 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 154 or resid 163 through 187)) ; ? ? ? ? ? ? ? ? 1 1 5 ? A 5 A 401 ;(chain A and (resid 5 through 38 or resid 40 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 154 or resid 163 through 187)) ; ? ? ? ? ? ? ? ? 1 1 6 ? A 5 A 401 ;(chain A and (resid 5 through 38 or resid 40 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 154 or resid 163 through 187)) ; ? ? ? ? ? ? ? ? 1 1 7 ? A 5 A 401 ;(chain A and (resid 5 through 38 or resid 40 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 154 or resid 163 through 187)) ; ? ? ? ? ? ? ? ? 1 2 1 ? B 5 B 38 ;(chain B and (resid 5 through 38 or resid 40 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG )) or resid 153 through 154 or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 187)) ; ? ? ? ? ? ? ? ? 1 2 2 ? B 40 B 68 ;(chain B and (resid 5 through 38 or resid 40 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG )) or resid 153 through 154 or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 187)) ; ? ? ? ? ? ? ? ? 1 2 3 ? B 69 B 69 ;(chain B and (resid 5 through 38 or resid 40 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG )) or resid 153 through 154 or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 187)) ; ? ? ? ? ? ? ? ? 1 2 4 ? B 5 B 401 ;(chain B and (resid 5 through 38 or resid 40 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG )) or resid 153 through 154 or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 187)) ; ? ? ? ? ? ? ? ? 1 2 5 ? B 5 B 401 ;(chain B and (resid 5 through 38 or resid 40 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG )) or resid 153 through 154 or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 187)) ; ? ? ? ? ? ? ? ? 1 2 6 ? B 5 B 401 ;(chain B and (resid 5 through 38 or resid 40 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG )) or resid 153 through 154 or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 187)) ; ? ? ? ? ? ? ? ? 1 2 7 ? B 5 B 401 ;(chain B and (resid 5 through 38 or resid 40 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG )) or resid 153 through 154 or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 187)) ; ? ? ? ? ? ? ? ? 2 1 1 ? A 188 A 201 ;(chain A and (resid 188 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205)) ; ? ? ? ? ? ? ? ? 2 1 2 ? A 202 A 203 ;(chain A and (resid 188 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205)) ; ? ? ? ? ? ? ? ? 2 1 3 ? A 5 A 401 ;(chain A and (resid 188 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205)) ; ? ? ? ? ? ? ? ? 2 1 4 ? A 5 A 401 ;(chain A and (resid 188 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205)) ; ? ? ? ? ? ? ? ? 2 1 5 ? A 5 A 401 ;(chain A and (resid 188 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205)) ; ? ? ? ? ? ? ? ? 2 1 6 ? A 5 A 401 ;(chain A and (resid 188 through 201 or (resid 202 through 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205)) ; ? ? ? ? ? ? ? ? 2 2 1 ? B 188 B 193 ;(chain B and (resid 188 through 193 or (resid 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 205)) ; ? ? ? ? ? ? ? ? 2 2 2 ? B 194 B 194 ;(chain B and (resid 188 through 193 or (resid 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 205)) ; ? ? ? ? ? ? ? ? 2 2 3 ? B 5 B 401 ;(chain B and (resid 188 through 193 or (resid 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 205)) ; ? ? ? ? ? ? ? ? 2 2 4 ? B 5 B 401 ;(chain B and (resid 188 through 193 or (resid 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 205)) ; ? ? ? ? ? ? ? ? 2 2 5 ? B 5 B 401 ;(chain B and (resid 188 through 193 or (resid 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 205)) ; ? ? ? ? ? ? ? ? 2 2 6 ? B 5 B 401 ;(chain B and (resid 188 through 193 or (resid 194 and (name N or name CA or name C or name O or name CB )) or resid 195 through 205)) ; ? ? ? ? ? ? ? ? 3 1 1 ? A 206 A 210 ;(chain A and (resid 206 through 210 or (resid 211 through 212 and (name N or name CA or name C or name O or name CB )) or resid 213 through 244 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 253 or (resid 254 and (name N or name CA or name C or name O or name CB )) or resid 255 through 284 or (resid 285 and (name N or name CA or name C or name O or name CB )) or resid 286 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? 3 1 2 ? A 211 A 212 ;(chain A and (resid 206 through 210 or (resid 211 through 212 and (name N or name CA or name C or name O or name CB )) or resid 213 through 244 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 253 or (resid 254 and (name N or name CA or name C or name O or name CB )) or resid 255 through 284 or (resid 285 and (name N or name CA or name C or name O or name CB )) or resid 286 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? 3 1 3 ? A 5 A 401 ;(chain A and (resid 206 through 210 or (resid 211 through 212 and (name N or name CA or name C or name O or name CB )) or resid 213 through 244 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 253 or (resid 254 and (name N or name CA or name C or name O or name CB )) or resid 255 through 284 or (resid 285 and (name N or name CA or name C or name O or name CB )) or resid 286 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? 3 1 4 ? A 5 A 401 ;(chain A and (resid 206 through 210 or (resid 211 through 212 and (name N or name CA or name C or name O or name CB )) or resid 213 through 244 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 253 or (resid 254 and (name N or name CA or name C or name O or name CB )) or resid 255 through 284 or (resid 285 and (name N or name CA or name C or name O or name CB )) or resid 286 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? 3 1 5 ? A 5 A 401 ;(chain A and (resid 206 through 210 or (resid 211 through 212 and (name N or name CA or name C or name O or name CB )) or resid 213 through 244 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 253 or (resid 254 and (name N or name CA or name C or name O or name CB )) or resid 255 through 284 or (resid 285 and (name N or name CA or name C or name O or name CB )) or resid 286 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? 3 1 6 ? A 5 A 401 ;(chain A and (resid 206 through 210 or (resid 211 through 212 and (name N or name CA or name C or name O or name CB )) or resid 213 through 244 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 253 or (resid 254 and (name N or name CA or name C or name O or name CB )) or resid 255 through 284 or (resid 285 and (name N or name CA or name C or name O or name CB )) or resid 286 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? 3 2 1 ? B 206 B 260 ;(chain B and (resid 206 through 260 or (resid 261 and (name N or name CA or name C or name O or name CB )) or resid 262 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 319 or (resid 320 and (name N or name CA or name C or name O or name CB )) or resid 321 through 324)) ; ? ? ? ? ? ? ? ? 3 2 2 ? B 261 B 261 ;(chain B and (resid 206 through 260 or (resid 261 and (name N or name CA or name C or name O or name CB )) or resid 262 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 319 or (resid 320 and (name N or name CA or name C or name O or name CB )) or resid 321 through 324)) ; ? ? ? ? ? ? ? ? 3 2 3 ? B 5 B 401 ;(chain B and (resid 206 through 260 or (resid 261 and (name N or name CA or name C or name O or name CB )) or resid 262 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 319 or (resid 320 and (name N or name CA or name C or name O or name CB )) or resid 321 through 324)) ; ? ? ? ? ? ? ? ? 