data_6WCX # _entry.id 6WCX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6WCX pdb_00006wcx 10.2210/pdb6wcx/pdb WWPDB D_1000248052 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6WCX _pdbx_database_status.recvd_initial_deposition_date 2020-03-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fellner, M.' 1 0000-0003-3192-6984 'Mace, P.D.' 2 0000-0003-2175-9537 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Infect Dis.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2373-8227 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first 2771 _citation.page_last 2782 _citation.title 'Structural Basis for the Inhibitor and Substrate Specificity of the Unique Fph Serine Hydrolases of Staphylococcus aureus .' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsinfecdis.0c00503 _citation.pdbx_database_id_PubMed 32865965 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fellner, M.' 1 ? primary 'Lentz, C.S.' 2 ? primary 'Jamieson, S.A.' 3 ? primary 'Brewster, J.L.' 4 ? primary 'Chen, L.' 5 ? primary 'Bogyo, M.' 6 ? primary 'Mace, P.D.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6WCX _cell.details ? _cell.formula_units_Z ? _cell.length_a 86.957 _cell.length_a_esd ? _cell.length_b 86.957 _cell.length_b_esd ? _cell.length_c 454.712 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 48 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6WCX _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Esterase family protein' 29205.822 4 3.1.2.12 'N-terminal GPG from expression tag' ? ? 2 non-polymer syn HEPTAN-1-OL 116.201 4 ? ? ? ? 3 water nat water 18.015 17 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Putative esterase,Tributyrin esterase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGAYISLNYHSPTIGMHQNLTVILPEDQSFFNSDTTVKPLKTLMLLHGLSSDETTYMRYTSIERYANEHKLAVIMPNVD HSAYANMAYGHSYYDYILEVYDYVHQIFPLSKKRDDNFIAGHSMGGYGTIKFALTQGDKFAKAVPLSAVFEAQNLMDLEW NDFSKEAIIGNLSSVKGTEHDPYYLLDKAVAEDKQIPKLLIMCGKQDFLYQDNLDFIDYLSRINVPYQFEDGPGDHDYAY WDQAIKRAITWMVND ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGAYISLNYHSPTIGMHQNLTVILPEDQSFFNSDTTVKPLKTLMLLHGLSSDETTYMRYTSIERYANEHKLAVIMPNVD HSAYANMAYGHSYYDYILEVYDYVHQIFPLSKKRDDNFIAGHSMGGYGTIKFALTQGDKFAKAVPLSAVFEAQNLMDLEW NDFSKEAIIGNLSSVKGTEHDPYYLLDKAVAEDKQIPKLLIMCGKQDFLYQDNLDFIDYLSRINVPYQFEDGPGDHDYAY WDQAIKRAITWMVND ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 ALA n 1 5 TYR n 1 6 ILE n 1 7 SER n 1 8 LEU n 1 9 ASN n 1 10 TYR n 1 11 HIS n 1 12 SER n 1 13 PRO n 1 14 THR n 1 15 ILE n 1 16 GLY n 1 17 MET n 1 18 HIS n 1 19 GLN n 1 20 ASN n 1 21 LEU n 1 22 THR n 1 23 VAL n 1 24 ILE n 1 25 LEU n 1 26 PRO n 1 27 GLU n 1 28 ASP n 1 29 GLN n 1 30 SER n 1 31 PHE n 1 32 PHE n 1 33 ASN n 1 34 SER n 1 35 ASP n 1 36 THR n 1 37 THR n 1 38 VAL n 1 39 LYS n 1 40 PRO n 1 41 LEU n 1 42 LYS n 1 43 THR n 1 44 LEU n 1 45 MET n 1 46 LEU n 1 47 LEU n 1 48 HIS n 1 49 GLY n 1 50 LEU n 1 51 SER n 1 52 SER n 1 53 ASP n 1 54 GLU n 1 55 THR n 1 56 THR n 1 57 TYR n 1 58 MET n 1 59 ARG n 1 60 TYR n 1 61 THR n 1 62 SER n 1 63 ILE n 1 64 GLU n 1 65 ARG n 1 66 TYR n 1 67 ALA n 1 68 ASN n 1 69 GLU n 1 70 HIS n 1 71 LYS n 1 72 LEU n 1 73 ALA n 1 74 VAL n 1 75 ILE n 1 76 MET n 1 77 PRO n 1 78 ASN n 1 79 VAL n 1 80 ASP n 1 81 HIS n 1 82 SER n 1 83 ALA n 1 84 TYR n 1 85 ALA n 1 86 ASN n 1 87 MET n 1 88 ALA n 1 89 TYR n 1 90 GLY n 1 91 HIS n 1 92 SER n 1 93 TYR n 1 94 TYR n 1 95 ASP n 1 96 TYR n 1 97 ILE n 1 98 LEU n 1 99 GLU n 1 100 VAL n 1 101 TYR n 1 102 ASP n 1 103 TYR n 1 104 VAL n 1 105 HIS n 1 106 GLN n 1 107 ILE n 1 108 PHE n 1 109 PRO n 1 110 LEU n 1 111 SER n 1 112 LYS n 1 113 LYS n 1 114 ARG n 1 115 ASP n 1 116 ASP n 1 117 ASN n 1 118 PHE n 1 119 ILE n 1 120 ALA n 1 121 GLY n 1 122 HIS n 1 123 SER n 1 124 MET n 1 125 GLY n 1 126 GLY n 1 127 TYR n 1 128 GLY n 1 129 THR n 1 130 ILE n 1 131 LYS n 1 132 PHE n 1 133 ALA n 1 134 LEU n 1 135 THR n 1 136 GLN n 1 137 GLY n 1 138 ASP n 1 139 LYS n 1 140 PHE n 1 141 ALA n 1 142 LYS n 1 143 ALA n 1 144 VAL n 1 145 PRO n 1 146 LEU n 1 147 SER n 1 148 ALA n 1 149 VAL n 1 150 PHE n 1 151 GLU n 1 152 ALA n 1 153 GLN n 1 154 ASN n 1 155 LEU n 1 156 MET n 1 157 ASP n 1 158 LEU n 1 159 GLU n 1 160 TRP n 1 161 ASN n 1 162 ASP n 1 163 PHE n 1 164 SER n 1 165 LYS n 1 166 GLU n 1 167 ALA n 1 168 ILE n 1 169 ILE n 1 170 GLY n 1 171 ASN n 1 172 LEU n 1 173 SER n 1 174 SER n 1 175 VAL n 1 176 LYS n 1 177 GLY n 1 178 THR n 1 179 GLU n 1 180 HIS n 1 181 ASP n 1 182 PRO n 1 183 TYR n 1 184 TYR n 1 185 LEU n 1 186 LEU n 1 187 ASP n 1 188 LYS n 1 189 ALA n 1 190 VAL n 1 191 ALA n 1 192 GLU n 1 193 ASP n 1 194 LYS n 1 195 GLN n 1 196 ILE n 1 197 PRO n 1 198 LYS n 1 199 LEU n 1 200 LEU n 1 201 ILE n 1 202 MET n 1 203 CYS n 1 204 GLY n 1 205 LYS n 1 206 GLN n 1 207 ASP n 1 208 PHE n 1 209 LEU n 1 210 TYR n 1 211 GLN n 1 212 ASP n 1 213 ASN n 1 214 LEU n 1 215 ASP n 1 216 PHE n 1 217 ILE n 1 218 ASP n 1 219 TYR n 1 220 LEU n 1 221 SER n 1 222 ARG n 1 223 ILE n 1 224 ASN n 1 225 VAL n 1 226 PRO n 1 227 TYR n 1 228 GLN n 1 229 PHE n 1 230 GLU n 1 231 ASP n 1 232 GLY n 1 233 PRO n 1 234 GLY n 1 235 ASP n 1 236 HIS n 1 237 ASP n 1 238 TYR n 1 239 ALA n 1 240 TYR n 1 241 TRP n 1 242 ASP n 1 243 GLN n 1 244 ALA n 1 245 ILE n 1 246 LYS n 1 247 ARG n 1 248 ALA n 1 249 ILE n 1 250 THR n 1 251 TRP n 1 252 MET n 1 253 VAL n 1 254 ASN n 1 255 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 255 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EP54_00010, EQ90_02595, HMPREF3211_01237, NCTC10654_02801, NCTC10702_04070, RK64_00235' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name M1366 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0D6GS23_STAAU _struct_ref.pdbx_db_accession A0A0D6GS23 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AYISLNYHSPTIGMHQNLTVILPEDQSFFNSDTTVKPLKTLMLLHGLSSDETTYMRYTSIERYANEHKLAVIMPNVDHSA YANMAYGHSYYDYILEVYDYVHQIFPLSKKRDDNFIAGHSMGGYGTIKFALTQGDKFAKAVPLSAVFEAQNLMDLEWNDF SKEAIIGNLSSVKGTEHDPYYLLDKAVAEDKQIPKLLIMCGKQDFLYQDNLDFIDYLSRINVPYQFEDGPGDHDYAYWDQ AIKRAITWMVND ; _struct_ref.pdbx_align_begin 2 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6WCX A 4 ? 255 ? A0A0D6GS23 2 ? 253 ? 2 253 2 1 6WCX B 4 ? 255 ? A0A0D6GS23 2 ? 253 ? 2 253 3 1 6WCX C 4 ? 255 ? A0A0D6GS23 2 ? 253 ? 2 253 4 1 6WCX D 4 ? 255 ? A0A0D6GS23 2 ? 253 ? 2 253 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6WCX GLY A 1 ? UNP A0A0D6GS23 ? ? 'expression tag' -1 1 1 6WCX PRO A 2 ? UNP A0A0D6GS23 ? ? 'expression tag' 0 2 1 6WCX GLY A 3 ? UNP A0A0D6GS23 ? ? 'expression tag' 1 3 2 6WCX GLY B 1 ? UNP A0A0D6GS23 ? ? 'expression tag' -1 4 2 6WCX PRO B 2 ? UNP A0A0D6GS23 ? ? 'expression tag' 0 5 2 6WCX GLY B 3 ? UNP A0A0D6GS23 ? ? 'expression tag' 1 6 3 6WCX GLY C 1 ? UNP A0A0D6GS23 ? ? 'expression tag' -1 7 3 6WCX PRO C 2 ? UNP A0A0D6GS23 ? ? 'expression tag' 0 8 3 6WCX GLY C 3 ? UNP A0A0D6GS23 ? ? 'expression tag' 1 9 4 6WCX GLY D 1 ? UNP A0A0D6GS23 ? ? 'expression tag' -1 10 4 6WCX PRO D 2 ? UNP A0A0D6GS23 ? ? 'expression tag' 0 11 4 6WCX GLY D 3 ? UNP A0A0D6GS23 ? ? 'expression tag' 1 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HE4 non-polymer . HEPTAN-1-OL ? 'C7 H16 O' 116.201 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6WCX _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.12 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.09 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.350 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.4 uL ~8.0 mg/mL FphF (10 mM HEPES pH 7.5, 10 mM NaCl) were mixed with 0.07 uL ligand solution (~0.5 mM 4-Methylumbelliferyl heptanoate in 100% DMSO) and 0.4 uL of reservoir solution. Sitting drop reservoir contained 50 uL of 0.8 M Sodium formate, 0.1 M Tris pH 7.5, 10 % w/v PEG 8000 and 10 % w/v PEG 1000. Crystals were soaked for ~15 seconds in 75% reservoir solution and 25% glycerol prior to freezing in liquid nitrogen ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-03-20 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.954 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.954 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX1 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6WCX _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.890 _reflns.d_resolution_low 49.190 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23922 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.100 _reflns.pdbx_Rmerge_I_obs 0.223 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.235 _reflns.pdbx_Rpim_I_all 0.069 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.988 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.890 3.070 ? ? 26252 ? ? ? 3641 97.400 ? ? ? ? 1.137 ? ? ? ? ? ? ? ? 7.200 ? ? ? 1.600 1.213 0.380 ? 1 1 0.524 ? ? 8.680 49.190 ? ? 15977 ? ? ? 1082 99.500 ? ? ? ? 0.107 ? ? ? ? ? ? ? ? 