3 2 4 ? B 5 B 401 ;(chain B and (resid 206 through 260 or (resid 261 and (name N or name CA or name C or name O or name CB )) or resid 262 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 319 or (resid 320 and (name N or name CA or name C or name O or name CB )) or resid 321 through 324)) ; ? ? ? ? ? ? ? ? 3 2 5 ? B 5 B 401 ;(chain B and (resid 206 through 260 or (resid 261 and (name N or name CA or name C or name O or name CB )) or resid 262 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 319 or (resid 320 and (name N or name CA or name C or name O or name CB )) or resid 321 through 324)) ; ? ? ? ? ? ? ? ? 3 2 6 ? B 5 B 401 ;(chain B and (resid 206 through 260 or (resid 261 and (name N or name CA or name C or name O or name CB )) or resid 262 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 319 or (resid 320 and (name N or name CA or name C or name O or name CB )) or resid 321 through 324)) ; ? ? ? ? ? ? ? ? # loop_ _struct_ncs_ens.id _struct_ncs_ens.details 1 ? 2 ? 3 ? # _struct.entry_id 6VJI _struct.title 'Structure of mammalian NEIL2 from Monodelphis domestica' _struct.pdbx_descriptor 'Nei like DNA glycosylase 2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6VJI _struct_keywords.text 'NEIL2, base excision repair, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 6 ? ALA A 15 ? SER A 6 ALA A 15 1 ? 10 HELX_P HELX_P2 AA2 PRO A 16 ? VAL A 18 ? PRO A 16 VAL A 18 5 ? 3 HELX_P HELX_P3 AA3 ASN A 33 ? GLU A 38 ? ASN A 33 GLU A 38 5 ? 6 HELX_P HELX_P4 AA4 GLU A 60 ? LEU A 64 ? GLU A 60 LEU A 64 5 ? 5 HELX_P HELX_P5 AA5 ASP A 205 ? LYS A 214 ? ASP A 205 LYS A 214 1 ? 10 HELX_P HELX_P6 AA6 PRO A 218 ? LEU A 224 ? PRO A 218 LEU A 224 1 ? 7 HELX_P HELX_P7 AA7 ASP A 225 ? ALA A 230 ? ASP A 225 ALA A 230 1 ? 6 HELX_P HELX_P8 AA8 GLY A 233 ? ALA A 244 ? GLY A 233 ALA A 244 1 ? 12 HELX_P HELX_P9 AA9 THR A 256 ? GLU A 280 ? THR A 256 GLU A 280 1 ? 25 HELX_P HELX_P10 AB1 SER B 6 ? ALA B 15 ? SER B 6 ALA B 15 1 ? 10 HELX_P HELX_P11 AB2 PRO B 16 ? VAL B 18 ? PRO B 16 VAL B 18 5 ? 3 HELX_P HELX_P12 AB3 ASN B 33 ? GLU B 38 ? ASN B 33 GLU B 38 5 ? 6 HELX_P HELX_P13 AB4 GLU B 60 ? LEU B 64 ? GLU B 60 LEU B 64 5 ? 5 HELX_P HELX_P14 AB5 ASP B 205 ? LYS B 214 ? ASP B 205 LYS B 214 1 ? 10 HELX_P HELX_P15 AB6 PRO B 218 ? LEU B 224 ? PRO B 218 LEU B 224 1 ? 7 HELX_P HELX_P16 AB7 ASP B 225 ? ALA B 230 ? ASP B 225 ALA B 230 1 ? 6 HELX_P HELX_P17 AB8 GLY B 233 ? ALA B 244 ? GLY B 233 ALA B 244 1 ? 12 HELX_P HELX_P18 AB9 THR B 256 ? GLU B 280 ? THR B 256 GLU B 280 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASN 35 C ? ? ? 1_555 A MSE 36 N ? ? A ASN 35 A MSE 36 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? A MSE 36 C ? ? ? 1_555 A LEU 37 N ? ? A MSE 36 A LEU 37 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale3 covale both ? A GLU 38 C ? ? ? 1_555 A MSE 39 N ? ? A GLU 38 A MSE 39 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale4 covale both ? A MSE 39 C ? ? ? 1_555 A LEU 40 N ? ? A MSE 39 A LEU 40 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale5 covale both ? A VAL 300 C ? ? ? 1_555 A MSE 301 N ? ? A VAL 300 A MSE 301 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale6 covale both ? A MSE 301 C ? ? ? 1_555 A LYS 302 N ? ? A MSE 301 A LYS 302 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale7 covale both ? B ASN 35 C ? ? ? 1_555 B MSE 36 N ? ? B ASN 35 B MSE 36 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale8 covale both ? B MSE 36 C ? ? ? 1_555 B LEU 37 N ? ? B MSE 36 B LEU 37 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale9 covale both ? B GLU 38 C ? ? ? 1_555 B MSE 39 N ? ? B GLU 38 B MSE 39 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale10 covale both ? B MSE 39 C ? ? ? 1_555 B LEU 40 N ? ? B MSE 39 B LEU 40 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale11 covale both ? B VAL 300 C ? ? ? 1_555 B MSE 301 N ? ? B VAL 300 B MSE 301 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale12 covale both ? B MSE 301 C ? ? ? 1_555 B LYS 302 N ? ? B MSE 301 B LYS 302 1_555 ? ? ? ? ? ? ? 1.331 ? ? metalc1 metalc ? ? A CYS 294 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 294 A ZN 401 1_555 ? ? ? ? ? ? ? 2.294 ? ? metalc2 metalc ? ? A HIS 298 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 298 A ZN 401 1_555 ? ? ? ? ? ? ? 2.029 ? ? metalc3 metalc ? ? A CYS 318 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 318 A ZN 401 1_555 ? ? ? ? ? ? ? 2.281 ? ? metalc4 metalc ? ? A CYS 321 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 321 A ZN 401 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc5 metalc ? ? B CYS 294 SG ? ? ? 1_555 D ZN . ZN ? ? B CYS 294 B ZN 401 1_555 ? ? ? ? ? ? ? 2.277 ? ? metalc6 metalc ? ? B HIS 298 ND1 ? ? ? 1_555 D ZN . ZN ? ? B HIS 298 B ZN 401 1_555 ? ? ? ? ? ? ? 2.039 ? ? metalc7 metalc ? ? B CYS 318 SG ? ? ? 1_555 D ZN . ZN ? ? B CYS 318 B ZN 401 1_555 ? ? ? ? ? ? ? 2.279 ? ? metalc8 metalc ? ? B CYS 321 SG ? ? ? 1_555 D ZN . ZN ? ? B CYS 321 B ZN 401 1_555 ? ? ? ? ? ? ? 2.287 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 70 A . ? LEU 70 A PRO 71 A ? PRO 71 A 1 1.94 2 LEU 70 B . ? LEU 70 B PRO 71 B ? PRO 71 B 1 1.60 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 2 ? AA3 ? 4 ? AA4 ? 4 ? AA5 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA5 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 24 ? GLY A 26 ? THR A 24 GLY A 26 AA1 2 LEU A 169 ? HIS A 172 ? LEU A 169 HIS A 172 AA1 3 PHE A 177 ? CYS A 188 ? PHE A 177 CYS A 188 AA1 4 LEU A 133 ? ALA A 147 ? LEU A 133 ALA A 147 AA1 5 ASN A 51 ? GLY A 57 ? ASN A 51 GLY A 57 AA1 6 ARG A 41 ? VAL A 47 ? ARG A 41 VAL A 47 AA2 1 MSE A 301 ? PHE A 305 ? MSE A 301 PHE A 305 AA2 2 ARG A 313 ? TRP A 317 ? ARG A 313 TRP A 317 AA3 1 THR B 24 ? GLY B 26 ? THR B 24 GLY B 26 AA3 2 LEU B 169 ? HIS B 172 ? LEU B 169 HIS B 172 AA3 3 PHE B 177 ? PHE B 180 ? PHE B 177 PHE B 180 AA3 4 VAL B 145 ? ALA B 147 ? VAL B 145 ALA B 147 AA4 1 ARG B 41 ? VAL B 47 ? ARG B 41 VAL B 47 AA4 2 ASN B 51 ? GLY B 57 ? ASN B 51 GLY B 57 AA4 3 LEU B 133 ? PHE B 139 ? LEU B 133 PHE B 139 AA4 4 CYS B 183 ? CYS B 188 ? CYS B 183 CYS B 188 AA5 1 MSE B 301 ? PHE B 305 ? MSE B 301 PHE B 305 AA5 2 ARG B 313 ? TRP B 317 ? ARG B 313 TRP B 317 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 24 ? N THR A 24 O HIS A 172 ? O HIS A 172 AA1 2 3 N LEU A 171 ? N LEU A 171 O LEU A 178 ? O LEU A 178 AA1 3 4 O TYR A 181 ? O TYR A 181 N SER A 144 ? N SER A 144 AA1 4 5 O LEU A 133 ? O LEU A 133 N PHE A 56 ? N PHE A 56 AA1 5 6 O TYR A 53 ? O TYR A 53 N GLN A 46 ? N GLN A 46 AA2 1 2 N ASP A 303 ? N ASP A 303 O THR A 315 ? O THR A 315 AA3 1 2 N THR B 24 ? N THR B 24 O HIS B 172 ? O HIS B 172 AA3 2 3 N LEU B 169 ? N LEU B 169 O PHE B 180 ? O PHE B 180 AA3 3 4 O ALA B 179 ? O ALA B 179 N ARG B 146 ? N ARG B 146 AA4 1 2 N GLN B 46 ? N GLN B 46 O TYR B 53 ? O TYR B 53 AA4 2 3 N PHE B 56 ? N PHE B 56 O LEU B 133 ? O LEU B 133 AA4 3 4 N CYS B 136 ? N CYS B 136 O TYR B 186 ? O TYR B 186 AA5 1 2 N ASP B 303 ? N ASP B 303 O THR B 315 ? O THR B 315 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 401 ? 4 'binding site for residue ZN A 401' AC2 Software B ZN 401 ? 4 'binding site for residue ZN B 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 294 ? CYS A 294 . ? 1_555 ? 2 AC1 4 HIS A 298 ? HIS A 298 . ? 1_555 ? 3 AC1 4 CYS A 318 ? CYS A 318 . ? 1_555 ? 