14.800 ? ? ? 26.800 0.112 0.029 ? 2 1 0.995 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 75.410 _refine.B_iso_mean 43.9473 _refine.B_iso_min 23.970 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6WCX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8900 _refine.ls_d_res_low 49.1900 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23797 _refine.ls_number_reflns_R_free 2067 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.1900 _refine.ls_percent_reflns_R_free 4.9600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2271 _refine.ls_R_factor_R_free 0.2606 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2253 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.920 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6VH9 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.8300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.8900 _refine_hist.d_res_low 49.1900 _refine_hist.number_atoms_solvent 17 _refine_hist.number_atoms_total 8201 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 1020 _refine_hist.pdbx_B_iso_mean_ligand 42.39 _refine_hist.pdbx_B_iso_mean_solvent 35.96 _refine_hist.pdbx_number_atoms_protein 8152 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 4548 8.205 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 4548 8.205 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 4548 8.205 ? 1 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 4 TORSIONAL ? D 4548 8.205 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.8900 2.9600 2514 . 117 2397 90.0000 . . . 0.2716 0.0000 0.3048 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.9600 3.0400 2725 . 117 2608 95.0000 . . . 0.3186 0.0000 0.2990 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.0400 3.1200 2759 . 139 2620 95.0000 . . . 0.3483 0.0000 0.2976 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.1200 3.2100 2736 . 164 2572 96.0000 . . . 0.3119 0.0000 0.2927 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.2100 3.3100 2710 . 130 2580 96.0000 . . . 0.3006 0.0000 0.2706 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.3100 3.4300 2769 . 138 2631 97.0000 . . . 0.2820 0.0000 0.2533 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.4300 3.5700 2737 . 121 2616 96.0000 . . . 0.3322 0.0000 0.2218 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.5700 3.7300 2817 . 144 2673 98.0000 . . . 0.2510 0.0000 0.2154 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.7300 3.9300 2844 . 133 2711 99.0000 . . . 0.2642 0.0000 0.2027 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.9300 4.1700 2835 . 157 2678 98.0000 . . . 0.2077 0.0000 0.1896 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 4.1700 4.4900 2799 . 151 2648 99.0000 . . . 0.1839 0.0000 0.1630 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 4.5000 4.9500 2838 . 125 2713 99.0000 . . . 0.2254 0.0000 0.1684 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 4.9500 5.6600 2875 . 141 2734 100.0000 . . . 0.2057 0.0000 0.1818 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 5.6600 7.1300 2866 . 159 2707 100.0000 . . . 0.2408 0.0000 0.2247 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 7.1300 49.1900 2835 . 131 2704 99.0000 . . . 0.3178 0.0000 0.2634 . . . . . . . 15 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid -1 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 176 or (resid 177 and (name N or name CA or name C or name O or name CB )) or resid 178 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 240 or (resid 241 through 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 2 ;(chain B and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 176 or (resid 177 and (name N or name CA or name C or name O or name CB )) or resid 178 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 227 or (resid 228 and (name N or name CA or name C or name O or name CB )) or resid 229 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 301)) ; 1 3 ;(chain C and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 42 or resid 44 through 55 or resid 57 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 191 or (resid 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 240 or (resid 241 through 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 4 ;(chain D and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 227 or (resid 228 and (name N or name CA or name C or name O or name CB )) or resid 229 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A GLY 1 . A LEU 44 . A GLY -1 A LEU 42 ? ;(chain A and (resid -1 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 176 or (resid 177 and (name N or name CA or name C or name O or name CB )) or resid 178 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 240 or (resid 241 through 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 1 2 A LEU 46 . A TYR 57 . A LEU 44 A TYR 55 ? ;(chain A and (resid -1 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 176 or (resid 177 and (name N or name CA or name C or name O or name CB )) or resid 178 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 240 or (resid 241 through 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 1 3 A ARG 59 . A LYS 112 . A ARG 57 A LYS 110 ? ;(chain A and (resid -1 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 176 or (resid 177 and (name N or name CA or name C or name O or name CB )) or resid 178 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 240 or (resid 241 through 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 1 4 A LYS 113 . A LYS 113 . A LYS 111 A LYS 111 ? ;(chain A and (resid -1 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 176 or (resid 177 and (name N or name CA or name C or name O or name CB )) or resid 178 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 240 or (resid 241 through 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 1 5 A GLY 1 . E HE4 . . A GLY -1 A HE4 301 ? ;(chain A and (resid -1 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 176 or (resid 177 and (name N or name CA or name C or name O or name CB )) or resid 178 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 240 or (resid 241 through 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 1 6 A GLY 1 . E HE4 . . A GLY -1 A HE4 301 ? ;(chain A and (resid -1 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 176 or (resid 177 and (name N or name CA or name C or name O or name CB )) or resid 178 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 240 or (resid 241 through 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 1 7 A GLY 1 . E HE4 . . A GLY -1 A HE4 301 ? ;(chain A and (resid -1 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 176 or (resid 177 and (name N or name CA or name C or name O or name CB )) or resid 178 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 240 or (resid 241 through 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 1 8 A GLY 1 . E HE4 . . A GLY -1 A HE4 301 ? ;(chain A and (resid -1 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 176 or (resid 177 and (name N or name CA or name C or name O or name CB )) or resid 178 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 240 or (resid 241 through 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 2 1 B GLY 1 . B ASP 28 . B GLY -1 B ASP 26 ? ;(chain B and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 176 or (resid 177 and (name N or name CA or name C or name O or name CB )) or resid 178 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 227 or (resid 228 and (name N or name CA or name C or name O or name CB )) or resid 229 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 301)) ; 1 2 2 B GLN 29 . B GLN 29 . B GLN 27 B GLN 27 ? ;(chain B and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 176 or (resid 177 and (name N or name CA or name C or name O or name CB )) or resid 178 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 227 or (resid 228 and (name N or name CA or name C or name O or name CB )) or resid 229 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 301)) ; 1 2 3 B GLY 1 . F HE4 . . B GLY -1 B HE4 301 ? ;(chain B and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 176 or (resid 177 and (name N or name CA or name C or name O or name CB )) or resid 178 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 227 or (resid 228 and (name N or name CA or name C or name O or name CB )) or resid 229 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 301)) ; 1 2 4 B GLY 1 . F HE4 . . B GLY -1 B HE4 301 ? ;(chain B and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 176 or (resid 177 and (name N or name CA or name C or name O or name CB )) or resid 178 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 227 or (resid 228 and (name N or name CA or name C or name O or name CB )) or resid 229 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 301)) ; 1 2 5 B GLY 1 . F HE4 . . B GLY -1 B HE4 301 ? ;(chain B and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 176 or (resid 177 and (name N or name CA or name C or name O or name CB )) or resid 178 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 227 or (resid 228 and (name N or name CA or name C or name O or name CB )) or resid 229 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 301)) ; 1 2 6 B GLY 1 . F HE4 . . B GLY -1 B HE4 301 ? ;(chain B and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 176 or (resid 177 and (name N or name CA or name C or name O or name CB )) or resid 178 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 227 or (resid 228 and (name N or name CA or name C or name O or name CB )) or resid 229 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 301)) ; 1 3 1 C GLY 1 . C ASP 28 . C GLY -1 C ASP 26 ? ;(chain C and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 42 or resid 44 through 55 or resid 57 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 191 or (resid 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 240 or (resid 241 through 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 3 2 C GLN 29 . C GLN 29 . C GLN 27 C GLN 27 ? ;(chain C and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 42 or resid 44 through 55 or resid 57 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 191 or (resid 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 240 or (resid 241 through 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 3 3 C GLY 1 . C ASP 255 . C GLY -1 C ASP 253 ? ;(chain C and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 42 or resid 44 through 55 or resid 57 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 191 or (resid 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 240 or (resid 241 through 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 3 4 C GLY 1 . C ASP 255 . C GLY -1 C ASP 253 ? ;(chain C and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 42 or resid 44 through 55 or resid 57 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 191 or (resid 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 240 or (resid 241 through 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 3 5 C GLY 1 . C ASP 255 . C GLY -1 C ASP 253 ? ;(chain C and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 42 or resid 44 through 55 or resid 57 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 191 or (resid 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 240 or (resid 241 through 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 3 6 C GLY 1 . C ASP 255 . C GLY -1 C ASP 253 ? ;(chain C and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 42 or resid 44 through 55 or resid 57 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170 through 173 or (resid 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 185 or (resid 186 through 187 and (name N or name CA or name C or name O or name CB )) or resid 188 through 191 or (resid 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 240 or (resid 241 through 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 4 1 D GLY 1 . D ASP 28 . D GLY -1 D ASP 26 ? ;(chain D and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 227 or (resid 228 and (name N or name CA or name C or name O or name CB )) or resid 229 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 4 2 D GLN 29 . D GLN 29 . D GLN 27 D GLN 27 ? ;(chain D and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 227 or (resid 228 and (name N or name CA or name C or name O or name CB )) or resid 229 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 4 3 D GLY 1 . D ASP 255 . D GLY -1 D ASP 253 ? ;(chain D and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 227 or (resid 228 and (name N or name CA or name C or name O or name CB )) or resid 229 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 4 4 D GLY 1 . D ASP 255 . D GLY -1 D ASP 253 ? ;(chain D and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 227 or (resid 228 and (name N or name CA or name C or name O or name CB )) or resid 229 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 4 5 D GLY 1 . D ASP 255 . D GLY -1 D ASP 253 ? ;(chain D and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 227 or (resid 228 and (name N or name CA or name C or name O or name CB )) or resid 229 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; 1 4 6 D GLY 1 . D ASP 255 . D GLY -1 D ASP 253 ? ;(chain D and (resid -1 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB )) or resid 28 through 42 or resid 44 through 55 or resid 57 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 156 or (resid 157 and (name N or name CA or name C or name O or name CB )) or resid 158 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170 through 190 or (resid 191 through 192 and (name N or name CA or name C or name O or name CB )) or resid 193 through 199 or resid 201 through 202 or (resid 203 and (name N or name CA or name C or name O or name CB )) or resid 204 through 205 or resid 207 through 215 or (resid 216 and (name N or name CA or name C or name O or name CB )) or resid 217 through 227 or (resid 228 and (name N or name CA or name C or name O or name CB )) or resid 229 through 251 or (resid 252 through 253 and (name N or name CA or name C or name O or name CB )) or resid 301)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 6WCX _struct.title 'FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6WCX _struct_keywords.text 'FphF, fluorophosphonate-binding, serine hydrolases, heptanoate, heptan-1-ol, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 3 ? J N N 3 ? K N N 3 ? L N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 28 ? ASN A 33 ? ASP A 26 ASN A 31 5 ? 6 HELX_P HELX_P2 AA2 THR A 55 ? THR A 61 ? THR A 53 THR A 59 1 ? 7 HELX_P HELX_P3 AA3 SER A 62 ? HIS A 70 ? SER A 60 HIS A 68 1 ? 9 HELX_P HELX_P4 AA4 SER A 92 ? PHE A 108 ? SER A 90 PHE A 106 1 ? 17 HELX_P HELX_P5 AA5 LYS A 113 ? ASP A 115 ? LYS A 111 ASP A 113 5 ? 3 HELX_P HELX_P6 AA6 SER A 123 ? GLN A 136 ? SER A 121 GLN A 134 1 ? 14 HELX_P HELX_P7 AA7 GLU A 151 ? ASP A 157 ? GLU A 149 ASP A 155 1 ? 7 HELX_P HELX_P8 AA8 SER A 164 ? GLY A 170 ? SER A 162 GLY A 168 1 ? 7 HELX_P HELX_P9 AA9 ASP A 181 ? GLU A 192 ? ASP A 179 GLU A 190 1 ? 12 HELX_P HELX_P10 AB1 LEU A 209 ? ILE A 223 ? LEU A 207 ILE A 221 1 ? 15 HELX_P HELX_P11 AB2 ASP A 237 ? ASN A 254 ? ASP A 235 ASN A 252 1 ? 18 HELX_P HELX_P12 AB3 ASP B 28 ? ASN B 33 ? ASP B 26 ASN B 31 5 ? 6 HELX_P HELX_P13 AB4 THR B 55 ? THR B 61 ? THR B 53 THR B 59 1 ? 7 HELX_P HELX_P14 AB5 SER B 62 ? HIS B 70 ? SER B 60 HIS B 68 1 ? 9 HELX_P HELX_P15 AB6 SER B 92 ? PHE B 108 ? SER B 90 PHE B 106 1 ? 17 HELX_P HELX_P16 AB7 LYS B 113 ? ASP B 115 ? LYS B 111 ASP B 113 5 ? 3 HELX_P HELX_P17 AB8 SER B 123 ? GLN B 136 ? SER B 121 GLN B 134 1 ? 14 HELX_P HELX_P18 AB9 ALA B 152 ? ASP B 157 ? ALA B 150 ASP B 155 1 ? 6 HELX_P HELX_P19 AC1 SER B 164 ? GLY B 170 ? SER B 162 GLY B 168 1 ? 7 HELX_P HELX_P20 AC2 ASP B 181 ? GLU B 192 ? ASP B 179 GLU B 190 1 ? 12 HELX_P HELX_P21 AC3 LEU B 209 ? ILE B 223 ? LEU B 207 ILE B 221 1 ? 15 HELX_P HELX_P22 AC4 ASP B 237 ? VAL B 253 ? ASP B 235 VAL B 251 1 ? 17 HELX_P HELX_P23 AC5 ASP C 28 ? ASN C 33 ? ASP C 26 ASN C 31 5 ? 6 HELX_P HELX_P24 AC6 THR C 55 ? THR C 61 ? THR C 53 THR C 59 1 ? 7 HELX_P HELX_P25 AC7 SER C 62 ? LYS C 71 ? SER C 60 LYS C 69 1 ? 10 HELX_P HELX_P26 AC8 SER C 92 ? PHE C 108 ? SER C 90 PHE C 106 1 ? 17 HELX_P HELX_P27 AC9 LYS C 113 ? ASP C 115 ? LYS C 111 ASP C 113 5 ? 3 HELX_P HELX_P28 AD1 SER C 123 ? GLN C 136 ? SER C 121 GLN C 134 1 ? 14 HELX_P HELX_P29 AD2 ALA C 152 ? ASP C 157 ? ALA C 150 ASP C 155 1 ? 6 HELX_P HELX_P30 AD3 SER C 164 ? GLY C 170 ? SER C 162 GLY C 168 1 ? 7 HELX_P HELX_P31 AD4 ASP C 181 ? GLU C 192 ? ASP C 179 GLU C 190 1 ? 12 HELX_P HELX_P32 AD5 LEU C 209 ? ILE C 223 ? LEU C 207 ILE C 221 1 ? 15 HELX_P HELX_P33 AD6 ASP C 237 ? ASN C 254 ? ASP C 235 ASN C 252 1 ? 18 HELX_P HELX_P34 AD7 ASP D 28 ? ASN D 33 ? ASP D 26 ASN D 31 5 ? 6 HELX_P HELX_P35 AD8 THR D 55 ? THR D 61 ? THR D 53 THR D 59 1 ? 7 HELX_P HELX_P36 AD9 SER D 62 ? LYS D 71 ? SER D 60 LYS D 69 1 ? 10 HELX_P HELX_P37 AE1 SER D 92 ? PHE D 108 ? SER D 90 PHE D 106 1 ? 17 HELX_P HELX_P38 AE2 LYS D 113 ? ASP D 115 ? LYS D 111 ASP D 113 5 ? 3 HELX_P HELX_P39 AE3 SER D 123 ? GLN D 136 ? SER D 121 GLN D 134 1 ? 14 HELX_P HELX_P40 AE4 GLY D 137 ? PHE D 140 ? GLY D 135 PHE D 138 5 ? 4 HELX_P HELX_P41 AE5 GLU D 151 ? ASP D 157 ? GLU D 149 ASP D 155 1 ? 7 HELX_P HELX_P42 AE6 SER D 164 ? GLY D 170 ? SER D 162 GLY D 168 1 ? 