4 AC1 4 CYS A 321 ? CYS A 321 . ? 1_555 ? 5 AC2 4 CYS B 294 ? CYS B 294 . ? 1_555 ? 6 AC2 4 HIS B 298 ? HIS B 298 . ? 1_555 ? 7 AC2 4 CYS B 318 ? CYS B 318 . ? 1_555 ? 8 AC2 4 CYS B 321 ? CYS B 321 . ? 1_555 ? # _atom_sites.entry_id 6VJI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014730 _atom_sites.fract_transf_matrix[1][2] 0.008505 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017009 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006706 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S SE ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 GLY 4 4 ? ? ? A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 MSE 36 36 36 MSE MSE A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 MSE 39 39 39 MSE MSE A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 LYS 72 72 ? ? ? A . n A 1 73 HIS 73 73 ? ? ? A . n A 1 74 LEU 74 74 ? ? ? A . n A 1 75 GLN 75 75 ? ? ? A . n A 1 76 LYS 76 76 ? ? ? A . n A 1 77 LYS 77 77 ? ? ? A . n A 1 78 VAL 78 78 ? ? ? A . n A 1 79 ARG 79 79 ? ? ? A . n A 1 80 LEU 80 80 ? ? ? A . n A 1 81 PRO 81 81 ? ? ? A . n A 1 82 LYS 82 82 ? ? ? A . n A 1 83 GLU 83 83 ? ? ? A . n A 1 84 LYS 84 84 ? ? ? A . n A 1 85 SER 85 85 ? ? ? A . n A 1 86 ASP 86 86 ? ? ? A . n A 1 87 HIS 87 87 ? ? ? A . n A 1 88 LYS 88 88 ? ? ? A . n A 1 89 LEU 89 89 ? ? ? A . n A 1 90 GLU 90 90 ? ? ? A . n A 1 91 THR 91 91 ? ? ? A . n A 1 92 THR 92 92 ? ? ? A . n A 1 93 SER 93 93 ? ? ? A . n A 1 94 ARG 94 94 ? ? ? A . n A 1 95 LEU 95 95 ? ? ? A . n A 1 96 ASP 96 96 ? ? ? A . n A 1 97 GLY 97 97 ? ? ? A . n A 1 98 GLN 98 98 ? ? ? A . n A 1 99 GLU 99 99 ? ? ? A . n A 1 100 VAL 100 100 ? ? ? A . n A 1 101 PRO 101 101 ? ? ? A . n A 1 102 GLY 102 102 ? ? ? A . n A 1 103 SER 103 103 ? ? ? A . n A 1 104 SER 104 104 ? ? ? A . n A 1 105 LEU 105 105 ? ? ? A . n A 1 106 ALA 106 106 ? ? ? A . n A 1 107 ILE 107 107 ? ? ? A . n A 1 108 LYS 108 108 ? ? ? A . n A 1 109 ALA 109 109 ? ? ? A . n A 1 110 LEU 110 110 ? ? ? A . n A 1 111 GLU 111 111 ? ? ? A . n A 1 112 LEU 112 112 ? ? ? A . n A 1 113 GLY 113 113 ? ? ? A . n A 1 114 GLU 114 114 ? ? ? A . n A 1 115 GLU 115 115 ? ? ? A . n A 1 116 GLU 116 116 ? ? ? A . n A 1 117 LYS 117 117 ? ? ? A . n A 1 118 GLU 118 118 ? ? ? A . n A 1 119 THR 119 119 ? ? ? A . n A 1 120 VAL 120 120 ? ? ? A . n A 1 121 MSE 121 121 ? ? ? A . n A 1 122 PRO 122 122 ? ? ? A . n A 1 123 TRP 123 123 ? ? ? A . n A 1 124 TRP 124 124 ? ? ? A . n A 1 125 LEU 125 125 ? ? ? A . n A 1 126 ASN 126 126 ? ? ? A . n A 1 127 THR 127 127 ? ? ? A . n A 1 128 SER 128 128 ? ? ? A . n A 1 129 GLN 129 129 ? ? ? A . n A 1 130 ASN 130 130 130 ASN ASN A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 TRP 134 134 134 TRP TRP A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 CYS 136 136 136 CYS CYS A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 HIS 138 138 138 HIS HIS A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 ASN 157 157 ? ? ? A . n A 1 158 LYS 158 158 ? ? ? A . n A 1 159 ARG 159 159 ? ? ? A . n A 1 160 GLY 160 160 ? ? ? A . n A 1 161 ASP 161 161 ? ? ? A . n A 1 162 TRP 162 162 ? ? ? A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 PRO 167 167 167 PRO PRO A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 PHE 177 177 177 PHE PHE A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 PHE 180 180 180 PHE PHE A . n A 1 181 TYR 181 181 181 TYR TYR A . n A 1 182 ASN 182 182 182 ASN ASN A . n A 1 183 CYS 183 183 183 CYS CYS A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 ILE 185 185 185 ILE ILE A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 TRP 187 187 187 TRP TRP A . n A 1 188 CYS 188 188 188 CYS CYS A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 THR 192 192 192 THR THR A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 LYS 194 194 194 LYS LYS A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 THR 196 196 196 THR THR A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 ASP 198 198 198 ASP ASP A . n A 1 199 ILE 199 199 199 ILE ILE A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 PHE 204 204 204 PHE PHE A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 ARG 206 206 206 ARG ARG A . n A 1 207 ARG 207 207 207 ARG ARG A . n A 1 208 GLN 208 208 208 GLN GLN A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 LEU 210 210 210 LEU LEU A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 LYS 214 214 214 LYS LYS A . n A 1 215 GLN 215 215 215 GLN GLN A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 SER 217 217 217 SER SER A . n A 1 218 PRO 218 218 218 PRO PRO A . n A 1 219 VAL 219 219 219 VAL VAL A . n A 1 220 SER 220 220 220 SER SER A . n A 1 221 TYR 221 221 221 TYR TYR A . n A 1 222 THR 222 222 222 THR THR A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 ASP 225 225 225 ASP ASP A . n A 1 226 GLN 226 226 226 GLN GLN A . n A 1 227 ARG 227 227 227 ARG ARG A . n A 1 228 TYR 228 228 228 TYR TYR A . n A 1 229 PHE 229 229 229 PHE PHE A . n A 1 230 ALA 230 230 230 ALA ALA A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 ASN 234 234 234 ASN ASN A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 ILE 236 236 236 ILE ILE A . n A 1 237 LYS 237 237 237 LYS LYS A . n A 1 238 ASN 238 238 238 ASN ASN A . n A 1 239 GLU 239 239 239 GLU GLU A . n A 1 240 VAL 240 240 240 VAL VAL A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 TYR 242 242 242 TYR TYR A . n A 1 243 LEU 243 243 243 LEU LEU A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 ARG 245 245 245 ARG ARG A . n A 1 246 ILE 246 246 246 ILE ILE A . n A 1 247 HIS 247 247 247 HIS HIS A . n A 1 248 PRO 248 248 248 PRO PRO A . n A 1 249 LEU 249 249 249 LEU LEU A . n A 1 250 SER 250 250 250 SER SER A . n A 1 251 LEU 251 251 251 LEU LEU A . n A 1 252 GLY 252 252 252 GLY GLY A . n A 1 253 SER 253 253 253 SER SER A . n A 1 254 CYS 254 254 254 CYS CYS A . n A 1 255 LEU 255 255 255 LEU LEU A . n A 1 256 THR 256 256 256 THR THR A . n A 1 257 PRO 257 257 257 PRO PRO A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 ASN 259 259 259 ASN ASN A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 GLU 261 261 261 GLU GLU A . n A 1 262 SER 262 262 262 SER SER A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 LEU 264 264 264 LEU LEU A . n A 1 265 ASP 265 265 265 ASP ASP A . n A 1 266 HIS 266 266 266 HIS HIS A . n A 1 267 VAL 267 267 267 VAL VAL A . n A 1 268 VAL 268 268 268 VAL VAL A . n A 1 269 SER 269 269 269 SER SER A . n A 1 270 PHE 270 270 270 PHE PHE A . n A 1 271 SER 271 271 271 SER SER A . n A 1 272 VAL 272 272 272 VAL VAL A . n A 1 273 GLY 273 273 273 GLY GLY A . n A 1 274 TRP 274 274 274 TRP TRP A . n A 1 275 LEU 275 275 275 LEU LEU A . n A 1 276 GLN 276 276 276 GLN GLN A . n A 1 277 LYS 277 277 277 LYS LYS A . n A 1 278 LYS 278 278 278 LYS LYS A . n A 1 279 LEU 279 279 279 LEU LEU A . n A 1 280 GLU 280 280 280 GLU GLU A . n A 1 281 GLY 281 281 281 GLY GLY A . n A 1 282 LYS 282 282 282 LYS LYS A . n A 1 283 PRO 283 283 283 PRO PRO A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 HIS 285 285 285 HIS HIS A . n A 1 286 HIS 286 286 286 HIS HIS A . n A 1 287 LEU 287 287 287 LEU LEU A . n A 1 288 ILE 288 288 288 ILE ILE A . n A 1 289 TYR 289 289 289 TYR TYR A . n A 1 290 GLN 290 290 290 GLN GLN A . n A 1 291 LYS 291 291 291 LYS LYS A . n A 1 292 GLU 292 292 292 GLU GLU A . n A 1 293 GLN 293 293 293 GLN GLN A . n A 1 294 CYS 294 294 294 CYS CYS A . n A 1 295 PRO 295 295 295 PRO PRO A . n A 1 296 ALA 296 296 296 ALA ALA A . n A 1 297 GLY 297 297 297 GLY GLY A . n A 1 298 HIS 