7 HELX_P HELX_P43 AE7 ASP D 181 ? GLU D 192 ? ASP D 179 GLU D 190 1 ? 12 HELX_P HELX_P44 AE8 LEU D 209 ? ILE D 223 ? LEU D 207 ILE D 221 1 ? 15 HELX_P HELX_P45 AE9 ASP D 237 ? ASN D 254 ? ASP D 235 ASN D 252 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A SER 123 OG ? ? ? 1_555 E HE4 . CAD ? ? A SER 121 A HE4 301 1_555 ? ? ? ? ? ? ? 1.375 ? ? covale2 covale none ? B SER 123 OG ? ? ? 1_555 F HE4 . CAD ? ? B SER 121 B HE4 301 1_555 ? ? ? ? ? ? ? 1.376 ? ? covale3 covale none ? C SER 123 OG ? ? ? 1_555 G HE4 . CAD ? ? C SER 121 C HE4 301 1_555 ? ? ? ? ? ? ? 1.374 ? ? covale4 covale none ? D SER 123 OG ? ? ? 1_555 H HE4 . CAD ? ? D SER 121 D HE4 301 1_555 ? ? ? ? ? ? ? 1.378 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 16 ? AA2 ? 16 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? parallel AA1 12 13 ? parallel AA1 13 14 ? parallel AA1 14 15 ? parallel AA1 15 16 ? parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA2 8 9 ? anti-parallel AA2 9 10 ? anti-parallel AA2 10 11 ? anti-parallel AA2 11 12 ? parallel AA2 12 13 ? parallel AA2 13 14 ? parallel AA2 14 15 ? parallel AA2 15 16 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 228 ? GLU A 230 ? GLN A 226 GLU A 228 AA1 2 LYS A 198 ? MET A 202 ? LYS A 196 MET A 200 AA1 3 LYS A 142 ? LEU A 146 ? LYS A 140 LEU A 144 AA1 4 ASN A 117 ? HIS A 122 ? ASN A 115 HIS A 120 AA1 5 LYS A 42 ? LEU A 47 ? LYS A 40 LEU A 45 AA1 6 LEU A 72 ? PRO A 77 ? LEU A 70 PRO A 75 AA1 7 MET A 17 ? PRO A 26 ? MET A 15 PRO A 24 AA1 8 GLY A 3 ? SER A 12 ? GLY A 1 SER A 10 AA1 9 GLY D 3 ? SER D 12 ? GLY D 1 SER D 10 AA1 10 MET D 17 ? PRO D 26 ? MET D 15 PRO D 24 AA1 11 LEU D 72 ? MET D 76 ? LEU D 70 MET D 74 AA1 12 LYS D 42 ? LEU D 47 ? LYS D 40 LEU D 45 AA1 13 ASN D 117 ? HIS D 122 ? ASN D 115 HIS D 120 AA1 14 LYS D 142 ? LEU D 146 ? LYS D 140 LEU D 144 AA1 15 LYS D 198 ? MET D 202 ? LYS D 196 MET D 200 AA1 16 GLN D 228 ? GLU D 230 ? GLN D 226 GLU D 228 AA2 1 GLN B 228 ? GLU B 230 ? GLN B 226 GLU B 228 AA2 2 LYS B 198 ? MET B 202 ? LYS B 196 MET B 200 AA2 3 LYS B 142 ? LEU B 146 ? LYS B 140 LEU B 144 AA2 4 ASN B 117 ? HIS B 122 ? ASN B 115 HIS B 120 AA2 5 LYS B 42 ? LEU B 47 ? LYS B 40 LEU B 45 AA2 6 LEU B 72 ? MET B 76 ? LEU B 70 MET B 74 AA2 7 MET B 17 ? PRO B 26 ? MET B 15 PRO B 24 AA2 8 GLY B 3 ? SER B 12 ? GLY B 1 SER B 10 AA2 9 GLY C 3 ? SER C 12 ? GLY C 1 SER C 10 AA2 10 MET C 17 ? PRO C 26 ? MET C 15 PRO C 24 AA2 11 LEU C 72 ? MET C 76 ? LEU C 70 MET C 74 AA2 12 LYS C 42 ? LEU C 47 ? LYS C 40 LEU C 45 AA2 13 ASN C 117 ? HIS C 122 ? ASN C 115 HIS C 120 AA2 14 LYS C 142 ? LEU C 146 ? LYS C 140 LEU C 144 AA2 15 LYS C 198 ? MET C 202 ? LYS C 196 MET C 200 AA2 16 GLN C 228 ? GLU C 230 ? GLN C 226 GLU C 228 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLN A 228 ? O GLN A 226 N ILE A 201 ? N ILE A 199 AA1 2 3 O LYS A 198 ? O LYS A 196 N ALA A 143 ? N ALA A 141 AA1 3 4 O LEU A 146 ? O LEU A 144 N GLY A 121 ? N GLY A 119 AA1 4 5 O ALA A 120 ? O ALA A 118 N MET A 45 ? N MET A 43 AA1 5 6 N LEU A 44 ? N LEU A 42 O ILE A 75 ? O ILE A 73 AA1 6 7 O MET A 76 ? O MET A 74 N THR A 22 ? N THR A 20 AA1 7 8 O VAL A 23 ? O VAL A 21 N ILE A 6 ? N ILE A 4 AA1 8 9 N TYR A 5 ? N TYR A 3 O ASN D 9 ? O ASN D 7 AA1 9 10 N ALA D 4 ? N ALA D 2 O LEU D 25 ? O LEU D 23 AA1 10 11 N THR D 22 ? N THR D 20 O MET D 76 ? O MET D 74 AA1 11 12 O ILE D 75 ? O ILE D 73 N LEU D 46 ? N LEU D 44 AA1 12 13 N THR D 43 ? N THR D 41 O PHE D 118 ? O PHE D 116 AA1 13 14 N GLY D 121 ? N GLY D 119 O LEU D 146 ? O LEU D 144 AA1 14 15 N ALA D 143 ? N ALA D 141 O LYS D 198 ? O LYS D 196 AA1 15 16 N ILE D 201 ? N ILE D 199 O GLN D 228 ? O GLN D 226 AA2 1 2 O GLN B 228 ? O GLN B 226 N ILE B 201 ? N ILE B 199 AA2 2 3 O LYS B 198 ? O LYS B 196 N ALA B 143 ? N ALA B 141 AA2 3 4 O LEU B 146 ? O LEU B 144 N GLY B 121 ? N GLY B 119 AA2 4 5 O PHE B 118 ? O PHE B 116 N THR B 43 ? N THR B 41 AA2 5 6 N LEU B 44 ? N LEU B 42 O ALA B 73 ? O ALA B 71 AA2 6 7 O VAL B 74 ? O VAL B 72 N ILE B 24 ? N ILE B 22 AA2 7 8 O LEU B 21 ? O LEU B 19 N LEU B 8 ? N LEU B 6 AA2 8 9 N TYR B 5 ? N TYR B 3 O ASN C 9 ? O ASN C 7 AA2 9 10 N ALA C 4 ? N ALA C 2 O LEU C 25 ? O LEU C 23 AA2 10 11 N THR C 22 ? N THR C 20 O MET C 76 ? O MET C 74 AA2 11 12 O ALA C 73 ? O ALA C 71 N LYS C 42 ? N LYS C 40 AA2 12 13 N LEU C 47 ? N LEU C 45 O ALA C 120 ? O ALA C 118 AA2 13 14 N ILE C 119 ? N ILE C 117 O VAL C 144 ? O VAL C 142 AA2 14 15 N ALA C 143 ? N ALA C 141 O LYS C 198 ? O LYS C 196 AA2 15 16 N ILE C 201 ? N ILE C 199 O GLN C 228 ? O GLN C 226 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A HE4 301 ? 6 'binding site for residue HE4 A 301' AC2 Software B HE4 301 ? 13 'binding site for Di-peptide HE4 B 301 and SER B 121' AC3 Software C HE4 301 ? 12 'binding site for Di-peptide HE4 C 301 and SER C 121' AC4 Software D HE4 301 ? 13 'binding site for Di-peptide HE4 D 301 and SER D 121' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLY A 49 ? GLY A 47 . ? 1_555 ? 2 AC1 6 LEU A 50 ? LEU A 48 . ? 1_555 ? 3 AC1 6 SER A 123 ? SER A 121 . ? 1_555 ? 4 AC1 6 MET A 124 ? MET A 122 . ? 1_555 ? 5 AC1 6 ASN A 154 ? ASN A 152 . ? 1_555 ? 6 AC1 6 HIS A 236 ? HIS A 234 . ? 1_555 ? 7 AC2 13 LEU B 50 ? LEU B 48 . ? 1_555 ? 8 AC2 13 HIS B 122 ? HIS B 120 . ? 1_555 ? 9 AC2 13 MET B 124 ? MET B 122 . ? 1_555 ? 10 AC2 13 GLY B 125 ? GLY B 123 . ? 1_555 ? 11 AC2 13 GLY B 126 ? GLY B 124 . ? 1_555 ? 12 AC2 13 TYR B 127 ? TYR B 125 . ? 1_555 ? 13 AC2 13 LEU B 146 ? LEU B 144 . ? 1_555 ? 14 AC2 13 SER B 147 ? SER B 145 . ? 1_555 ? 15 AC2 13 ALA B 148 ? ALA B 146 . ? 1_555 ? 16 AC2 13 VAL B 149 ? VAL B 147 . ? 1_555 ? 17 AC2 13 ASN B 154 ? ASN B 152 . ? 1_555 ? 18 AC2 13 LEU B 209 ? LEU B 207 . ? 1_555 ? 19 AC2 13 HIS B 236 ? HIS B 234 . ? 1_555 ? 20 AC3 12 GLY C 49 ? GLY C 47 . ? 1_555 ? 21 AC3 12 LEU C 50 ? LEU C 48 . ? 1_555 ? 22 AC3 12 HIS C 122 ? HIS C 120 . ? 1_555 ? 23 AC3 12 MET C 124 ? MET C 122 . ? 1_555 ? 24 AC3 12 GLY C 125 ? GLY C 123 . ? 1_555 ? 25 AC3 12 GLY C 126 ? GLY C 124 . ? 1_555 ? 26 AC3 12 TYR C 127 ? TYR C 125 . ? 1_555 ? 27 AC3 12 LEU C 146 ? LEU C 144 . ? 1_555 ? 28 AC3 12 SER C 147 ? SER C 145 . ? 1_555 ? 29 AC3 12 VAL C 149 ? VAL C 147 . ? 1_555 ? 30 AC3 12 ASN C 154 ? ASN C 152 . ? 1_555 ? 31 AC3 12 HIS C 236 ? HIS C 234 . ? 1_555 ? 32 AC4 13 GLY D 49 ? GLY D 47 . ? 1_555 ? 33 AC4 13 LEU D 50 ? LEU D 48 . ? 1_555 ? 34 AC4 13 HIS D 122 ? HIS D 120 . ? 1_555 ? 35 AC4 13 MET D 124 ? MET D 122 . ? 1_555 ? 36 AC4 13 GLY D 125 ? GLY D 123 . ? 1_555 ? 37 AC4 13 GLY D 126 ? GLY D 124 . ? 1_555 ? 38 AC4 13 TYR D 127 ? TYR D 125 . ? 1_555 ? 39 AC4 13 LEU D 146 ? LEU D 144 . ? 1_555 ? 40 AC4 13 SER D 147 ? SER D 145 . ? 1_555 ? 41 AC4 13 ALA D 148 ? ALA D 146 . ? 1_555 ? 42 AC4 13 VAL D 149 ? VAL D 147 . ? 1_555 ? 43 AC4 13 ASN D 154 ? ASN D 152 . ? 1_555 ? 44 AC4 13 HIS D 236 ? HIS D 234 . ? 1_555 ? # _atom_sites.entry_id 6WCX _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011500 _atom_sites.fract_transf_matrix[1][2] 0.006639 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013279 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.002199 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 -1 GLY GLY A . n A 1 2 PRO 2 0 0 PRO PRO A . n A 1 3 GLY 3 1 1 GLY GLY A . n A 1 4 ALA 4 2 2 ALA ALA A . n A 1 5 TYR 5 3 3 TYR TYR A . n A 1 6 ILE 6 4 4 ILE ILE A . n A 1 7 SER 7 5 5 SER SER A . n A 1 8 LEU 8 6 6 LEU LEU A . n A 1 9 ASN 9 7 7 ASN ASN A . n A 1 10 TYR 10 8 8 TYR TYR A . n A 1 11 HIS 11 9 9 HIS HIS A . n A 1 12 SER 12 10 10 SER SER A . n A 1 13 PRO 13 11 11 PRO PRO A . n A 1 14 THR 14 12 12 THR THR A . n A 1 15 ILE 15 13 13 ILE ILE A . n A 1 16 GLY 16 14 14 GLY GLY A . n A 1 17 MET 17 15 15 MET MET A . n A 1 18 HIS 18 16 16 HIS HIS A . n A 1 19 GLN 19 17 17 GLN GLN A . n A 1 20 ASN 20 18 18 ASN ASN A . n A 1 21 LEU 21 19 19 LEU LEU A . n A 1 22 THR 22 20 20 THR THR A . n A 1 23 VAL 23 21 21 VAL VAL A . n A 1 24 ILE 24 22 22 ILE ILE A . n A 1 25 LEU 25 23 23 LEU LEU A . n A 1 26 PRO 26 24 24 PRO PRO A . n A 1 27 GLU 27 25 25 GLU GLU A . n A 1 28 ASP 28 26 26 ASP ASP A . n A 1 29 GLN 29 27 27 GLN GLN A . n A 1 30 SER 30 28 28 SER SER A . n A 1 31 PHE 31 29 29 PHE PHE A . n A 1 32 PHE 32 30 30 PHE PHE A . n A 1 33 ASN 33 31 31 ASN ASN A . n A 1 34 SER 34 32 32 SER SER A . n A 1 35 ASP 35 33 33 ASP ASP A . n A 1 36 THR 36 34 34 THR THR A . n A 1 37 THR 37 35 35 THR THR A . n A 1 38 VAL 38 36 36 VAL VAL A . n A 1 39 LYS 39 37 37 LYS LYS A . n A 1 40 PRO 40 38 38 PRO PRO A . n A 1 41 LEU 41 39 39 LEU LEU A . n A 1 42 LYS 42 40 40 LYS LYS A . n A 1 43 THR 43 41 41 THR THR A . n A 1 44 LEU 44 42 42 LEU LEU A . n A 1 45 MET 45 43 43 MET MET A . n A 1 46 LEU 46 44 44 LEU LEU A . n A 1 47 LEU 47 45 45 LEU LEU A . n A 1 48 HIS 48 46 46 HIS HIS A . n A 1 49 GLY 49 47 47 GLY GLY A . n A 1 50 LEU 50 48 48 LEU LEU A . n A 1 51 SER 51 49 49 SER SER A . n A 1 52 SER 52 50 50 SER SER A . n A 1 53 ASP 53 51 51 ASP ASP A . n A 1 54 GLU 54 52 52 GLU GLU A . n A 1 55 THR 55 53 53 THR THR A . n A 1 56 THR 56 54 54 THR THR A . n A 1 57 TYR 57 55 55 TYR TYR A . n A 1 58 MET 58 56 56 MET MET A . n A 1 59 ARG 59 57 57 ARG ARG A . n A 1 60 TYR 60 58 58 TYR TYR A . n A 1 61 THR 61 59 59 THR THR A . n A 1 62 SER 62 60 60 SER SER A . n A 1 63 ILE 63 61 61 ILE ILE A . n A 1 64 GLU 64 62 62 GLU GLU A . n A 1 65 ARG 65 63 63 ARG ARG A . n A 1 66 TYR 66 64 64 TYR TYR A . n A 1 67 ALA 67 65 65 ALA ALA A . n A 1 68 ASN 68 66 66 ASN ASN A . n A 1 69 GLU 69 67 67 GLU GLU A . n A 1 70 HIS 70 68 68 HIS HIS A . n A 1 71 LYS 71 69 69 LYS LYS A . n A 1 72 LEU 72 70 70 LEU LEU A . n A 1 73 ALA 73 71 71 ALA ALA A . n A 1 74 VAL 74 72 72 VAL VAL A . n A 1 75 ILE 75 73 73 ILE ILE A . n A 1 76 MET 76 74 74 MET MET A . n A 1 77 PRO 77 75 75 PRO PRO A . n A 1 78 ASN 78 76 76 ASN ASN A . n A 1 79 VAL 79 77 77 VAL VAL A . n A 1 80 ASP 80 78 78 ASP ASP A . n A 1 81 HIS 81 79 79 HIS HIS A . n A 1 82 SER 82 80 80 SER SER A . n A 1 83 ALA 83 81 81 ALA ALA A . n A 1 84 TYR 84 82 82 TYR TYR A . n A 1 85 ALA 85 83 83 ALA ALA A . n A 1 86 ASN 86 84 84 ASN ASN A . n A 1 87 MET 87 85 85 MET MET A . n A 1 88 ALA 88 86 86 ALA ALA A . n A 1 89 TYR 89 87 87 TYR TYR A . n A 1 90 GLY 90 88 88 GLY GLY A . n A 1 91 HIS 91 89 89 HIS HIS A . n A 1 92 SER 92 90 90 SER SER A . n A 1 93 TYR 93 91 91 TYR TYR A . n A 1 94 TYR 94 92 92 TYR TYR A . n A 1 95 ASP 95 93 93 ASP ASP A . n A 1 96 TYR 96 94 94 TYR TYR A . n A 1 97 ILE 97 95 95 ILE ILE A . n A 1 98 LEU 98 96 96 LEU LEU A . n A 1 99 GLU 99 97 97 GLU GLU A . n A 1 100 VAL 100 98 98 VAL VAL A . n A 1 101 TYR 101 99 99 TYR TYR A . n A 1 102 ASP 102 100 100 ASP ASP A . n A 1 103 TYR 103 101 101 TYR TYR A . n A 1 104 VAL 104 102 102 VAL VAL A . n A 1 105 HIS 105 103 103 HIS HIS A . n A 1 106 GLN 106 104 104 GLN GLN A . n A 1 107 ILE 107 105 105 ILE ILE A . n A 1 108 PHE 108 106 106 PHE PHE A . n A 1 109 PRO 109 107 107 PRO PRO A . n A 1 110 LEU 110 108 108 LEU LEU A . n A 1 111 SER 111 109 109 SER SER A . n A 1 112 LYS 112 110 110 LYS LYS A . n A 1 113 LYS 113 111 111 LYS LYS A . n A 1 114 ARG 114 112 112 ARG ARG A . n A 1 115 ASP 115 113 113 ASP ASP A . n A 1 116 ASP 116 114 114 ASP ASP A . n A 1 117 ASN 117 115 115 ASN ASN A . n A 1 118 PHE 118 116 116 PHE PHE A . n A 1 119 ILE 119 117 117 ILE ILE A . n A 1 120 ALA 120 118 118 ALA ALA A . n A 1 121 GLY 121 119 119 GLY GLY A . n A 1 122 HIS 122 120 120 HIS HIS A . n A 1 123 SER 123 121 121 SER SER A . n A 1 124 MET 124 122 122 MET MET A . n A 1 125 GLY 125 123 123 GLY GLY A . n A 1 126 GLY 126 124 124 GLY GLY A . n A 1 127 TYR 127 125 125 TYR TYR A . n A 1 128 GLY 128 126 126 GLY GLY A . n A 1 129 THR 129 127 127 THR THR A . n A 1 130 ILE 130 128 128 ILE ILE A . n A 1 131 LYS 131 129 129 LYS LYS A . n A 1 132 PHE 132 130 130 PHE PHE A . n A 1 133 ALA 133 131 131 ALA ALA A . n A 1 134 LEU 134 132 132 LEU LEU A . n A 1 135 THR 135 133 133 THR THR A . n A 1 136 GLN 136 134 134 GLN GLN A . n A 1 137 GLY 137 135 135 GLY GLY A . n A 1 138 ASP 138 136 136 ASP ASP A . n A 1 139 LYS 139 137 137 LYS LYS A . n A 1 140 PHE 140 138 138 PHE PHE A . n A 1 141 ALA 141 139 139 ALA ALA A . n A 1 142 LYS 142 140 140 LYS LYS A . n A 1 143 ALA 143 141 141 ALA ALA A . n A 1 144 VAL 144 142 142 VAL VAL A . n A 1 145 PRO 145 143 143 PRO PRO A . n A 1 146 LEU 146 144 144 LEU LEU A . n A 1 147 SER 147 145 145 SER SER A . n A 1 148 ALA 148 146 146 ALA ALA A . n A 1 149 VAL 149 147 147 VAL VAL A . n A 1 150 PHE 150 148 148 PHE PHE A . n A 1 151 GLU 151 149 149 GLU GLU A . n A 1 152 ALA 152 150 150 ALA ALA A . n A 1 153 GLN 153 151 151 GLN GLN A . n A 1 154 ASN 154 152 152 ASN ASN A . n A 1 155 LEU 155 153 153 LEU LEU A . n A 1 156 MET 156 154 154 MET MET A . n A 1 157 ASP 157 155 155 ASP ASP A . n A 1 158 LEU 158 156 156 LEU LEU A . n A 1 159 GLU 159 157 157 GLU GLU A . n A 1 160 TRP 160 158 158 TRP TRP A . n A 1 161 ASN 161 159 159 ASN ASN A . n A 1 162 ASP 162 160 160 ASP ASP A . n A 1 163 PHE 163 161 161 PHE PHE A . n A 1 164 SER 164 162 162 SER SER A . n A 1 165 LYS 165 163 163 LYS LYS A . n A 1 166 GLU 166 164 164 GLU GLU A . n A 1 167 ALA 167 165 165 ALA ALA A . n A 1 168 ILE 168 166 166 ILE ILE A . n A 1 169 ILE 169 167 167 ILE ILE A . n A 1 170 GLY 170 168 168 GLY GLY A . n A 1 171 ASN 171 169 169 ASN ASN A . n A 1 172 LEU 172 170 170 LEU LEU A . n A 1 173 SER 173 171 171 SER SER A . n A 1 174 SER 174 172 172 SER SER A . n A 1 175 VAL 175 173 173 VAL VAL A . n A 1 176 LYS 176 174 174 LYS LYS A . n A 1 177 GLY 177 175 175 GLY GLY A . n A 1 178 THR 178 176 176 THR THR A . n A 1 179 GLU 179 177 177 GLU GLU A . n A 1 180 HIS 180 178 178 HIS HIS A . n A 1 181 ASP 181 179 179 ASP ASP A . n A 1 182 PRO 182 180 180 PRO PRO A . n A 1 183 TYR 183 181 181 TYR TYR A . n A 1 184 TYR 184 182 182 TYR TYR A . n A 1 185 LEU 185 183 183 LEU LEU A . n A 1 186 LEU 186 184 184 LEU LEU A . n A 1 187 ASP 187 185 185 ASP ASP A . n A 1 188 LYS 188 186 186 LYS LYS A . n A 1 189 ALA 189 187 187 ALA ALA A . n A 1 190 VAL 190 188 188 VAL VAL A . n A 1 191 ALA 191 189 189 ALA ALA A . n A 1 192 GLU 192 190 190 GLU GLU A . n A 1 193 ASP 193 191 191 ASP ASP A . n A 1 194 LYS 194 192 192 LYS LYS A . n A 1 195 GLN 195 193 193 GLN GLN A . n A 1 196 ILE 196 194 194 ILE ILE A . n A 1 197 PRO 197 195 195 PRO PRO A . n A 1 198 LYS 198 196 196 LYS LYS A . n A 1 199 LEU 199 197 197 LEU LEU A . n A 1 200 LEU 200 198 198 LEU LEU A . n A 1 201 ILE 201 199 199 ILE ILE A . n A 1 202 MET 202 200 200 MET MET A . n A 1 203 CYS 203 201 201 CYS CYS A . n A 1 204 GLY 204 202 202 GLY GLY A . n A 1 205 LYS 205 203 203 LYS LYS A . n A 1 206 GLN 206 204 204 GLN GLN A . n A 1 207 ASP 207 205 205 ASP ASP A . n A 1 208 PHE 208 206 206 PHE PHE A . n A 1 209 LEU 209 207 207 LEU LEU A . n A 1 210 TYR 210 208 208 TYR TYR A . n A 1 211 GLN 211 209 209 GLN GLN A . n A 1 212 ASP 212 210 210 ASP ASP A . n A 1 213 ASN 213 211 211 ASN ASN A . n A 1 214 LEU 214 212 212 LEU LEU A . n A 1 215 ASP 215 213 213 ASP ASP A . n A 1 216 PHE 216 214 214 PHE PHE A . n A 1 217 ILE 217 215 215 ILE ILE A . n A 1 218 ASP 218 216 216 ASP ASP A . n A 1 219 TYR 219 217 217 TYR TYR A . n A 1 220 LEU 220 218 218 LEU LEU A . n A 1 221 SER 221 219 219 SER SER A . n A 1 222 ARG 222 220 220 ARG ARG A . n A 1 223 ILE 223 221 221 ILE ILE A . n A 1 224 ASN 224 222 222 ASN ASN A . n A 1 225 VAL 225 223 223 VAL VAL A . n A 1 226 PRO 226 224 224 PRO PRO A . n A 1 227 TYR 227 225 225 TYR TYR A . n A 1 228 GLN 228 226 226 GLN GLN A . n A 1 229 PHE 229 227 227 PHE PHE A . n A 1 230 GLU 230 228 228 GLU GLU A . n A 1 231 ASP 231 229 229 ASP ASP A . n A 1 232 GLY 232 230 230 GLY GLY A . n A 1 233 PRO 233 231 231 PRO PRO A . n A 1 234 GLY 234 232 232 GLY GLY A . n A 1 235 ASP 235 233 233 ASP ASP A . n A 1 236 HIS 236 234 234 HIS HIS A . n A 1 237 ASP 237 235 235 ASP ASP A . n A 1 238 TYR 238 236 236 TYR TYR A . n A 1 239 ALA 239 237 237 ALA ALA A . n A 1 240 TYR 240 238 238 TYR TYR A . n A 1 241 TRP 241 239 239 TRP TRP A . n A 1 242 ASP 242 240 240 ASP ASP A . n A 1 243 GLN 243 241 241 GLN GLN A . n A 1 244 ALA 244 242 242 ALA ALA A . n A 1 245 ILE 245 243 243 ILE ILE A . n A 1 246 LYS 246 244 244 LYS LYS A . n A 1 247 ARG 247 245 245 ARG ARG A . n A 1 248 ALA 248 246 246 ALA ALA A . n A 1 249 ILE 249 247 247 ILE ILE A . n A 1 250 THR 250 248 248 THR THR A . n A 1 251 TRP 251 249 249 TRP TRP A . n A 1 252 MET 252 250 250 MET MET A . n A 1 253 VAL 253 251 251 VAL VAL A . n A 1 254 ASN 254 252 252 ASN ASN A . n A 1 255 ASP 255 253 253 ASP ASP A . n B 1 1 GLY 1 -1 -1 GLY GLY B . n B 1 2 PRO 2 0 0 PRO PRO B . n B 1 3 GLY 3 1 1 GLY GLY B . n B 1 4 ALA 4 2 2 ALA ALA B . n B 1 5 TYR 5 3 3 TYR TYR B . n B 1 6 ILE 6 4 4 ILE ILE B . n B 1 7 SER 7 5 5 SER SER B . n B 1 8 LEU 8 6 6 LEU LEU B . n B 1 9 ASN 9 7 7 ASN ASN B . n B 1 10 TYR 10 8 8 TYR TYR B . n B 1 11 HIS 11 9 9 HIS HIS B . n B 1 12 SER 12 10 10 SER SER B . n B 1 13 PRO 13 11 11 PRO PRO B . n B 1 14 THR 14 12 12 THR THR B . n B 1 15 ILE 15 13 13 ILE ILE B . n B 1 16 GLY 16 14 14 GLY GLY B . n B 1 17 MET 17 15 15 MET MET B . n B 1 18 HIS 18 16 16 HIS HIS B . n B 1 19 GLN 19 17 17 GLN GLN B . n B 1 20 ASN 20 18 18 ASN ASN B . n B 1 21 LEU 21 19 19 LEU LEU B . n B 1 22 THR 22 20 20 THR THR B . n B 1 23 VAL 23 21 21 VAL VAL B . n B 1 24 ILE 24 22 22 ILE ILE B . n B 1 25 LEU 25 23 23 LEU LEU B . n B 1 26 PRO 26 24 24 PRO PRO B . n B 1 27 GLU 27 25 25 GLU GLU B . n B 1 28 ASP 28 26 26 ASP ASP B . n B 1 29 GLN 29 27 27 GLN GLN B . n B 1 30 SER 30 28 28 SER SER B . n B 1 31 PHE 31 29 29 PHE PHE B . n B 1 32 PHE 32 30 30 PHE PHE B . n B 1 33 ASN 33 31 31 ASN ASN B . n B 1 34 SER 34 32 32 SER SER B . n B 1 35 ASP 35 33 33 ASP ASP B . n B 1 36 THR 36 34 34 THR THR B . n B 1 37 THR 37 35 35 THR THR B . n B 1 38 VAL 38 36 36 VAL VAL B . n B 1 39 LYS 39 37 37 LYS LYS B . n B 1 40 PRO 40 38 38 PRO PRO B . n B 1 41 LEU 41 39 39 LEU LEU B . n B 1 42 LYS 42 40 40 LYS LYS B . n B 1 43 THR 43 41 41 THR THR B . n B 1 44 LEU 44 42 42 LEU LEU B . n B 1 45 MET 45 43 43 MET MET B . n B 1 46 LEU 46 44 44 LEU LEU B . n B 1 47 LEU 47 45 45 LEU LEU B . n B 1 48 HIS 48 46 46 HIS HIS B . n B 1 49 GLY 49 47 47 GLY GLY B . n B 1 50 LEU 50 48 48 LEU LEU B . n B 1 51 SER 51 49 49 SER SER B . n B 1 52 SER 52 50 50 SER SER B . n B 1 53 ASP 53 51 51 ASP ASP B . n B 1 54 GLU 54 52 52 GLU GLU B . n B 1 55 THR 55 53 53 THR THR B . n B 1 56 THR 56 54 54 THR THR B . n B 1 57 TYR 57 55 55 TYR TYR B . n B 1 58 MET 58 56 56 MET MET B . n B 1 59 ARG 59 57 57 ARG ARG B . n B 1 60 TYR 60 58 58 TYR TYR B . n B 1 61 THR 61 59 59 THR THR B . n B 1 62 SER 62 60 60 SER SER B . n B 1 63 ILE 63 61 61 ILE ILE B . n B 1 64 GLU 64 62 62 GLU GLU B . n B 1 65 ARG 65 63 63 ARG ARG B . n B 1 66 TYR 66 64 64 TYR TYR B . n B 1 67 ALA 67 65 65 ALA ALA B . n B 1 68 ASN 68 66 66 ASN ASN B . n B 1 69 GLU 69 67 67 GLU GLU B . n B 1 70 HIS 70 68 68 HIS HIS B . n B 1 71 LYS 71 69 69 LYS LYS B . n B 1 72 LEU 72 70 70 LEU LEU B . n B 1 73 ALA 73 71 71 ALA ALA B . n B 1 74 VAL 74 72 72 VAL VAL B . n B 1 75 ILE 75 73 73 ILE ILE B . n B 1 76 MET 76 74 74 MET MET B . n B 1 77 PRO 77 75 75 PRO PRO B . n B 1 78 ASN 78 76 76 ASN ASN B . n B 1 79 VAL 79 77 77 VAL VAL B . n B 1 80 ASP 80 78 78 ASP ASP B . n B 1 81 HIS 81 79 79 HIS HIS B . n B 1 82 SER 82 80 80 SER SER B . n B 1 83 ALA 83 81 81 ALA ALA B . n B 1 84 TYR 84 82 82 TYR TYR B . n B 1 85 ALA 85 83 83 ALA ALA B . n B 1 86 ASN 86 84 84 ASN ASN B . n B 1 87 MET 87 85 85 MET MET B . n B 1 88 ALA 88 86 86 ALA ALA B . n B 1 89 TYR 89 87 87 TYR TYR B . n B 1 90 GLY 90 88 88 GLY GLY B . n B 1 91 HIS 91 89 89 HIS HIS B . n B 1 92 SER 92 90 90 SER SER B . n B 1 93 TYR 93 91 91 TYR TYR B . n B 1 94 TYR 94 92 92 TYR TYR B . n B 1 95 ASP 95 93 93 ASP ASP B . n B 1 96 TYR 96 94 94 TYR TYR B . n B 1 97 ILE 97 95 95 ILE ILE B . n B 1 98 LEU 98 96 96 LEU LEU B . n B 1 99 GLU 99 97 97 GLU GLU B . n B 1 100 VAL 100 98 98 VAL VAL B . n B 1 101 TYR 101 99 99 TYR TYR B . n B 1 102 ASP 102 100 100 ASP ASP B . n B 1 103 TYR 103 101 101 TYR TYR B . n B 1 104 VAL 104 102 102 VAL VAL B . n B 1 105 HIS 105 103 103 HIS HIS B . n B 1 106 GLN 106 104 104 GLN GLN B . n B 1 107 ILE 107 105 105 ILE ILE B . n B 1 108 PHE 108 106 106 PHE PHE B . n B 1 109 PRO 109 107 107 PRO PRO B . n B 1 110 LEU 110 108 108 LEU LEU B . n B 1 111 SER 111 109 109 SER SER B . n B 1 112 LYS 112 110 110 LYS LYS B . n B 1 113 LYS 113 111 111 LYS LYS B . n B 1 114 ARG 114 112 112 ARG ARG B . n B 1 115 ASP 115 113 113 ASP ASP B . n B 1 116 ASP 116 114 114 ASP ASP B . n B 1 117 ASN 117 115 115 ASN ASN B . n B 1 118 PHE 118 116 116 PHE PHE B . n B 1 119 ILE 119 117 117 ILE ILE B . n B 1 120 ALA 120 118 118 ALA ALA B . n B 1 121 GLY 121 119 119 GLY GLY B . n B 1 122 HIS 122 120 120 HIS HIS B . n B 1 123 SER 123 121 121 SER SER B . n B 1 124 MET 124 122 122 MET MET B . n B 1 125 GLY 125 123 123 GLY GLY B . n B 1 126 GLY 126 124 124 GLY GLY B . n B 1 127 TYR 127 125 125 TYR TYR B . n B 1 128 GLY 128 126 126 GLY GLY B . n B 1 129 THR 129 127 127 THR THR B . n B 1 130 ILE 130 128 128 ILE ILE B . n B 1 131 LYS 131 129 129 LYS LYS B . n B 1 132 PHE 132 130 130 PHE PHE B . n B 1 133 ALA 133 131 131 ALA ALA B . n B 1 134 LEU 134 132 132 LEU LEU B . n B 1 135 THR 135 133 133 THR THR B . n B 1 136 GLN 136 134 134 GLN GLN B . n B 1 137 GLY 137 135 135 GLY GLY B . n B 1 138 ASP 138 136 136 ASP ASP B . n B 1 139 LYS 139 137 137 LYS LYS B . n B 1 140 PHE 140 138 138 PHE PHE B . n B 1 141 ALA 141 139 139 ALA ALA B . n B 1 142 LYS 142 140 140 LYS LYS B . n B 1 143 ALA 143 141 141 ALA ALA B . n B 1 144 VAL 144 142 142 VAL VAL B . n B 1 145 PRO 145 143 143 PRO PRO B . n B 1 146 LEU 146 144 144 LEU LEU B . n B 1 147 SER 147 145 145 SER SER B . n B 1 148 ALA 148 146 146 ALA ALA B . n B 1 149 VAL 149 147 147 VAL VAL B . n B 1 150 PHE 150 148 148 PHE PHE B . n B 1 151 GLU 151 149 149 GLU GLU B . n B 1 152 ALA 152 150 150 ALA ALA B . n B 1 153 GLN 153 151 151 GLN GLN B . n B 1 154 ASN 154 152 152 ASN ASN B . n B 1 155 LEU 155 153 153 LEU LEU B . n B 1 156 MET 156 154 154 MET MET B . n B 1 157 ASP 157 155 155 ASP ASP B . n B 1 158 LEU 158 156 156 LEU LEU B . n B 1 159 GLU 159 157 157 GLU GLU B . n B 1 160 TRP 160 158 158 TRP TRP B . n B 1 161 ASN 161 159 159 ASN ASN B . n B 1 162 ASP 162 160 160 ASP ASP B . n B 1 163 PHE 163 161 161 PHE PHE B . n B 1 164 SER 164 162 162 SER SER B . n B 1 165 LYS 165 163 163 LYS LYS B . n B 1 166 GLU 166 164 164 GLU GLU B . n B 1 167 ALA 167 165 165 ALA ALA B . n B 1 168 ILE 168 166 166 ILE ILE B . n B 1 169 ILE 169 167 167 ILE ILE B . n B 1 170 GLY 170 168 168 GLY GLY B . n B 1 171 ASN 171 169 169 ASN ASN B . n B 1 172 LEU 172 170 170 LEU LEU B . n B 1 173 SER 173 171 171 SER SER B . n B 1 174 SER 174 172 172 SER SER B . n B 1 175 VAL 175 173 173 VAL VAL B . n B 1 176 LYS 176 174 174 LYS LYS B . n B 1 177 GLY 177 175 175 GLY GLY B . n B 1 178 THR 178 176 176 THR THR B . n B 1 179 GLU 179 177 177 GLU GLU B . n B 1 180 HIS 180 178 178 HIS HIS B . n B 1 181 ASP 181 179 179 ASP ASP B . n B 1 182 PRO 182 180 180 PRO PRO B . n B 1 183 TYR 183 181 181 TYR TYR B . n B 1 184 TYR 184 182 182 TYR TYR B . n B 1 185 LEU 185 183 183 LEU LEU B . n B 1 186 LEU 186 184 184 LEU LEU B . n B 1 187 ASP 187 185 185 ASP ASP B . n B 1 188 LYS 188 186 186 LYS LYS B . n B 1 189 ALA 189 187 187 ALA ALA B . n B 1 190 VAL 190 188 188 VAL VAL B . n B 1 191 ALA 191 189 189 ALA ALA B . n B 1 192 GLU 192 190 190 GLU GLU B . n B 1 193 ASP 193 191 191 ASP ASP B . n B 1 194 LYS 194 192 192 LYS LYS B . n B 1 195 GLN 195 193 193 GLN GLN B . n B 1 196 ILE 196 194 194 ILE ILE B . n B 1 197 PRO 197 195 195 PRO PRO B . n B 1 198 LYS 198 196 196 LYS LYS B . n B 1 199 LEU 199 197 197 LEU LEU B . n B 1 200 LEU 200 198 198 LEU LEU B . n B 1 201 ILE 201 199 199 ILE ILE B . n B 1 202 MET 202 200 200 MET MET B . n B 1 203 CYS 203 201 201 CYS CYS B . n B 1 204 GLY 204 202 202 GLY GLY B . n B 1 205 LYS 205 203 203 LYS LYS B . n B 1 206 GLN 206 204 204 GLN GLN B . n B 1 207 ASP 207 205 205 ASP ASP B . n B 1 208 PHE 208 206 206 PHE PHE B . n B 1 209 LEU 209 207 207 LEU LEU B . n B 1 210 TYR 210 208 208 TYR TYR B . n B 1 211 GLN 211 209 209 GLN GLN B . n B 1 212 ASP 212 210 210 ASP ASP B . n B 1 213 ASN 213 211 211 ASN ASN B . n B 1 214 LEU 214 212 212 LEU LEU B . n B 1 215 ASP 215 213 213 ASP ASP B . n B 1 216 PHE 216 214 214 PHE PHE B . n B 1 217 ILE 217 215 215 ILE ILE B . n B 1 218 ASP 218 216 216 ASP ASP B . n B 1 219 TYR 219 217 217 TYR TYR B . n B 1 220 LEU 220 218 218 LEU LEU B . n B 1 221 SER 221 219 219 SER SER B . n B 1 222 ARG 222 220 220 ARG ARG B . n B 1 223 ILE 223 221 221 ILE ILE B . n B 1 224 ASN 224 222 222 ASN ASN B . n B 1 225 VAL 225 223 223 VAL VAL B . n B 1 226 PRO 226 224 224 PRO PRO B . n B 1 227 TYR 227 225 225 TYR TYR B . n B 1 228 GLN 228 226 226 GLN GLN B . n B 1 229 PHE 229 227 227 PHE PHE B . n B 1 230 GLU 230 228 228 GLU GLU B . n B 1 231 ASP 231 229 229 ASP ASP B . n B 1 232 GLY 232 230 230 GLY GLY B . n B 1 233 PRO 233 231 231 PRO PRO B . n B 1 234 GLY 234 232 232 GLY GLY B . n B 1 235 ASP 235 233 233 ASP ASP B . n B 1 236 HIS 236 234 234 HIS HIS B . n B 1 237 ASP 237 235 235 ASP ASP B . n B 1 238 TYR 238 236 236 TYR TYR B . n B 1 239 ALA 239 237 237 ALA ALA B . n B 1 240 TYR 240 238 238 TYR TYR B . n B 1 241 TRP 241 239 239 TRP TRP B . n B 1 242 ASP 242 240 240 ASP ASP B . n B 1 243 GLN 243 241 241 GLN GLN B . n B 1 244 ALA 244 242 242 ALA ALA B . n B 1 245 ILE 245 243 243 ILE ILE B . n B 1 246 LYS 246 244 244 LYS LYS B . n B 1 247 ARG 247 245 245 ARG ARG B . n B 1 248 ALA 248 246 246 ALA ALA B . n B 1 249 ILE 249 247 247 ILE ILE B . n B 1 250 THR 250 248 248 THR THR B . n B 1 251 TRP 251 249 249 TRP TRP B . n B 1 252 MET 252 250 250 MET MET B . n B 1 253 VAL 253 251 251 VAL VAL B . n B 1 254 ASN 254 252 252 ASN ASN B . n B 1 255 ASP 255 253 253 ASP ASP B . n C 1 1 GLY 1 -1 -1 GLY GLY C . n C 1 2 PRO 2 0 0 PRO PRO C . n C 1 3 GLY 3 1 1 GLY GLY C . n C 1 4 ALA 4 2 2 ALA ALA C . n C 1 5 TYR 5 3 3 TYR TYR C . n C 1 6 ILE 6 4 4 ILE ILE C . n C 1 7 SER 7 5 5 SER SER C . n C 1 8 LEU 8 6 6 LEU LEU C . n C 1 9 ASN 9 7 7 ASN ASN C . n C 1 10 TYR 10 8 8 TYR TYR C . n C 1 11 HIS 11 9 9 HIS HIS C . n C 1 12 SER 12 10 10 SER SER C . n C 1 13 PRO 13 11 11 PRO PRO C . n C 1 14 THR 14 12 12 THR THR C . n C 1 15 ILE 15 13 13 ILE ILE C . n C 1 16 GLY 16 14 14 GLY