298 298 298 HIS HIS A . n A 1 299 GLN 299 299 299 GLN GLN A . n A 1 300 VAL 300 300 300 VAL VAL A . n A 1 301 MSE 301 301 301 MSE MSE A . n A 1 302 LYS 302 302 302 LYS LYS A . n A 1 303 ASP 303 303 303 ASP ASP A . n A 1 304 SER 304 304 304 SER SER A . n A 1 305 PHE 305 305 305 PHE PHE A . n A 1 306 GLY 306 306 306 GLY GLY A . n A 1 307 PRO 307 307 307 PRO PRO A . n A 1 308 PRO 308 308 ? ? ? A . n A 1 309 GLY 309 309 ? ? ? A . n A 1 310 SER 310 310 ? ? ? A . n A 1 311 PHE 311 311 311 PHE PHE A . n A 1 312 GLN 312 312 312 GLN GLN A . n A 1 313 ARG 313 313 313 ARG ARG A . n A 1 314 LEU 314 314 314 LEU LEU A . n A 1 315 THR 315 315 315 THR THR A . n A 1 316 TRP 316 316 316 TRP TRP A . n A 1 317 TRP 317 317 317 TRP TRP A . n A 1 318 CYS 318 318 318 CYS CYS A . n A 1 319 PRO 319 319 319 PRO PRO A . n A 1 320 HIS 320 320 320 HIS HIS A . n A 1 321 CYS 321 321 321 CYS CYS A . n A 1 322 GLN 322 322 322 GLN GLN A . n A 1 323 PRO 323 323 323 PRO PRO A . n A 1 324 LYS 324 324 324 LYS LYS A . n A 1 325 ALA 325 325 325 ALA ALA A . n A 1 326 GLU 326 326 326 GLU GLU A . n A 1 327 GLU 327 327 ? ? ? A . n A 1 328 LYS 328 328 ? ? ? A . n A 1 329 VAL 329 329 ? ? ? A . n A 1 330 GLU 330 330 ? ? ? A . n A 1 331 VAL 331 331 ? ? ? A . n A 1 332 THR 332 332 ? ? ? A . n A 1 333 GLN 333 333 ? ? ? A . n A 1 334 GLU 334 334 ? ? ? A . n A 1 335 GLN 335 335 ? ? ? A . n A 1 336 LEU 336 336 ? ? ? A . n A 1 337 LEU 337 337 ? ? ? A . n A 1 338 GLU 338 338 ? ? ? A . n A 1 339 HIS 339 339 ? ? ? A . n A 1 340 HIS 340 340 ? ? ? A . n A 1 341 HIS 341 341 ? ? ? A . n A 1 342 HIS 342 342 ? ? ? A . n A 1 343 HIS 343 343 ? ? ? A . n A 1 344 HIS 344 344 ? ? ? A . n B 1 1 MSE 1 1 ? ? ? B . n B 1 2 PRO 2 2 ? ? ? B . n B 1 3 GLU 3 3 ? ? ? B . n B 1 4 GLY 4 4 ? ? ? B . n B 1 5 PRO 5 5 5 PRO PRO B . n B 1 6 SER 6 6 6 SER SER B . n B 1 7 LEU 7 7 7 LEU LEU B . n B 1 8 ARG 8 8 8 ARG ARG B . n B 1 9 LYS 9 9 9 LYS LYS B . n B 1 10 PHE 10 10 10 PHE PHE B . n B 1 11 HIS 11 11 11 HIS HIS B . n B 1 12 GLN 12 12 12 GLN GLN B . n B 1 13 LEU 13 13 13 LEU LEU B . n B 1 14 VAL 14 14 14 VAL VAL B . n B 1 15 ALA 15 15 15 ALA ALA B . n B 1 16 PRO 16 16 16 PRO PRO B . n B 1 17 PHE 17 17 17 PHE PHE B . n B 1 18 VAL 18 18 18 VAL VAL B . n B 1 19 GLY 19 19 19 GLY GLY B . n B 1 20 GLN 20 20 20 GLN GLN B . n B 1 21 LEU 21 21 21 LEU LEU B . n B 1 22 VAL 22 22 22 VAL VAL B . n B 1 23 VAL 23 23 23 VAL VAL B . n B 1 24 THR 24 24 24 THR THR B . n B 1 25 VAL 25 25 25 VAL VAL B . n B 1 26 GLY 26 26 26 GLY GLY B . n B 1 27 GLY 27 27 27 GLY GLY B . n B 1 28 ASN 28 28 28 ASN ASN B . n B 1 29 SER 29 29 29 SER SER B . n B 1 30 LYS 30 30 30 LYS LYS B . n B 1 31 LYS 31 31 31 LYS LYS B . n B 1 32 ILE 32 32 32 ILE ILE B . n B 1 33 ASN 33 33 33 ASN ASN B . n B 1 34 PRO 34 34 34 PRO PRO B . n B 1 35 ASN 35 35 35 ASN ASN B . n B 1 36 MSE 36 36 36 MSE MSE B . n B 1 37 LEU 37 37 37 LEU LEU B . n B 1 38 GLU 38 38 38 GLU GLU B . n B 1 39 MSE 39 39 39 MSE MSE B . n B 1 40 LEU 40 40 40 LEU LEU B . n B 1 41 ARG 41 41 41 ARG ARG B . n B 1 42 LEU 42 42 42 LEU LEU B . n B 1 43 GLN 43 43 43 GLN GLN B . n B 1 44 ASP 44 44 44 ASP ASP B . n B 1 45 SER 45 45 45 SER SER B . n B 1 46 GLN 46 46 46 GLN GLN B . n B 1 47 VAL 47 47 47 VAL VAL B . n B 1 48 HIS 48 48 48 HIS HIS B . n B 1 49 GLY 49 49 49 GLY GLY B . n B 1 50 LYS 50 50 50 LYS LYS B . n B 1 51 ASN 51 51 51 ASN ASN B . n B 1 52 LEU 52 52 52 LEU LEU B . n B 1 53 TYR 53 53 53 TYR TYR B . n B 1 54 LEU 54 54 54 LEU LEU B . n B 1 55 ASN 55 55 55 ASN ASN B . n B 1 56 PHE 56 56 56 PHE PHE B . n B 1 57 GLY 57 57 57 GLY GLY B . n B 1 58 LEU 58 58 58 LEU LEU B . n B 1 59 THR 59 59 59 THR THR B . n B 1 60 GLU 60 60 60 GLU GLU B . n B 1 61 ASP 61 61 61 ASP ASP B . n B 1 62 LEU 62 62 62 LEU LEU B . n B 1 63 GLY 63 63 63 GLY GLY B . n B 1 64 LEU 64 64 64 LEU LEU B . n B 1 65 PRO 65 65 65 PRO PRO B . n B 1 66 GLU 66 66 66 GLU GLU B . n B 1 67 SER 67 67 67 SER SER B . n B 1 68 PHE 68 68 68 PHE PHE B . n B 1 69 LEU 69 69 69 LEU LEU B . n B 1 70 LEU 70 70 70 LEU LEU B . n B 1 71 PRO 71 71 71 PRO PRO B . n B 1 72 LYS 72 72 ? ? ? B . n B 1 73 HIS 73 73 ? ? ? B . n B 1 74 LEU 74 74 ? ? ? B . n B 1 75 GLN 75 75 ? ? ? B . n B 1 76 LYS 76 76 ? ? ? B . n B 1 77 LYS 77 77 ? ? ? B . n B 1 78 VAL 78 78 ? ? ? B . n B 1 79 ARG 79 79 ? ? ? B . n B 1 80 LEU 80 80 ? ? ? B . n B 1 81 PRO 81 81 ? ? ? B . n B 1 82 LYS 82 82 ? ? ? B . n B 1 83 GLU 83 83 ? ? ? B . n B 1 84 LYS 84 84 ? ? ? B . n B 1 85 SER 85 85 ? ? ? B . n B 1 86 ASP 86 86 ? ? ? B . n B 1 87 HIS 87 87 ? ? ? B . n B 1 88 LYS 88 88 ? ? ? B . n B 1 89 LEU 89 89 ? ? ? B . n B 1 90 GLU 90 90 ? ? ? B . n B 1 91 THR 91 91 ? ? ? B . n B 1 92 THR 92 92 ? ? ? B . n B 1 93 SER 93 93 ? ? ? B . n B 1 94 ARG 94 94 ? ? ? B . n B 1 95 LEU 95 95 ? ? ? B . n B 1 96 ASP 96 96 ? ? ? B . n B 1 97 GLY 97 97 ? ? ? B . n B 1 98 GLN 98 98 ? ? ? B . n B 1 99 GLU 99 99 ? ? ? B . n B 1 100 VAL 100 100 ? ? ? B . n B 1 101 PRO 101 101 ? ? ? B . n B 1 102 GLY 102 102 ? ? ? B . n B 1 103 SER 103 103 ? ? ? B . n B 1 104 SER 104 104 ? ? ? B . n B 1 105 LEU 105 105 ? ? ? B . n B 1 106 ALA 106 106 ? ? ? B . n B 1 107 ILE 107 107 ? ? ? B . n B 1 108 LYS 108 108 ? ? ? B . n B 1 109 ALA 109 109 ? ? ? B . n B 1 110 LEU 110 110 ? ? ? B . n B 1 111 GLU 111 111 ? ? ? B . n B 1 112 LEU 112 112 ? ? ? B . n B 1 113 GLY 113 113 ? ? ? B . n B 1 114 GLU 114 114 ? ? ? B . n B 1 115 GLU 115 115 ? ? ? B . n B 1 116 GLU 116 116 ? ? ? B . n B 1 117 LYS 117 117 ? ? ? B . n B 1 118 GLU 118 118 ? ? ? B . n B 1 119 THR 119 119 ? ? ? B . n B 1 120 VAL 120 120 ? ? ? B . n B 1 121 MSE 121 121 ? ? ? B . n B 1 122 PRO 122 122 ? ? ? B . n B 1 123 TRP 123 123 ? ? ? B . n B 1 124 TRP 124 124 ? ? ? B . n B 1 125 LEU 125 125 ? ? ? B . n B 1 126 ASN 126 126 ? ? ? B . n B 1 127 THR 127 127 ? ? ? B . n B 1 128 SER 128 128 ? ? ? B . n B 1 129 GLN 129 129 ? ? ? B . n B 1 130 ASN 130 130 130 ASN ASN B . n B 1 131 SER 131 131 131 SER SER B . n B 1 132 GLY 132 132 132 GLY GLY B . n B 1 133 LEU 133 133 133 LEU LEU B . n B 1 134 TRP 134 134 134 TRP TRP B . n B 1 135 LEU 135 135 135 LEU LEU B . n B 1 136 CYS 136 136 136 CYS CYS B . n B 1 137 PHE 137 137 137 PHE PHE B . n B 1 138 HIS 138 138 138 HIS HIS B . n B 1 139 PHE 139 139 139 PHE PHE B . n B 1 140 GLY 140 140 140 GLY GLY B . n B 1 141 LEU 141 141 141 LEU LEU B . n B 1 142 PHE 142 142 142 PHE PHE B . n B 1 143 GLY 143 143 143 GLY GLY B . n B 1 144 SER 144 144 144 SER SER B . n B 1 145 VAL 145 145 145 VAL VAL B . n B 1 146 ARG 146 146 146 ARG ARG B . n B 1 147 ALA 147 147 147 ALA ALA B . n B 1 148 SER 148 148 148 SER SER B . n B 1 149 GLU 149 149 149 GLU GLU B . n B 1 150 LEU 150 150 150 LEU LEU B . n B 1 151 SER 151 151 151 SER SER B . n B 1 152 ARG 152 152 152 ARG ARG B . n B 1 153 ALA 153 153 153 ALA ALA B . n B 1 154 THR 154 154 154 THR THR B . n B 1 155 LYS 155 155 ? ? ? B . n B 1 156 ALA 156 156 ? ? ? B . n B 1 157 ASN 157 157 ? ? ? B . n B 1 158 LYS 158 158 ? ? ? B . n B 1 159 ARG 159 159 ? ? ? B . n B 1 160 GLY 160 160 ? ? ? B . n B 1 161 ASP 161 161 ? ? ? B . n B 1 162 TRP 162 162 162 TRP TRP B . n B 1 163 LYS 163 163 163 LYS LYS B . n B 1 164 ASP 164 164 164 ASP ASP B . n B 1 165 PRO 165 165 165 PRO PRO B . n B 1 166 ILE 166 166 166 ILE ILE B . n B 1 167 PRO 167 167 167 PRO PRO B . n B 1 168 ARG 168 168 168 ARG ARG B . n B 1 169 LEU 169 169 169 LEU LEU B . n B 1 170 VAL 170 170 170 VAL VAL B . n B 1 171 LEU 171 171 171 LEU LEU B . n B 1 172 HIS 172 172 172 HIS HIS B . n B 1 173 PHE 173 173 173 PHE PHE B . n B 1 174 ALA 174 174 174 ALA ALA B . n B 1 175 LYS 175 175 175 LYS LYS B . n B 1 176 GLY 176 176 176 GLY GLY B . n B 1 177 PHE 177 177 177 PHE PHE B . n B 1 178 LEU 178 178 178 LEU LEU B . n B 1 179 ALA 179 179 179 ALA ALA B . n B 1 180 PHE 180 180 180 PHE PHE B . n B 1 181 TYR 181 181 181 TYR TYR B . n B 1 182 ASN 182 182 182 ASN ASN B . n B 1 183 CYS 183 183 183 CYS CYS B . n B 1 184 ARG 184 184 184 ARG ARG B . n B 1 185 ILE 185 185 185 ILE ILE B . n B 1 186 TYR 186 186 186 TYR TYR B . n B 1 187 TRP 187 187 187 TRP TRP B . n B 1 188 CYS 188 188 188 CYS CYS B . n B 1 189 LEU 189 189 189 LEU LEU B . n B 1 190 GLY 190 190 190 GLY GLY B . n B 1 191 PRO 191 191 191 PRO PRO B . n B 1 192 THR 192 192 192 THR THR B . n B 1 193 VAL 193 193 193 VAL VAL B . n B 1 194 LYS 194 194 194 LYS LYS B . n B 1 195 PRO 195 195 195 PRO PRO B . n B 1 196 THR 196 196 196 THR THR B . n B 1 197 SER 197 197 197 SER SER B . n B 1 198 ASP 198 198 198 ASP ASP B . n B 1 199 ILE 199 199 199 ILE ILE B . n B 1 200 LEU 200 200 200 LEU LEU B . n B 1 201 SER 201 201 201 SER SER B . n B 1 202 GLU 202 202 202 GLU GLU B . n B 1 203 GLU 203 203 203 GLU GLU B . n B 1 204 PHE 204 204 204 PHE PHE B . n B 1 205 ASP 205 205 205 ASP ASP B . n B 1 206 ARG 206 206 206 ARG ARG B . n B 1 207 ARG 207 207 207 ARG ARG B . n B 1 208 GLN 208 208 208 GLN GLN B . n B 1 209 ALA 209 209 209 ALA ALA B . n B 1 210 LEU 210 210 210 LEU LEU B . n B 1 211 GLU 211 211 211 GLU GLU B . n B 1 212 ALA 212 212 212 ALA ALA B . n B 1 213 LEU 213 213 213 LEU LEU B . n B 1 214 LYS 214 214 214 LYS LYS B . n B 1 215 GLN 215 215 215 GLN GLN B . n B 1 216 ALA 216 216 216 ALA ALA B . n B 1 217 SER 217 217 217 SER SER B . n B 1 218 PRO 218 218 218 PRO PRO B . n B 1 219 VAL 219 219 219 VAL VAL B . n B 1 220 SER 220 220 220 SER SER B . n B 1 221 TYR 221 221 221 TYR TYR B . n B 1 222 THR 222 222 222 THR THR B . n B 1 223 LEU 223 223 223 LEU LEU B . n B 1 224 LEU 224 224 224 LEU LEU B . n B 1 225 ASP 225 225 225 ASP ASP B . n B 1 226 GLN 226 226 226 GLN GLN B . n B 1 227 ARG 227 227 227 ARG ARG B . n B 1 228 TYR 228 228 228 TYR TYR B . n B 1 229 PHE 229 229 229 PHE PHE B . n B 1 230 ALA 230 230 230 ALA ALA B . n B 1 231 GLY 231 231 231 GLY GLY B . n B 1 232 LEU 232 232 232 LEU LEU B . n B 1 233 GLY 233 233 233 GLY GLY B . n B 1 234 ASN 234 234 234 ASN ASN B . n B 1 235 ILE 235 235 235 ILE ILE B . n B 1 236 ILE 236 236 236 ILE ILE B . n B 1 237 LYS 237 237 237 LYS LYS B . n B 1 238 ASN 238 238 238 ASN ASN B . n B 1 239 GLU 239 239 239 GLU GLU B . n B 1 240 VAL 240 240 240 VAL VAL B . n B 1 241 LEU 241 241 241 LEU LEU B . n B 1 242 TYR 242 242 242 TYR TYR B . n B 1 243 LEU 243 243 243 LEU LEU B . n B 1 244 ALA 244 244 244 ALA ALA B . n B 1 245 ARG 245 245 245 ARG ARG B . n B 1 246 ILE 246 246 246 ILE ILE B . n B 1 247 HIS 247 247 247 HIS HIS B . n B 1 248 PRO 248 248 248 PRO PRO B . n B 1 249 LEU 249 249 249 LEU LEU B . n B 1 250 SER 250 250 250 SER SER B . n B 1 251 LEU 251 251 251 LEU LEU B . n B 1 252 GLY 252 252 252 GLY GLY B . n B 1 253 SER 253 253 253 SER SER B . n B 1 254 CYS 254 254 254 CYS CYS B . n B 1 255 LEU 255 255 255 LEU LEU B . n B 1 256 THR 256 256 256 THR THR B . n B 1 257 PRO 257 257 257 PRO PRO B . n B 1 258 LEU 258 258 258 LEU LEU B . n B 1 259 ASN 259 259 259 ASN ASN B . n B 1 260 LEU 260 260 260 LEU LEU B . n B 1 261 GLU 261 261 261 GLU GLU B . n B 1 262 SER 262 262 262 SER SER B . n B 1 263 LEU 263 263 263 LEU LEU B . n B 1 264 LEU 264 264 264 LEU LEU B . n B 1 265 ASP 265 265 265 ASP ASP B . n B 1 266 HIS 266 266 266 HIS HIS B . n B 1 267 VAL 267 267 267 VAL VAL B . n B 1 268 VAL 268 268 268 VAL VAL B . n B 1 269 SER 269 269 269 SER SER B . n B 1 270 PHE 270 270 270 PHE PHE B . n B 1 271 SER 271 271 271 SER SER B . n B 1 272 VAL 272 272 272 VAL VAL B . n B 1 273 GLY 273 273 273 GLY GLY B . n B 1 274 TRP 274 274 274 TRP TRP B . n B 1 275 LEU 275 275 275 LEU LEU B . n B 1 276 GLN 276 276 276 GLN GLN B . n B 1 277 LYS 277 277 277 LYS LYS B . n B 1 278 LYS 278 278 278 LYS LYS B . n B 1 279 LEU 279 279 279 LEU LEU B . n B 1 280 GLU 280 280 280 GLU GLU B . n B 1 281 GLY 281 281 281 GLY GLY B . n B 1 282 LYS 282 282 282 LYS LYS B . n B 1 283 PRO 283 283 283 PRO PRO B . n B 1 284 LEU 284 284 284 LEU LEU B . n B 1 285 HIS 285 285 285 HIS HIS B . n B 1 286 HIS 286 286 286 HIS HIS B . n B 1 287 LEU 287 287 287 LEU LEU B . n B 1 288 ILE 288 288 288 ILE ILE B . n B 1 289 TYR 289 289 289 TYR TYR B . n B 1 290 GLN 290 290 290 GLN GLN B . n B 1 291 LYS 291 291 291 LYS LYS B . n B 1 292 GLU 292 292 292 GLU GLU B . n B 1 293 GLN 293 293 293 GLN GLN B . n B 1 294 CYS 294 294 294 CYS CYS B . n B 1 295 PRO 295 295 295 PRO PRO B . n B 1 296 ALA 296 296 296 ALA ALA B . n B 1 297 GLY 297 297 297 GLY GLY B . n B 1 298 HIS 298 298 298 HIS HIS B . n B 1 299 GLN 299 299 299 GLN GLN B . n B 1 300 VAL 300 300 300 VAL VAL B . n B 1 301 MSE 301 301 301 MSE MSE B . n B 1 302 LYS 302 302 302 LYS LYS B . n B 1 303 ASP 303 303 303 ASP ASP B . n B 1 304 SER 304 304 304 SER SER B . n B 1 305 PHE 305 305 305 PHE PHE B . n B 1 306 GLY 306 306 306 GLY GLY B . n B 1 307 PRO 307 307 307 PRO PRO B . n B 1 308 PRO 308 308 ? ? ? B . n B 1 309 GLY 309 309 ? ? ? B . n B 1 310 SER 310 310 ? ? ? B . n B 1 311 PHE 311 311 311 PHE PHE B . n B 1 312 GLN 312 312 312 GLN GLN B . n B 1 313 ARG 313 313 313 ARG ARG B . n B 1 314 LEU 314 314 314 LEU LEU B . n B 1 315 THR 315 315 315 THR THR B . n B 1 316 TRP 316 316 316 TRP TRP B . n B 1 317 TRP 317 317 317 TRP TRP B . n B 1 318 CYS 318 318 318 CYS CYS B . n B 1 319 PRO 319 319 319 PRO PRO B . n B 1 320 HIS 320 320 320 HIS HIS B . n B 1 321 CYS 321 321 321 CYS CYS B . n B 1 322 GLN 322 322 322 GLN GLN B . n B 1 323 PRO 323 323 323 PRO PRO B . n B 1 324 LYS 324 324 324 LYS LYS B . n B 1 325 ALA 325 325 325 ALA ALA B . n B 1 326 GLU 326 326 ? ? ? B . n B 1 327 GLU 327 327 ? ? ? B . n B 1 328 LYS 328 328 ? ? ? B . n B 1 329 VAL 329 329 ? ? ? B . n B 1 330 GLU 330 330 ? ? ? B . n B 1 331 VAL 331 331 ? ? ? B . n B 1 332 THR 332 332 ? ? ? B . n B 1 333 GLN 333 333 ? ? ? B . n B 1 334 GLU 334 334 ? ? ? B . n B 1 335 GLN 335 335 ? ? ? B . n B 1 336 LEU 336 336 ? ? ? B . n B 1 337 LEU 337 337 ? ? ? B . n B 1 338 GLU 338 338 ? ? ? B . n B 1 339 HIS 339 339 ? ? ? B . n B 1 340 HIS 340 340 ? ? ? B . n B 1 341 HIS 341 341 ? ? ? B . n B 1 342 HIS 342 342 ? ? ? B . n B 1 343 HIS 343 343 ? ? ? B . n B 1 344 HIS 344 344 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 ZN 1 401 401 ZN ZN A . D 2 ZN 1 401 401 ZN ZN B . E 3 HOH 1 501 6 HOH HOH A . E 3 HOH 2 502 5 HOH HOH A . E 3 HOH 3 503 3 HOH HOH A . E 3 HOH 4 504 4 HOH HOH A . E 3 HOH 5 505 2 HOH HOH A . F 3 HOH 1 501 1 HOH HOH B . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 36 A MSE 36 ? MET 'modified residue' 2 A MSE 39 A MSE 39 ? MET 'modified residue' 3 A MSE 301 A MSE 301 ? MET 'modified residue' 4 B MSE 36 B MSE 36 ? MET 'modified residue' 5 B MSE 39 B MSE 39 ? MET 'modified residue' 6 B MSE 301 B MSE 301 ? MET 'modified residue' # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA monomeric 1 2 author_and_software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,E 2 1 B,D,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 294 ? A CYS 294 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 298 ? A HIS 298 ? 1_555 96.8 ? 2 SG ? A CYS 294 ? A CYS 294 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 318 ? A CYS 318 ? 1_555 120.7 ? 3 ND1 ? A HIS 298 ? A HIS 298 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 318 ? A CYS 318 ? 