GLY C . n C 1 17 MET 17 15 15 MET MET C . n C 1 18 HIS 18 16 16 HIS HIS C . n C 1 19 GLN 19 17 17 GLN GLN C . n C 1 20 ASN 20 18 18 ASN ASN C . n C 1 21 LEU 21 19 19 LEU LEU C . n C 1 22 THR 22 20 20 THR THR C . n C 1 23 VAL 23 21 21 VAL VAL C . n C 1 24 ILE 24 22 22 ILE ILE C . n C 1 25 LEU 25 23 23 LEU LEU C . n C 1 26 PRO 26 24 24 PRO PRO C . n C 1 27 GLU 27 25 25 GLU GLU C . n C 1 28 ASP 28 26 26 ASP ASP C . n C 1 29 GLN 29 27 27 GLN GLN C . n C 1 30 SER 30 28 28 SER SER C . n C 1 31 PHE 31 29 29 PHE PHE C . n C 1 32 PHE 32 30 30 PHE PHE C . n C 1 33 ASN 33 31 31 ASN ASN C . n C 1 34 SER 34 32 32 SER SER C . n C 1 35 ASP 35 33 33 ASP ASP C . n C 1 36 THR 36 34 34 THR THR C . n C 1 37 THR 37 35 35 THR THR C . n C 1 38 VAL 38 36 36 VAL VAL C . n C 1 39 LYS 39 37 37 LYS LYS C . n C 1 40 PRO 40 38 38 PRO PRO C . n C 1 41 LEU 41 39 39 LEU LEU C . n C 1 42 LYS 42 40 40 LYS LYS C . n C 1 43 THR 43 41 41 THR THR C . n C 1 44 LEU 44 42 42 LEU LEU C . n C 1 45 MET 45 43 43 MET MET C . n C 1 46 LEU 46 44 44 LEU LEU C . n C 1 47 LEU 47 45 45 LEU LEU C . n C 1 48 HIS 48 46 46 HIS HIS C . n C 1 49 GLY 49 47 47 GLY GLY C . n C 1 50 LEU 50 48 48 LEU LEU C . n C 1 51 SER 51 49 49 SER SER C . n C 1 52 SER 52 50 50 SER SER C . n C 1 53 ASP 53 51 51 ASP ASP C . n C 1 54 GLU 54 52 52 GLU GLU C . n C 1 55 THR 55 53 53 THR THR C . n C 1 56 THR 56 54 54 THR THR C . n C 1 57 TYR 57 55 55 TYR TYR C . n C 1 58 MET 58 56 56 MET MET C . n C 1 59 ARG 59 57 57 ARG ARG C . n C 1 60 TYR 60 58 58 TYR TYR C . n C 1 61 THR 61 59 59 THR THR C . n C 1 62 SER 62 60 60 SER SER C . n C 1 63 ILE 63 61 61 ILE ILE C . n C 1 64 GLU 64 62 62 GLU GLU C . n C 1 65 ARG 65 63 63 ARG ARG C . n C 1 66 TYR 66 64 64 TYR TYR C . n C 1 67 ALA 67 65 65 ALA ALA C . n C 1 68 ASN 68 66 66 ASN ASN C . n C 1 69 GLU 69 67 67 GLU GLU C . n C 1 70 HIS 70 68 68 HIS HIS C . n C 1 71 LYS 71 69 69 LYS LYS C . n C 1 72 LEU 72 70 70 LEU LEU C . n C 1 73 ALA 73 71 71 ALA ALA C . n C 1 74 VAL 74 72 72 VAL VAL C . n C 1 75 ILE 75 73 73 ILE ILE C . n C 1 76 MET 76 74 74 MET MET C . n C 1 77 PRO 77 75 75 PRO PRO C . n C 1 78 ASN 78 76 76 ASN ASN C . n C 1 79 VAL 79 77 77 VAL VAL C . n C 1 80 ASP 80 78 78 ASP ASP C . n C 1 81 HIS 81 79 79 HIS HIS C . n C 1 82 SER 82 80 80 SER SER C . n C 1 83 ALA 83 81 81 ALA ALA C . n C 1 84 TYR 84 82 82 TYR TYR C . n C 1 85 ALA 85 83 83 ALA ALA C . n C 1 86 ASN 86 84 84 ASN ASN C . n C 1 87 MET 87 85 85 MET MET C . n C 1 88 ALA 88 86 86 ALA ALA C . n C 1 89 TYR 89 87 87 TYR TYR C . n C 1 90 GLY 90 88 88 GLY GLY C . n C 1 91 HIS 91 89 89 HIS HIS C . n C 1 92 SER 92 90 90 SER SER C . n C 1 93 TYR 93 91 91 TYR TYR C . n C 1 94 TYR 94 92 92 TYR TYR C . n C 1 95 ASP 95 93 93 ASP ASP C . n C 1 96 TYR 96 94 94 TYR TYR C . n C 1 97 ILE 97 95 95 ILE ILE C . n C 1 98 LEU 98 96 96 LEU LEU C . n C 1 99 GLU 99 97 97 GLU GLU C . n C 1 100 VAL 100 98 98 VAL VAL C . n C 1 101 TYR 101 99 99 TYR TYR C . n C 1 102 ASP 102 100 100 ASP ASP C . n C 1 103 TYR 103 101 101 TYR TYR C . n C 1 104 VAL 104 102 102 VAL VAL C . n C 1 105 HIS 105 103 103 HIS HIS C . n C 1 106 GLN 106 104 104 GLN GLN C . n C 1 107 ILE 107 105 105 ILE ILE C . n C 1 108 PHE 108 106 106 PHE PHE C . n C 1 109 PRO 109 107 107 PRO PRO C . n C 1 110 LEU 110 108 108 LEU LEU C . n C 1 111 SER 111 109 109 SER SER C . n C 1 112 LYS 112 110 110 LYS LYS C . n C 1 113 LYS 113 111 111 LYS LYS C . n C 1 114 ARG 114 112 112 ARG ARG C . n C 1 115 ASP 115 113 113 ASP ASP C . n C 1 116 ASP 116 114 114 ASP ASP C . n C 1 117 ASN 117 115 115 ASN ASN C . n C 1 118 PHE 118 116 116 PHE PHE C . n C 1 119 ILE 119 117 117 ILE ILE C . n C 1 120 ALA 120 118 118 ALA ALA C . n C 1 121 GLY 121 119 119 GLY GLY C . n C 1 122 HIS 122 120 120 HIS HIS C . n C 1 123 SER 123 121 121 SER SER C . n C 1 124 MET 124 122 122 MET MET C . n C 1 125 GLY 125 123 123 GLY GLY C . n C 1 126 GLY 126 124 124 GLY GLY C . n C 1 127 TYR 127 125 125 TYR TYR C . n C 1 128 GLY 128 126 126 GLY GLY C . n C 1 129 THR 129 127 127 THR THR C . n C 1 130 ILE 130 128 128 ILE ILE C . n C 1 131 LYS 131 129 129 LYS LYS C . n C 1 132 PHE 132 130 130 PHE PHE C . n C 1 133 ALA 133 131 131 ALA ALA C . n C 1 134 LEU 134 132 132 LEU LEU C . n C 1 135 THR 135 133 133 THR THR C . n C 1 136 GLN 136 134 134 GLN GLN C . n C 1 137 GLY 137 135 135 GLY GLY C . n C 1 138 ASP 138 136 136 ASP ASP C . n C 1 139 LYS 139 137 137 LYS LYS C . n C 1 140 PHE 140 138 138 PHE PHE C . n C 1 141 ALA 141 139 139 ALA ALA C . n C 1 142 LYS 142 140 140 LYS LYS C . n C 1 143 ALA 143 141 141 ALA ALA C . n C 1 144 VAL 144 142 142 VAL VAL C . n C 1 145 PRO 145 143 143 PRO PRO C . n C 1 146 LEU 146 144 144 LEU LEU C . n C 1 147 SER 147 145 145 SER SER C . n C 1 148 ALA 148 146 146 ALA ALA C . n C 1 149 VAL 149 147 147 VAL VAL C . n C 1 150 PHE 150 148 148 PHE PHE C . n C 1 151 GLU 151 149 149 GLU GLU C . n C 1 152 ALA 152 150 150 ALA ALA C . n C 1 153 GLN 153 151 151 GLN GLN C . n C 1 154 ASN 154 152 152 ASN ASN C . n C 1 155 LEU 155 153 153 LEU LEU C . n C 1 156 MET 156 154 154 MET MET C . n C 1 157 ASP 157 155 155 ASP ASP C . n C 1 158 LEU 158 156 156 LEU LEU C . n C 1 159 GLU 159 157 157 GLU GLU C . n C 1 160 TRP 160 158 158 TRP TRP C . n C 1 161 ASN 161 159 159 ASN ASN C . n C 1 162 ASP 162 160 160 ASP ASP C . n C 1 163 PHE 163 161 161 PHE PHE C . n C 1 164 SER 164 162 162 SER SER C . n C 1 165 LYS 165 163 163 LYS LYS C . n C 1 166 GLU 166 164 164 GLU GLU C . n C 1 167 ALA 167 165 165 ALA ALA C . n C 1 168 ILE 168 166 166 ILE ILE C . n C 1 169 ILE 169 167 167 ILE ILE C . n C 1 170 GLY 170 168 168 GLY GLY C . n C 1 171 ASN 171 169 169 ASN ASN C . n C 1 172 LEU 172 170 170 LEU LEU C . n C 1 173 SER 173 171 171 SER SER C . n C 1 174 SER 174 172 172 SER SER C . n C 1 175 VAL 175 173 173 VAL VAL C . n C 1 176 LYS 176 174 174 LYS LYS C . n C 1 177 GLY 177 175 175 GLY GLY C . n C 1 178 THR 178 176 176 THR THR C . n C 1 179 GLU 179 177 177 GLU GLU C . n C 1 180 HIS 180 178 178 HIS HIS C . n C 1 181 ASP 181 179 179 ASP ASP C . n C 1 182 PRO 182 180 180 PRO PRO C . n C 1 183 TYR 183 181 181 TYR TYR C . n C 1 184 TYR 184 182 182 TYR TYR C . n C 1 185 LEU 185 183 183 LEU LEU C . n C 1 186 LEU 186 184 184 LEU LEU C . n C 1 187 ASP 187 185 185 ASP ASP C . n C 1 188 LYS 188 186 186 LYS LYS C . n C 1 189 ALA 189 187 187 ALA ALA C . n C 1 190 VAL 190 188 188 VAL VAL C . n C 1 191 ALA 191 189 189 ALA ALA C . n C 1 192 GLU 192 190 190 GLU GLU C . n C 1 193 ASP 193 191 191 ASP ASP C . n C 1 194 LYS 194 192 192 LYS LYS C . n C 1 195 GLN 195 193 193 GLN GLN C . n C 1 196 ILE 196 194 194 ILE ILE C . n C 1 197 PRO 197 195 195 PRO PRO C . n C 1 198 LYS 198 196 196 LYS LYS C . n C 1 199 LEU 199 197 197 LEU LEU C . n C 1 200 LEU 200 198 198 LEU LEU C . n C 1 201 ILE 201 199 199 ILE ILE C . n C 1 202 MET 202 200 200 MET MET C . n C 1 203 CYS 203 201 201 CYS CYS C . n C 1 204 GLY 204 202 202 GLY GLY C . n C 1 205 LYS 205 203 203 LYS LYS C . n C 1 206 GLN 206 204 204 GLN GLN C . n C 1 207 ASP 207 205 205 ASP ASP C . n C 1 208 PHE 208 206 206 PHE PHE C . n C 1 209 LEU 209 207 207 LEU LEU C . n C 1 210 TYR 210 208 208 TYR TYR C . n C 1 211 GLN 211 209 209 GLN GLN C . n C 1 212 ASP 212 210 210 ASP ASP C . n C 1 213 ASN 213 211 211 ASN ASN C . n C 1 214 LEU 214 212 212 LEU LEU C . n C 1 215 ASP 215 213 213 ASP ASP C . n C 1 216 PHE 216 214 214 PHE PHE C . n C 1 217 ILE 217 215 215 ILE ILE C . n C 1 218 ASP 218 216 216 ASP ASP C . n C 1 219 TYR 219 217 217 TYR TYR C . n C 1 220 LEU 220 218 218 LEU LEU C . n C 1 221 SER 221 219 219 SER SER C . n C 1 222 ARG 222 220 220 ARG ARG C . n C 1 223 ILE 223 221 221 ILE ILE C . n C 1 224 ASN 224 222 222 ASN ASN C . n C 1 225 VAL 225 223 223 VAL VAL C . n C 1 226 PRO 226 224 224 PRO PRO C . n C 1 227 TYR 227 225 225 TYR TYR C . n C 1 228 GLN 228 226 226 GLN GLN C . n C 1 229 PHE 229 227 227 PHE PHE C . n C 1 230 GLU 230 228 228 GLU GLU C . n C 1 231 ASP 231 229 229 ASP ASP C . n C 1 232 GLY 232 230 230 GLY GLY C . n C 1 233 PRO 233 231 231 PRO PRO C . n C 1 234 GLY 234 232 232 GLY GLY C . n C 1 235 ASP 235 233 233 ASP ASP C . n C 1 236 HIS 236 234 234 HIS HIS C . n C 1 237 ASP 237 235 235 ASP ASP C . n C 1 238 TYR 238 236 236 TYR TYR C . n C 1 239 ALA 239 237 237 ALA ALA C . n C 1 240 TYR 240 238 238 TYR TYR C . n C 1 241 TRP 241 239 239 TRP TRP C . n C 1 242 ASP 242 240 240 ASP ASP C . n C 1 243 GLN 243 241 241 GLN GLN C . n C 1 244 ALA 244 242 242 ALA ALA C . n C 1 245 ILE 245 243 243 ILE ILE C . n C 1 246 LYS 246 244 244 LYS LYS C . n C 1 247 ARG 247 245 245 ARG ARG C . n C 1 248 ALA 248 246 246 ALA ALA C . n C 1 249 ILE 249 247 247 ILE ILE C . n C 1 250 THR 250 248 248 THR THR C . n C 1 251 TRP 251 249 249 TRP TRP C . n C 1 252 MET 252 250 250 MET MET C . n C 1 253 VAL 253 251 251 VAL VAL C . n C 1 254 ASN 254 252 