1_555 112.7 ? 4 SG ? A CYS 294 ? A CYS 294 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 321 ? A CYS 321 ? 1_555 127.9 ? 5 ND1 ? A HIS 298 ? A HIS 298 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 321 ? A CYS 321 ? 1_555 108.2 ? 6 SG ? A CYS 318 ? A CYS 318 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 321 ? A CYS 321 ? 1_555 91.0 ? 7 SG ? B CYS 294 ? B CYS 294 ? 1_555 ZN ? D ZN . ? B ZN 401 ? 1_555 ND1 ? B HIS 298 ? B HIS 298 ? 1_555 92.3 ? 8 SG ? B CYS 294 ? B CYS 294 ? 1_555 ZN ? D ZN . ? B ZN 401 ? 1_555 SG ? B CYS 318 ? B CYS 318 ? 1_555 125.1 ? 9 ND1 ? B HIS 298 ? B HIS 298 ? 1_555 ZN ? D ZN . ? B ZN 401 ? 1_555 SG ? B CYS 318 ? B CYS 318 ? 1_555 124.8 ? 10 SG ? B CYS 294 ? B CYS 294 ? 1_555 ZN ? D ZN . ? B ZN 401 ? 1_555 SG ? B CYS 321 ? B CYS 321 ? 1_555 112.7 ? 11 ND1 ? B HIS 298 ? B HIS 298 ? 1_555 ZN ? D ZN . ? B ZN 401 ? 1_555 SG ? B CYS 321 ? B CYS 321 ? 1_555 114.4 ? 12 SG ? B CYS 318 ? B CYS 318 ? 1_555 ZN ? D ZN . ? B ZN 401 ? 1_555 SG ? B CYS 321 ? B CYS 321 ? 1_555 89.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-08-12 2 'Structure model' 1 1 2020-09-09 3 'Structure model' 1 2 2021-01-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_DOI' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 2 'Structure model' '_citation_author.name' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_citation.year' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -24.4278 73.8542 76.3324 0.8025 ? 0.0163 ? -0.0689 ? 0.4714 ? -0.0038 ? 0.6565 ? 1.4587 ? -0.7585 ? 2.6895 ? 1.1734 ? -2.1719 ? 3.9758 ? -0.5239 ? 0.0130 ? 0.1969 ? -0.0207 ? -0.0247 ? -0.0647 ? -0.3266 ? 0.0102 ? -0.0000 ? 2 'X-RAY DIFFRACTION' ? refined -21.9843 70.5298 77.6199 0.8481 ? 0.0445 ? 0.0518 ? 0.6113 ? 0.0718 ? 0.7696 ? 0.4786 ? 1.6246 ? 3.4340 ? 0.8074 ? -0.4505 ? 1.0260 ? -0.0261 ? 0.1932 ? -0.0851 ? 0.1904 ? -0.3504 ? -0.0251 ? -0.8364 ? 0.7859 ? -0.0000 ? 3 'X-RAY DIFFRACTION' ? refined -25.0571 75.6185 63.5618 0.7365 ? 0.0092 ? -0.0247 ? 0.5540 ? 0.1105 ? 0.5836 ? 1.6233 ? 0.9548 ? 1.3201 ? 2.1610 ? 0.8150 ? 0.7666 ? -0.3666 ? 0.2613 ? 0.3907 ? -0.3299 ? -0.0391 ? 0.0145 ? -0.0769 ? 0.9005 ? 0.0000 ? 4 'X-RAY DIFFRACTION' ? refined -7.7956 51.7933 78.2214 0.7449 ? 0.3959 ? 0.1606 ? 0.9851 ? 0.0926 ? 0.5621 ? 1.0356 ? 0.2229 ? 1.9559 ? 3.1892 ? -0.5999 ? 1.3130 ? 0.3986 ? 0.9154 ? 0.1312 ? -0.3479 ? -0.7865 ? -0.0719 ? 0.1615 ? 1.0258 ? -0.0000 ? 5 'X-RAY DIFFRACTION' ? refined -14.3462 39.9170 84.7469 1.4194 ? 0.3563 ? 0.1244 ? 0.7695 ? -0.0658 ? 1.1174 ? 0.3490 ? -0.2861 ? 0.6825 ? 0.0787 ? -2.2945 ? -0.1652 ? -0.0528 ? 0.2525 ? -0.0135 ? -0.2821 ? 0.0098 ? 0.3970 ? -0.0348 ? 0.3823 ? 0.0000 ? 6 'X-RAY DIFFRACTION' ? refined -16.0637 59.2979 103.9713 0.5126 ? 0.1154 ? 0.0372 ? 0.6729 ? 0.0719 ? 0.6112 ? 1.8982 ? -0.7090 ? 1.3435 ? 1.2396 ? -2.8454 ? 4.2499 ? -0.2019 ? -0.3447 ? -0.0163 ? -0.1223 ? -0.3062 ? -0.0108 ? 0.1107 ? 0.3614 ? -0.0000 ? 7 'X-RAY DIFFRACTION' ? refined -26.9883 59.9101 86.7387 0.9040 ? 0.1667 ? -0.0131 ? 0.6760 ? -0.0138 ? 0.9351 ? 0.0449 ? -0.0714 ? -0.1983 ? -0.0870 ? -0.2581 ? 0.2217 ? 0.9562 ? 0.8176 ? -0.3600 ? 1.8977 ? -0.0223 ? -1.1305 ? -0.5628 ? -0.3037 ? 0.0000 ? 8 'X-RAY DIFFRACTION' ? refined -12.6747 61.3460 117.7172 0.6181 ? 0.0008 ? -0.1240 ? 0.9633 ? 0.1352 ? 0.7866 ? 0.6855 ? 1.1267 ? -0.2295 ? 1.1601 ? 0.1673 ? 0.5602 ? -0.0123 ? -0.2115 ? -0.1792 ? -0.1017 ? -0.3209 ? -0.5267 ? -0.6664 ? 1.2718 ? -0.0000 ? 9 'X-RAY DIFFRACTION' ? refined -16.4690 59.3857 111.4967 0.6145 ? 0.1270 ? 0.0012 ? 0.5819 ? 0.0624 ? 0.5333 ? 1.3257 ? -0.6292 ? -0.8992 ? -0.1466 ? -0.2268 ? 0.5895 ? 0.0726 ? -0.0588 ? -0.1322 ? 0.1608 ? -0.4287 ? -0.2126 ? -0.7093 ? 0.2385 ? -0.0000 ? 10 'X-RAY DIFFRACTION' ? refined -26.7052 84.8185 101.9290 1.6456 ? 0.2349 ? -0.1491 ? 0.0570 ? -0.1120 ? 0.5312 ? 2.7181 ? -0.5588 ? -0.8566 ? 0.0766 ? -1.2230 ? -3.7257 ? -0.3294 ? 0.2854 ? -0.1122 ? 1.6435 ? -0.5990 ? -0.2803 ? -2.0611 ? 1.8261 ? -0.0000 ? 11 'X-RAY DIFFRACTION' ? refined -40.7293 84.7868 95.6493 1.3258 ? 0.4389 ? 0.1537 ? 0.7271 ? -0.0364 ? 1.0649 ? 1.6781 ? 0.7223 ? 1.6569 ? 0.7375 ? -2.0296 ? 1.0477 ? -0.2762 ? 0.1731 ? -0.3073 ? 0.2057 ? 0.2816 ? 0.3726 ? -0.2199 ? 0.2891 ? -0.0000 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 5 ? ? A 63 ? ;chain 'A' and (resid 5 through 63 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 64 ? ? A 147 ? ;chain 'A' and (resid 64 through 147 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 148 ? ? A 187 ? ;chain 'A' and (resid 148 through 187 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 188 ? ? A 279 ? ;chain 'A' and (resid 188 through 279 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 280 ? ? A 326 ? ;chain 'A' and (resid 280 through 326 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? B 5 ? ? B 63 ? ;chain 'B' and (resid 5 through 63 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? B 64 ? ? B 132 ? ;chain 'B' and (resid 64 through 132 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? B 133 ? ? B 168 ? ;chain 'B' and (resid 133 through 168 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? B 169 ? ? B 188 ? ;chain 'B' and (resid 169 through 188 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? B 189 ? ? B 279 ? ;chain 'B' and (resid 189 through 279 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? B 280 ? ? B 325 ? ;chain 'B' and (resid 280 through 325 ) ; # _phasing.method MIR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14-3260 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 2017-05-29 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.32 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHARP ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? SOLOMON ? ? ? . 5 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 6 # _pdbx_entry_details.entry_id 6VJI _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 33 ? ? 56.87 71.51 2 1 SER A 148 ? ? 58.41 14.98 3 1 ASN B 33 ? ? 57.11 71.58 4 1 SER B 148 ? ? 59.55 15.78 5 1 ASN B 182 ? ? -108.29 65.59 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 8 ? CG ? A ARG 8 CG 2 1 Y 1 A ARG 8 ? CD ? A ARG 8 CD 3 1 Y 1 A ARG 8 ? NE ? A ARG 8 NE 4 1 Y 1 A ARG 8 ? CZ ? A ARG 8 CZ 5 1 Y 1 A ARG 8 ? NH1 ? A ARG 8 NH1 6 1 Y 1 A ARG 8 ? NH2 ? A ARG 8 NH2 7 1 Y 1 A LYS 9 ? CG ? A LYS 9 CG 8 1 Y 1 A LYS 9 ? CD ? A LYS 9 CD 9 1 Y 1 A LYS 9 ? CE ? A LYS 9 CE 10 1 Y 1 A LYS 9 ? NZ ? A LYS 9 NZ 11 1 Y 1 A GLN 12 ? CG ? A GLN 12 CG 12 1 Y 1 A GLN 12 ? CD ? A GLN 12 CD 13 1 Y 1 A GLN 12 ? OE1 ? A GLN 12 OE1 14 1 Y 1 A GLN 12 ? NE2 ? A GLN 12 NE2 15 1 Y 1 A LYS 30 ? CG ? A LYS 30 CG 16 1 Y 1 A LYS 30 ? CD ? A LYS 30 CD 17 1 Y 1 A LYS 30 ? CE ? A LYS 30 CE 18 1 Y 1 A LYS 30 ? NZ ? A LYS 30 NZ 19 1 Y 1 A LYS 50 ? CG ? A LYS 50 CG 20 1 Y 1 A LYS 50 ? CD ? A LYS 50 CD 21 1 Y 1 A LYS 50 ? CE ? A LYS 50 CE 22 1 Y 1 A LYS 50 ? NZ ? A LYS 50 NZ 23 1 Y 1 A LEU 69 ? CG ? A LEU 69 CG 24 1 Y 1 A LEU 69 ? CD1 ? A LEU 69 CD1 25 1 Y 1 A LEU 69 ? CD2 ? A LEU 69 CD2 26 1 Y 1 A ASN 130 ? CG ? A ASN 130 CG 27 1 Y 1 A ASN 130 ? OD1 ? A ASN 130 OD1 28 1 Y 1 A ASN 130 ? ND2 ? A ASN 130 ND2 29 1 Y 1 A ARG 152 ? CD ? A ARG 152 CD 30 1 Y 1 A ARG 152 ? NE ? A ARG 152 NE 31 1 Y 1 A ARG 152 ? CZ ? A ARG 152 CZ 32 1 Y 1 A ARG 152 ? NH1 ? A ARG 152 NH1 33 1 Y 1 A ARG 152 ? NH2 ? A ARG 152 NH2 34 1 Y 1 A LYS 155 ? CG ? A LYS 155 CG 35 1 Y 1 A LYS 155 ? CD ? A LYS 155 CD 36 1 Y 1 A LYS 155 ? CE ? A LYS 155 CE 37 1 Y 1 A LYS 155 ? NZ ? A LYS 155 NZ 38 1 Y 1 A LYS 163 ? CG ? A LYS 163 CG 39 1 Y 1 A LYS 163 ? CD ? A LYS 163 CD 40 1 Y 1 A LYS 163 ? CE ? A LYS 163 CE 41 1 Y 1 A LYS 163 ? NZ ? A LYS 163 NZ 42 1 Y 1 A ARG 168 ? CG ? A ARG 168 CG 43 1 Y 1 A ARG 168 ? CD ? A ARG 168 CD 44 1 Y 1 A ARG 168 ? NE ? A ARG 168 NE 45 1 Y 1 A ARG 168 ? CZ ? A ARG 168 CZ 46 1 Y 1 A ARG 168 ? NH1 ? A ARG 168 NH1 47 1 Y 1 A ARG 168 ? NH2 ? A ARG 168 NH2 48 1 Y 1 A LYS 175 ? CG ? A LYS 175 CG 49 1 Y 1 A LYS 175 ? CD ? A LYS 175 CD 50 1 Y 1 A LYS 175 ? CE ? A LYS 175 CE 51 1 Y 1 A LYS 175 ? NZ ? A LYS 175 NZ 52 1 Y 1 A ARG 184 ? CG ? A ARG 184 CG 53 1 Y 1 A ARG 184 ? CD ? A ARG 184 CD 54 1 Y 1 A ARG 184 ? NE ? A ARG 184 NE 55 1 Y 1 A ARG 184 ? CZ ? A ARG 184 CZ 56 1 Y 1 A ARG 184 ? NH1 ? A ARG 184 NH1 57 1 Y 1 A ARG 184 ? NH2 ? A ARG 184 NH2 58 1 Y 1 A LYS 194 ? CG ? A LYS 194 CG 59 1 Y 1 A LYS 194 ? CD ? A LYS 194 CD 60 1 Y 1 A LYS 194 ? CE ? A LYS 194 CE 61 1 Y 1 A LYS 194 ? NZ ? A LYS 194 NZ 62 1 Y 1 A GLU 203 ? CG ? A GLU 203 CG 63 1 Y 1 A GLU 203 ? CD ? A GLU 203 CD 64 1 Y 1 A GLU 203 ? OE1 ? A GLU 203 OE1 65 1 Y 1 A GLU 203 ? OE2 ? A GLU 203 OE2 66 1 Y 1 A ARG 207 ? CG ? A ARG 207 CG 67 1 Y 1 A ARG 207 ? CD ? A ARG 207 CD 68 1 Y 1 A ARG 207 ? NE ? A ARG 207 NE 69 1 Y 1 A ARG 207 ? CZ ? A ARG 207 CZ 70 1 Y 1 A ARG 207 ? NH1 ? A ARG 207 NH1 71 1 Y 1 A ARG 207 ? NH2 ? A ARG 207 NH2 72 1 Y 1 A LYS 214 ? CG ? A LYS 214 CG 73 1 Y 1 A LYS 214 ? CD ? A LYS 214 CD 74 1 Y 1 A LYS 214 ? CE ? A LYS 214 CE 75 1 Y 1 A LYS 214 ? NZ ? A LYS 214 NZ 76 1 Y 1 A GLN 215 ? CG ? A GLN 215 CG 77 1 Y 1 A GLN 215 ? CD ? A GLN 215 CD 78 1 Y 1 A GLN 215 ? OE1 ? A GLN 215 OE1 79 1 Y 1 A GLN 215 ? NE2 ? A GLN 215 NE2 80 1 Y 1 A ARG 227 ? CG ? A ARG 227 CG 81 1 Y 1 A ARG 227 ? CD ? A ARG 227 CD 82 1 Y 1 A ARG 227 ? NE ? A ARG 227 NE 83 1 Y 1 A ARG 227 ? CZ ? A ARG 227 CZ 84 1 Y 1 A ARG 227 ? NH1 ? A ARG 227 NH1 85 1 Y 1 A ARG 227 ? NH2 ? A ARG 227 NH2 86 1 Y 1 A LEU 260 ? CG ? A LEU 260 CG 87 1 Y 1 A LEU 260 ? CD1 ? A LEU 260 CD1 88 1 Y 1 A LEU 260 ? CD2 ? A LEU 260 CD2 89 1 Y 1 A GLU 261 ? CG ? A GLU 261 CG 90 1 Y 1 A GLU 261 ? CD ? A GLU 261 CD 91 1 Y 1 A GLU 261 ? OE1 ? A GLU 261 OE1 92 1 Y 1 A GLU 261 ? OE2 ? A GLU 261 OE2 93 1 Y 1 A LYS 277 ? CG ? A LYS 277 CG 94 1 Y 1 A LYS 277 ? CD ? A LYS 277 CD 95 1 Y 1 A LYS 277 ? CE ? A LYS 277 CE 96 1 Y 1 A LYS 277 ? NZ ? A LYS 277 NZ 97 1 Y 1 A LYS 282 ? CG ? A LYS 282 CG 98 1 Y 1 A LYS 282 ? CD ? A LYS 282 CD 99 1 Y 1 A LYS 282 ? CE ? A LYS 282 CE 100 1 Y 1 A LYS 282 ? NZ ? A LYS 282 NZ 101 1 Y 1 A LYS 291 ? CG ? A LYS 291 CG 102 1 Y 1 A LYS 291 ? CD ? A LYS 291 CD 103 1 Y 1 A LYS 291 ? CE ? A LYS 291 CE 104 1 Y 1 A LYS 291 ? NZ ? A LYS 291 NZ 105 1 Y 1 A GLU 292 ? CG ? A GLU 292 CG 106 1 Y 1 A GLU 292 ? CD ? A GLU 292 CD 107 1 Y 1 A GLU 292 ? OE1 ? A GLU 292 OE1 108 1 Y 1 A GLU 292 ? OE2 ? A GLU 292 OE2 109 1 Y 1 A GLN 293 ? CG ? A GLN 293 CG 110 1 Y 1 A GLN 293 ? CD ? A GLN 293 CD 111 1 Y 1 A GLN 293 ? OE1 ? A GLN 293 OE1 112 1 Y 1 A GLN 293 ? NE2 ? A GLN 293 NE2 113 1 Y 1 A GLN 299 ? CG ? A GLN 299 CG 114 1 Y 1 A GLN 299 ? CD ? A GLN 299 CD 115 1 Y 1 A GLN 299 ? OE1 ? A GLN 299 OE1 116 1 Y 1 A GLN 299 ? NE2 ? A GLN 299 NE2 117 1 Y 1 A LYS 302 ? CG ? A LYS 302 CG 118 1 Y 1 A LYS 302 ? CD ? A LYS 302 CD 119 1 Y 1 A LYS 302 ? CE ? A LYS 302 CE 120 1 Y 1 A LYS 302 ? NZ ? A LYS 302 NZ 121 1 Y 1 A HIS 320 ? CG ? A HIS 320 CG 122 1 Y 1 A HIS 320 ? ND1 ? A HIS 320 ND1 123 1 Y 1 A HIS 320 ? CD2 ? A HIS 320 CD2 124 1 Y 1 A HIS 320 ? CE1 ? A HIS 320 CE1 125 1 Y 1 A HIS 320 ? NE2 ? A HIS 320 NE2 126 1 Y 1 A GLU 326 ? CG ? A GLU 326 CG 127 1 Y 1 A GLU 326 ? CD ? A GLU 326 CD 128 1 Y 1 A GLU 326 ? OE1 ? A GLU 326 OE1 129 1 Y 1 A GLU 326 ? OE2 ? A GLU 326 OE2 130 1 Y 1 B ARG 8 ? CG ? B ARG 8 CG 131 1 Y 1 B ARG 8 ? CD ? B ARG 8 CD 132 1 Y 1 B ARG 8 ? NE ? B ARG 8 NE 133 1 Y 1 B ARG 8 ? CZ ? B ARG 8 CZ 134 1 Y 1 B ARG 8 ? NH1 ? B ARG 8 NH1 135 1 Y 1 B ARG 8 ? NH2 ? B ARG 8 NH2 136 1 Y 1 B LYS 9 ? CG ? B LYS 9 CG 137 1 Y 1 B LYS 9 ? CD ? B LYS 9 CD 138 1 Y 1 B LYS 9 ? CE ? B LYS 9 CE 139 1 Y 1 B LYS 9 ? NZ ? B LYS 9 NZ 140 1 Y 1 B GLN 12 ? CG ? B GLN 12 CG 141 1 Y 1 B GLN 12 ? CD ? B GLN 12 CD 142 1 Y 1 B GLN 12 ? OE1 ? B GLN 12 OE1 143 1 Y 1 B GLN 12 ? NE2 ? B GLN 12 NE2 144 1 Y 1 B LYS 30 ? CG ? B LYS 30 CG 145 1 Y 1 B LYS 30 ? CD ? B LYS 30 CD 146 1 Y 1 B LYS 30 ? CE ? B LYS 30 CE 147 1 Y 1 B LYS 30 ? NZ ? B LYS 30 NZ 148 1 Y 1 B LYS 50 ? CG ? B LYS 50 CG 149 1 Y 1 B LYS 50 ? CD ? B LYS 50 CD 150 1 Y 1 B LYS 50 ? CE ? B LYS 50 CE 151 1 Y 1 B LYS 50 ? NZ ? B LYS 50 NZ 152 1 Y 1 B GLU 66 ? CG ? B GLU 66 CG 153 1 Y 1 B GLU 66 ? CD ? B GLU 66 CD 154 1 Y 1 B GLU 66 ? OE1 ? B GLU 66 OE1 155 1 Y 1 B GLU 66 ? OE2 ? B GLU 66 OE2 156 1 Y 1 B ASN 130 ? CG ? B ASN 130 CG 157 1 Y 1 B ASN 130 ? OD1 ? B ASN 130 OD1 158 1 Y 1 B ASN 130 ? ND2 ? B ASN 130 ND2 159 1 Y 1 B TRP 162 ? CG ? B TRP 162 CG 160 1 Y 1 B TRP 162 ? CD1 ? B TRP 162 CD1 161 1 Y 1 B TRP 162 ? CD2 ? B TRP 162 CD2 162 1 Y 1 B TRP 162 ? NE1 ? B TRP 162 NE1 163 1 Y 1 B TRP 162 ? CE2 ? B TRP 162 CE2 164 1 Y 1 B TRP 162 ? CE3 ? B TRP 162 CE3 165 1 Y 1 B TRP 162 ? CZ2 ? B TRP 162 CZ2 166 1 Y 1 B TRP 162 ? CZ3 ? B TRP 162 CZ3 167 1 Y 1 B TRP 162 ? CH2 ? B TRP 162 CH2 168 1 Y 1 B LYS 163 ? CG ? B LYS 163 CG 169 1 Y 1 B LYS 163 ? CD ? B LYS 163 CD 170 1 Y 1 B LYS 163 ? CE ? B LYS 163 CE 171 1 Y 1 B LYS 163 ? NZ ? B LYS 163 NZ 172 1 Y 1 B LYS 175 ? CG ? B LYS 175 CG 173 1 Y 1 B LYS 175 ? CD ? B LYS 175 CD 174 1 Y 1 B LYS 175 ? CE ? B LYS 175 CE 175 1 Y 1 B LYS 175 ? NZ ? B LYS 175 NZ 176 1 Y 1 B ARG 184 ? CG ? B ARG 184 CG 177 1 Y 1 B ARG 184 ? CD ? B ARG 184 CD 178 1 Y 1 B ARG 184 ? NE ? B ARG 184 NE 179 1 Y 1 B ARG 184 ? CZ ? B ARG 184 CZ 180 1 Y 1 B ARG 184 ? NH1 ? B ARG 184 NH1 181 1 Y 1 B ARG 184 ? NH2 ? B ARG 184 NH2 182 1 Y 1 B LYS 194 ? CD ? B LYS 194 CD 183 1 Y 1 B LYS 194 ? CE ? B LYS 194 CE 184 1 Y 1 B LYS 194 ? NZ ? B LYS 194 NZ 185 1 Y 1 B GLU 202 ? CG ? B GLU 202 CG 186 1 Y 1 B GLU 202 ? CD ? B GLU 202 CD 187 1 Y 1 B GLU 202 ? OE1 ? B GLU 202 OE1 188 1 Y 1 B GLU 202 ? OE2 ? B GLU 202 OE2 189 1 Y 1 B GLU 203 ? CG ? B GLU 203 CG 190 1 Y 1 B GLU 203 ? CD ? B GLU 203 CD 191 1 Y 1 B GLU 203 ? OE1 ? B GLU 203 OE1 192 1 Y 1 B GLU 203 ? OE2 ? B GLU 203 OE2 193 1 Y 1 B ARG 207 ? CG ? B ARG 207 CG 194 1 Y 1 B ARG 207 ? CD ? B ARG 207 CD 195 1 Y 1 B ARG 207 ? NE ? B ARG 207 NE 196 1 Y 1 B ARG 207 ? CZ ? B ARG 207 CZ 197 1 Y 1 B ARG 207 ? NH1 ? B ARG 207 NH1 198 1 Y 1 B ARG 207 ? NH2 ? B ARG 207 NH2 199 1 Y 1 B GLU 211 ? CG ? B GLU 211 CG 200 1 Y 1 B GLU 211 ? CD ? B GLU 211 CD 201 1 Y 1 B GLU 211 ? OE1 ? B GLU 211 OE1 202 1 Y 1 B GLU 211 ? OE2 ? B GLU 211 OE2 203 1 Y 1 B LYS 214 ? CG ? B LYS 214 CG 204 1 Y 1 B LYS 214 ? CD ? B LYS 214 CD 205 1 Y 1 B LYS 214 ? CE ? B LYS 214 CE 206 1 Y 1 B LYS 214 ? NZ ? B LYS 214 NZ 207 1 Y 1 B GLN 215 ? CG ? B GLN 215 CG 208 1 Y 1 B GLN 215 ? CD ? B GLN 215 CD 209 1 Y 1 B GLN 215 ? OE1 ? B GLN 215 OE1 210 1 Y 1 B GLN 215 ? NE2 ? B GLN 215 NE2 211 1 Y 1 B ARG 227 ? CG ? B ARG 227 CG 212 1 Y 1 B ARG 227 ? CD ? B ARG 227 CD 213 1 Y 1 B ARG 227 ? NE ? B ARG 227 NE 214 1 Y 1 B ARG 227 ? CZ ? B ARG 227 CZ 215 1 Y 1 B ARG 227 ? NH1 ? B ARG 227 NH1 216 1 Y 1 B ARG 227 ? NH2 ? B ARG 227 NH2 217 1 Y 1 B ARG 245 ? CG ? B ARG 245 CG 218 1 Y 1 B ARG 245 ? CD ? B ARG 245 CD 219 1 Y 1 B ARG 245 ? NE ? B ARG 245 NE 220 1 Y 1 B ARG 245 ? CZ ? B ARG 245 CZ 221 1 Y 1 B ARG 245 ? NH1 ? B ARG 245 NH1 222 1 Y 1 B ARG 245 ? NH2 ? B ARG 245 NH2 223 1 Y 1 B CYS 254 ? SG ? B CYS 254 SG 224 1 Y 1 B LEU 260 ? CG ? B LEU 260 CG 225 1 Y 1 B LEU 260 ? CD1 ? B LEU 260 CD1 226 1 Y 1 B LEU 260 ? CD2 ? B LEU 260 CD2 227 1 Y 1 B LYS 277 ? CG ? B LYS 277 CG 228 1 Y 1 B LYS 277 ? CD ? B LYS 277 CD 229 1 Y 1 B LYS 277 ? CE ? B LYS 277 CE 230 1 Y 1 B LYS 277 ? NZ ? B LYS 277 NZ 231 1 Y 1 B LYS 282 ? CG ? B LYS 282 CG 232 1 Y 1 B LYS 282 ? CD ? B LYS 282 CD 233 1 Y 1 B LYS 282 ? CE ? B LYS 282 CE 234 1 Y 1 B LYS 282 ? NZ ? B LYS 282 NZ 235 1 Y 1 B HIS 285 ? CG ? B HIS 285 CG 236 1 Y 1 B HIS 285 ? ND1 ? B HIS 285 ND1 237 1 Y 1 B HIS 285 ? CD2 ? B HIS 285 CD2 238 1 Y 1 B HIS 285 ? CE1 ? B HIS 285 CE1 239 1 Y 1 B HIS 285 ? NE2 ? B HIS 285 NE2 240 1 Y 1 B LYS 291 ? CG ? B LYS 291 CG 241 1 Y 1 B LYS 291 ? CD ? B LYS 291 CD 242 1 Y 1 B LYS 291 ? CE ? B LYS 291 CE 243 1 Y 1 B LYS 291 ? NZ ? B LYS 291 NZ 244 1 Y 1 B GLU 292 ? CG ? B GLU 292 CG 245 1 Y 1 B GLU 292 ? CD ? B GLU 292 CD 246 1 Y 1 B GLU 292 ? OE1 ? B GLU 292 OE1 247 1 Y 1 B GLU 292 ? OE2 ? B GLU 292 OE2 248 1 Y 1 B GLN 293 ? CG ? B GLN 293 CG 249 1 Y 1 B GLN 293 ? CD ? B GLN 293 CD 250 1 Y 1 B GLN 293 ? OE1 ? B GLN 293 OE1 251 1 Y 1 B GLN 293 ? NE2 ? B GLN 293 NE2 252 1 Y 1 B GLN 299 ? CD ? B GLN 299 CD 253 1 Y 1 B GLN 299 ? OE1 ? B GLN 299 OE1 254 1 Y 1 B GLN 299 ? NE2 ? B GLN 299 NE2 255 1 Y 1 B LYS 302 ? CG ? B LYS 302 CG 256 1 Y 1 B LYS 302 ? CD ? B LYS 302 CD 257 1 Y 1 B LYS 302 ? CE ? B LYS 302 CE 258 1 Y 1 B LYS 302 ? NZ ? B LYS 302 NZ 259 1 Y 1 B GLN 312 ? CG ? B GLN 312 CG 260 1 Y 1 B GLN 312 ? CD ? B GLN 312 CD 261 1 Y 1 B GLN 312 ? OE1 ? B GLN 312 OE1 262 1 Y 1 B GLN 312 ? NE2 ? B GLN 312 NE2 263 1 Y 1 B LYS 324 ? CG ? B LYS 324 CG 264 1 Y 1 B LYS 324 ? CD ? B LYS 324 CD 265 1 Y 1 B LYS 324 ? CE ? B LYS 324 CE 266 1 Y 1 B LYS 324 ? NZ ? B LYS 324 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A GLY 4 ? A GLY 4 5 1 Y 1 A LYS 72 ? A LYS 72 6 1 Y 1 A HIS 73 ? A HIS 73 7 1 Y 1 A LEU 74 ? A LEU 74 8 1 Y 1 A GLN 75 ? A GLN 75 9 1 Y 1 A LYS 76 ? A LYS 76 10 1 Y 1 A LYS 77 ? A LYS 77 11 1 Y 1 A VAL 78 ? A VAL 78 12 1 Y 1 A ARG 79 ? A ARG 79 13 1 Y 1 A LEU 80 ? A LEU 80 14 1 Y 1 A PRO 81 ? A PRO 81 15 1 Y 1 A LYS 82 ? A LYS 82 16 1 Y 1 A GLU 83 ? A GLU 83 17 1 Y 1 A LYS 84 ? A LYS 84 18 1 Y 1 A SER 85 ? A SER 85 19 1 Y 1 A ASP 86 ? A ASP 86 20 1 Y 1 A HIS 87 ? A HIS 87 21 1 Y 1 A LYS 88 ? A LYS 88 22 1 Y 1 A LEU 89 ? A LEU 89 23 1 Y 1 A GLU 90 ? A GLU 90 24 1 Y 1 A THR 91 ? A THR 91 25 1 Y 1 A THR 92 ? A THR 92 26 1 Y 1 A SER 93 ? A SER 93 27 1 Y 1 A ARG 94 ? A ARG 94 28 1 Y 1 A LEU 95 ? A LEU 95 29 1 Y 1 A ASP 96 ? A ASP 96 30 1 Y 1 A GLY 97 ? A GLY 97 31 1 Y 1 A GLN 98 ? A GLN 98 32 1 Y 1 A GLU 99 ? A GLU 99 33 1 Y 1 A VAL 100 ? A VAL 100 34 1 Y 1 A PRO 101 ? A PRO 101 35 1 Y 1 A GLY 102 ? A GLY 102 36 1 Y 1 A SER 103 ? A SER 103 37 1 Y 1 A SER 104 ? A SER 104 38 1 Y 1 A LEU 105 ? A LEU 105 39 1 Y 1 A ALA 106 ? A ALA 106 40 1 Y 1 A ILE 107 ? A ILE 107 41 1 Y 1 A LYS 108 ? A LYS 108 42 1 Y 1 A ALA 109 ? A ALA 109 43 1 Y 1 A LEU 110 ? A LEU 110 44 1 Y 1 A GLU 111 ? A GLU 111 45 1 Y 1 A LEU 112 ? A LEU 112 46 1 Y 1 A GLY 113 ? A GLY 113 47 1 Y 1 A GLU 114 ? A GLU 114 48 1 Y 1 A GLU 115 ? A GLU 115 49 1 Y 1 A GLU 116 ? A GLU 116 50 1 Y 1 A LYS 117 ? A LYS 117 51 1 Y 1 A GLU 118 ? A GLU 118 52 1 Y 1 A THR 119 ? A THR 119 53 1 Y 1 A VAL 120 ? A VAL 120 54 1 Y 1 A MSE 121 ? A MSE 121 55 1 Y 1 A PRO 122 ? A PRO 122 56 1 Y 1 A TRP 123 ? A TRP 123 57 1 Y 1 A TRP 124 ? A TRP 124 58 1 Y 1 A LEU 125 ? A LEU 125 59 1 Y 1 A ASN 126 ? A ASN 126 60 1 Y 1 A THR 127 ? A THR 127 61 1 Y 1 A SER 128 ? A SER 128 62 1 Y 1 A GLN 129 ? A GLN 129 63 1 Y 1 A ASN 157 ? A ASN 157 64 1 Y 1 A LYS 158 ? A LYS 158 65 1 Y 1 A ARG 159 ? A ARG 159 66 1 Y 1 A GLY 160 ? A GLY 160 67 1 Y 1 A ASP 161 ? A ASP 161 68 1 Y 1 A TRP 162 ? A TRP 162 69 1 Y 1 A PRO 308 ? A PRO 308 70 1 Y 1 A GLY 309 ? A GLY 309 71 1 Y 1 A SER 310 ? A SER 310 72 1 Y 1 A GLU 327 ? A GLU 327 73 1 Y 1 A LYS 328 ? A LYS 328 74 1 Y 1 A VAL 329 ? A VAL 329 75 1 Y 1 A GLU 330 ? A GLU 330 76 1 Y 1 A VAL 331 ? A VAL 331 77 1 Y 1 A THR 332 ? A THR 332 78 1 Y 1 A GLN 333 ? A GLN 333 79 1 Y 1 A GLU 334 ? A GLU 334 80 1 Y 1 A GLN 335 ? A GLN 335 81 1 Y 1 A LEU 336 ? A LEU 336 82 1 Y 1 A LEU 337 ? A LEU 337 83 1 Y 1 A GLU 338 ? A GLU 338 84 1 Y 1 A HIS 339 ? A HIS 339 85 1 Y 1 A HIS 340 ? A HIS 340 86 1 Y 1 A HIS 341 ? A HIS 341 87 1 Y 1 A HIS 342 ? A HIS 342 88 1 Y 1 A HIS 343 ? A HIS 343 89 1 Y 1 A HIS 344 ? A HIS 344 90 1 Y 1 B MSE 1 ? B MSE 1 91 1 Y 1 B PRO 2 ? B PRO 2 92 1 Y 1 B GLU 3 ? B GLU 3 93 1 Y 1 B GLY 4 ? B GLY 4 94 1 Y 1 B LYS 72 ? B LYS 72 95 1 Y 1 B HIS 73 ? B HIS 73 96 1 Y 1 B LEU 74 ? B LEU 74 97 1 Y 1 B GLN 75 ? B GLN 75 98 1 Y 1 B LYS 76 ? B LYS 76 99 1 Y 1 B LYS 77 ? B LYS 77 100 1 Y 1 B VAL 78 ? B VAL 78 101 1 Y 1 B ARG 79 ? B ARG 79 102 1 Y 1 B LEU 80 ? B LEU 80 103 1 Y 1 B PRO 81 ? B PRO 81 104 1 Y 1 B LYS 82 ? B LYS 82 105 1 Y 1 B GLU 83 ? B GLU 83 106 1 Y 1 B LYS 84 ? B LYS 84 107 1 Y 1 B SER 85 ? B SER 85 108 1 Y 1 B ASP 86 ? B ASP 86 109 1 Y 1 B HIS 87 ? B HIS 87 110 1 Y 1 B LYS 88 ? B LYS 88 111 1 Y 1 B LEU 89 ? B LEU 89 112 1 Y 1 B GLU 90 ? B GLU 90 113 1 Y 1 B THR 91 ? B THR 91 114 1 Y 1 B THR 92 ? B THR 92 115 1 Y 1 B SER 93 ? B SER 93 116 1 Y 1 B ARG 94 ? B ARG 94 117 1 Y 1 B LEU 95 ? B LEU 95 118 1 Y 1 B ASP 96 ? B ASP 96 119 1 Y 1 B GLY 97 ? B GLY 97 120 1 Y 1 B GLN 98 ? B GLN 98 121 1 Y 1 B GLU 99 ? B GLU 99 122 1 Y 1 B VAL 100 ? B VAL 100 123 1 Y 1 B PRO 101 ? B PRO 101 124 1 Y 1 B GLY 102 ? B GLY 102 125 1 Y 1 B SER 103 ? B SER 103 126 1 Y 1 B SER 104 ? B SER 104 127 1 Y 1 B LEU 105 ? B LEU 105 128 1 Y 1 B ALA 106 ? B ALA 106 129 1 Y 1 B ILE 107 ? B ILE 107 130 1 Y 1 B LYS 108 ? B LYS 108 131 1 Y 1 B ALA 109 ? B ALA 109 132 1 Y 1 B LEU 110 ? B LEU 110 133 1 Y 1 B GLU 111 ? B GLU 111 134 1 Y 1 B LEU 112 ? B LEU 112 135 1 Y 1 B GLY 113 ? B GLY 113 136 1 Y 1 B GLU 114 ? B GLU 114 137 1 Y 1 B GLU 115 ? B GLU 115 138 1 Y 1 B GLU 116 ? B GLU 116 139 1 Y 1 B LYS 117 ? B LYS 117 140 1 Y 1 B GLU 118 ? B GLU 118 141 1 Y 1 B THR 119 ? B THR 119 142 1 Y 1 B VAL 120 ? B VAL 120 143 1 Y 1 B MSE 121 ? B MSE 121 144 1 Y 1 B PRO 122 ? B PRO 122 145 1 Y 1 B TRP 123 ? B TRP 123 146 1 Y 1 B TRP 124 ? B TRP 124 147 1 Y 1 B LEU 125 ? B LEU 125 148 1 Y 1 B ASN 126 ? B ASN 126 149 1 Y 1 B THR 127 ? B THR 127 150 1 Y 1 B SER 128 ? B SER 128 151 1 Y 1 B GLN 129 ? B GLN 129 152 1 Y 1 B LYS 155 ? B LYS 155 153 1 Y 1 B ALA 156 ? B ALA 156 154 1 Y 1 B ASN 157 ? B ASN 157 155 1 Y 1 B LYS 158 ? B LYS 158 156 1 Y 1 B ARG 159 ? B ARG 159 157 1 Y 1 B GLY 160 ? B GLY 160 158 1 Y 1 B ASP 161 ? B ASP 161 159 1 Y 1 B PRO 308 ? B PRO 308 160 1 Y 1 B GLY 309 ? B GLY 309 161 1 Y 1 B SER 310 ? B SER 310 162 1 Y 1 B GLU 326 ? B GLU 326 163 1 Y 1 B GLU 327 ? B GLU 327 164 1 Y 1 B LYS 328 ? B LYS 328 165 1 Y 1 B VAL 329 ? B VAL 329 166 1 Y 1 B GLU 330 ? B GLU 330 167 1 Y 1 B VAL 331 ? B VAL 331 168 1 Y 1 B THR 332 ? B THR 332 169 1 Y 1 B GLN 333 ? B GLN 333 170 1 Y 1 B GLU 334 ? B GLU 334 171 1 Y 1 B GLN 335 ? B GLN 335 172 1 Y 1 B LEU 336 ? B LEU 336 173 1 Y 1 B LEU 337 ? B LEU 337 174 1 Y 1 B GLU 338 ? B GLU 338 175 1 Y 1 B HIS 339 ? B HIS 339 176 1 Y 1 B HIS 340 ? B HIS 340 177 1 Y 1 B HIS 341 ? B HIS 341 178 1 Y 1 B HIS 342 ? B HIS 342 179 1 Y 1 B HIS 343 ? B HIS 343 180 1 Y 1 B HIS 344 ? B HIS 344 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' CA098993 1 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' CA233185 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details ? #