252 ASN ASN C . n C 1 255 ASP 255 253 253 ASP ASP C . n D 1 1 GLY 1 -1 -1 GLY GLY D . n D 1 2 PRO 2 0 0 PRO PRO D . n D 1 3 GLY 3 1 1 GLY GLY D . n D 1 4 ALA 4 2 2 ALA ALA D . n D 1 5 TYR 5 3 3 TYR TYR D . n D 1 6 ILE 6 4 4 ILE ILE D . n D 1 7 SER 7 5 5 SER SER D . n D 1 8 LEU 8 6 6 LEU LEU D . n D 1 9 ASN 9 7 7 ASN ASN D . n D 1 10 TYR 10 8 8 TYR TYR D . n D 1 11 HIS 11 9 9 HIS HIS D . n D 1 12 SER 12 10 10 SER SER D . n D 1 13 PRO 13 11 11 PRO PRO D . n D 1 14 THR 14 12 12 THR THR D . n D 1 15 ILE 15 13 13 ILE ILE D . n D 1 16 GLY 16 14 14 GLY GLY D . n D 1 17 MET 17 15 15 MET MET D . n D 1 18 HIS 18 16 16 HIS HIS D . n D 1 19 GLN 19 17 17 GLN GLN D . n D 1 20 ASN 20 18 18 ASN ASN D . n D 1 21 LEU 21 19 19 LEU LEU D . n D 1 22 THR 22 20 20 THR THR D . n D 1 23 VAL 23 21 21 VAL VAL D . n D 1 24 ILE 24 22 22 ILE ILE D . n D 1 25 LEU 25 23 23 LEU LEU D . n D 1 26 PRO 26 24 24 PRO PRO D . n D 1 27 GLU 27 25 25 GLU GLU D . n D 1 28 ASP 28 26 26 ASP ASP D . n D 1 29 GLN 29 27 27 GLN GLN D . n D 1 30 SER 30 28 28 SER SER D . n D 1 31 PHE 31 29 29 PHE PHE D . n D 1 32 PHE 32 30 30 PHE PHE D . n D 1 33 ASN 33 31 31 ASN ASN D . n D 1 34 SER 34 32 32 SER SER D . n D 1 35 ASP 35 33 33 ASP ASP D . n D 1 36 THR 36 34 34 THR THR D . n D 1 37 THR 37 35 35 THR THR D . n D 1 38 VAL 38 36 36 VAL VAL D . n D 1 39 LYS 39 37 37 LYS LYS D . n D 1 40 PRO 40 38 38 PRO PRO D . n D 1 41 LEU 41 39 39 LEU LEU D . n D 1 42 LYS 42 40 40 LYS LYS D . n D 1 43 THR 43 41 41 THR THR D . n D 1 44 LEU 44 42 42 LEU LEU D . n D 1 45 MET 45 43 43 MET MET D . n D 1 46 LEU 46 44 44 LEU LEU D . n D 1 47 LEU 47 45 45 LEU LEU D . n D 1 48 HIS 48 46 46 HIS HIS D . n D 1 49 GLY 49 47 47 GLY GLY D . n D 1 50 LEU 50 48 48 LEU LEU D . n D 1 51 SER 51 49 49 SER SER D . n D 1 52 SER 52 50 50 SER SER D . n D 1 53 ASP 53 51 51 ASP ASP D . n D 1 54 GLU 54 52 52 GLU GLU D . n D 1 55 THR 55 53 53 THR THR D . n D 1 56 THR 56 54 54 THR THR D . n D 1 57 TYR 57 55 55 TYR TYR D . n D 1 58 MET 58 56 56 MET MET D . n D 1 59 ARG 59 57 57 ARG ARG D . n D 1 60 TYR 60 58 58 TYR TYR D . n D 1 61 THR 61 59 59 THR THR D . n D 1 62 SER 62 60 60 SER SER D . n D 1 63 ILE 63 61 61 ILE ILE D . n D 1 64 GLU 64 62 62 GLU GLU D . n D 1 65 ARG 65 63 63 ARG ARG D . n D 1 66 TYR 66 64 64 TYR TYR D . n D 1 67 ALA 67 65 65 ALA ALA D . n D 1 68 ASN 68 66 66 ASN ASN D . n D 1 69 GLU 69 67 67 GLU GLU D . n D 1 70 HIS 70 68 68 HIS HIS D . n D 1 71 LYS 71 69 69 LYS LYS D . n D 1 72 LEU 72 70 70 LEU LEU D . n D 1 73 ALA 73 71 71 ALA ALA D . n D 1 74 VAL 74 72 72 VAL VAL D . n D 1 75 ILE 75 73 73 ILE ILE D . n D 1 76 MET 76 74 74 MET MET D . n D 1 77 PRO 77 75 75 PRO PRO D . n D 1 78 ASN 78 76 76 ASN ASN D . n D 1 79 VAL 79 77 77 VAL VAL D . n D 1 80 ASP 80 78 78 ASP ASP D . n D 1 81 HIS 81 79 79 HIS HIS D . n D 1 82 SER 82 80 80 SER SER D . n D 1 83 ALA 83 81 81 ALA ALA D . n D 1 84 TYR 84 82 82 TYR TYR D . n D 1 85 ALA 85 83 83 ALA ALA D . n D 1 86 ASN 86 84 84 ASN ASN D . n D 1 87 MET 87 85 85 MET MET D . n D 1 88 ALA 88 86 86 ALA ALA D . n D 1 89 TYR 89 87 87 TYR TYR D . n D 1 90 GLY 90 88 88 GLY GLY D . n D 1 91 HIS 91 89 89 HIS HIS D . n D 1 92 SER 92 90 90 SER SER D . n D 1 93 TYR 93 91 91 TYR TYR D . n D 1 94 TYR 94 92 92 TYR TYR D . n D 1 95 ASP 95 93 93 ASP ASP D . n D 1 96 TYR 96 94 94 TYR TYR D . n D 1 97 ILE 97 95 95 ILE ILE D . n D 1 98 LEU 98 96 96 LEU LEU D . n D 1 99 GLU 99 97 97 GLU GLU D . n D 1 100 VAL 100 98 98 VAL VAL D . n D 1 101 TYR 101 99 99 TYR TYR D . n D 1 102 ASP 102 100 100 ASP ASP D . n D 1 103 TYR 103 101 101 TYR TYR D . n D 1 104 VAL 104 102 102 VAL VAL D . n D 1 105 HIS 105 103 103 HIS HIS D . n D 1 106 GLN 106 104 104 GLN GLN D . n D 1 107 ILE 107 105 105 ILE ILE D . n D 1 108 PHE 108 106 106 PHE PHE D . n D 1 109 PRO 109 107 107 PRO PRO D . n D 1 110 LEU 110 108 108 LEU LEU D . n D 1 111 SER 111 109 109 SER SER D . n D 1 112 LYS 112 110 110 LYS LYS D . n D 1 113 LYS 113 111 111 LYS LYS D . n D 1 114 ARG 114 112 112 ARG ARG D . n D 1 115 ASP 115 113 113 ASP ASP D . n D 1 116 ASP 116 114 114 ASP ASP D . n D 1 117 ASN 117 115 115 ASN ASN D . n D 1 118 PHE 118 116 116 PHE PHE D . n D 1 119 ILE 119 117 117 ILE ILE D . n D 1 120 ALA 120 118 118 ALA ALA D . n D 1 121 GLY 121 119 119 GLY GLY D . n D 1 122 HIS 122 120 120 HIS HIS D . n D 1 123 SER 123 121 121 SER SER D . n D 1 124 MET 124 122 122 MET MET D . n D 1 125 GLY 125 123 123 GLY GLY D . n D 1 126 GLY 126 124 124 GLY GLY D . n D 1 127 TYR 127 125 125 TYR TYR D . n D 1 128 GLY 128 126 126 GLY GLY D . n D 1 129 THR 129 127 127 THR THR D . n D 1 130 ILE 130 128 128 ILE ILE D . n D 1 131 LYS 131 129 129 LYS LYS D . n D 1 132 PHE 132 130 130 PHE PHE D . n D 1 133 ALA 133 131 131 ALA ALA D . n D 1 134 LEU 134 132 132 LEU LEU D . n D 1 135 THR 135 133 133 THR THR D . n D 1 136 GLN 136 134 134 GLN GLN D . n D 1 137 GLY 137 135 135 GLY GLY D . n D 1 138 ASP 138 136 136 ASP ASP D . n D 1 139 LYS 139 137 137 LYS LYS D . n D 1 140 PHE 140 138 138 PHE PHE D . n D 1 141 ALA 141 139 139 ALA ALA D . n D 1 142 LYS 142 140 140 LYS LYS D . n D 1 143 ALA 143 141 141 ALA ALA D . n D 1 144 VAL 144 142 142 VAL VAL D . n D 1 145 PRO 145 143 143 PRO PRO D . n D 1 146 LEU 146 144 144 LEU LEU D . n D 1 147 SER 147 145 145 SER SER D . n D 1 148 ALA 148 146 146 ALA ALA D . n D 1 149 VAL 149 147 147 VAL VAL D . n D 1 150 PHE 150 148 148 PHE PHE D . n D 1 151 GLU 151 149 149 GLU GLU D . n D 1 152 ALA 152 150 150 ALA ALA D . n D 1 153 GLN 153 151 151 GLN GLN D . n D 1 154 ASN 154 152 152 ASN ASN D . n D 1 155 LEU 155 153 153 LEU LEU D . n D 1 156 MET 156 154 154 MET MET D . n D 1 157 ASP 157 155 155 ASP ASP D . n D 1 158 LEU 158 156 156 LEU LEU D . n D 1 159 GLU 159 157 157 GLU GLU D . n D 1 160 TRP 160 158 158 TRP TRP D . n D 1 161 ASN 161 159 159 ASN ASN D . n D 1 162 ASP 162 160 160 ASP ASP D . n D 1 163 PHE 163 161 161 PHE PHE D . n D 1 164 SER 164 162 162 SER SER D . n D 1 165 LYS 165 163 163 LYS LYS D . n D 1 166 GLU 166 164 164 GLU GLU D . n D 1 167 ALA 167 165 165 ALA ALA D . n D 1 168 ILE 168 166 166 ILE ILE D . n D 1 169 ILE 169 167 167 ILE ILE D . n D 1 170 GLY 170 168 168 GLY GLY D . n D 1 171 ASN 171 169 169 ASN ASN D . n D 1 172 LEU 172 170 170 LEU LEU D . n D 1 173 SER 173 171 171 SER SER D . n D 1 174 SER 174 172 172 SER SER D . n D 1 175 VAL 175 173 173 VAL VAL D . n D 1 176 LYS 176 174 174 LYS LYS D . n D 1 177 GLY 177 175 175 GLY GLY D . n D 1 178 THR 178 176 176 THR THR D . n D 1 179 GLU 179 177 177 GLU GLU D . n D 1 180 HIS 180 178 178 HIS HIS D . n D 1 181 ASP 181 179 179 ASP ASP D . n D 1 182 PRO 182 180 180 PRO PRO D . n D 1 183 TYR 183 181 181 TYR TYR D . n D 1 184 TYR 184 182 182 TYR TYR D . n D 1 185 LEU 185 183 183 LEU LEU D . n D 1 186 LEU 186 184 184 LEU LEU D . n D 1 187 ASP 187 185 185 ASP ASP D . n D 1 188 LYS 188 186 186 LYS LYS D . n D 1 189 ALA 189 187 187 ALA ALA D . n D 1 190 VAL 190 188 188 VAL VAL D . n D 1 191 ALA 191 189 189 ALA ALA D . n D 1 192 GLU 192 190 190 GLU GLU D . n D 1 193 ASP 193 191 191 ASP ASP D . n D 1 194 LYS 194 192 192 LYS LYS D . n D 1 195 GLN 195 193 193 GLN GLN D . n D 1 196 ILE 196 194 194 ILE ILE D . n D 1 197 PRO 197 195 195 PRO PRO D . n D 1 198 LYS 198 196 196 LYS LYS D . n D 1 199 LEU 199 197 197 LEU LEU D . n D 1 200 LEU 200 198 198 LEU LEU D . n D 1 201 ILE 201 199 199 ILE ILE D . n D 1 202 MET 202 200 200 MET MET D . n D 1 203 CYS 203 201 201 CYS CYS D . n D 1 204 GLY 204 202 202 GLY GLY D . n D 1 205 LYS 205 203 203 LYS LYS D . n D 1 206 GLN 206 204 204 GLN GLN D . n D 1 207 ASP 207 205 205 ASP ASP D . n D 1 208 PHE 208 206 206 PHE PHE D . n D 1 209 LEU 209 207 207 LEU LEU D . n D 1 210 TYR 210 208 208 TYR TYR D . n D 1 211 GLN 211 209 209 GLN GLN D . n D 1 212 ASP 212 210 210 ASP ASP D . n D 1 213 ASN 213 211 211 ASN ASN D . n D 1 214 LEU 214 212 212 LEU LEU D . n D 1 215 ASP 215 213 213 ASP ASP D . n D 1 216 PHE 216 214 214 PHE PHE D . n D 1 217 ILE 217 215 215 ILE ILE D . n D 1 218 ASP 218 216 216 ASP ASP D . n D 1 219 TYR 219 217 217 TYR TYR D . n D 1 220 LEU 220 218 218 LEU LEU D . n D 1 221 SER 221 219 219 SER SER D . n D 1 222 ARG 222 220 220 ARG ARG D . n D 1 223 ILE 223 221 221 ILE ILE D . n D 1 224 ASN 224 222 222 ASN ASN D . n D 1 225 VAL 225 223 223 VAL VAL D . n D 1 226 PRO 226 224 224 PRO PRO D . n D 1 227 TYR 227 225 225 TYR TYR D . n D 1 228 GLN 228 226 226 GLN GLN D . n D 1 229 PHE 229 227 227 PHE PHE D . n D 1 230 GLU 230 228 228 GLU GLU D . n D 1 231 ASP 231 229 229 ASP ASP D . n D 1 232 GLY 232 230 230 GLY GLY D . n D 1 233 PRO 233 231 231 PRO PRO D . n D 1 234 GLY 234 232 232 GLY GLY D . n D 1 235 ASP 235 233 233 ASP ASP D . n D 1 236 HIS 236 234 234 HIS HIS D . n D 1 237 ASP 237 235 235 ASP ASP D . n D 1 238 TYR 238 236 236 TYR TYR D . n D 1 239 ALA 239 237 237 ALA ALA D . n D 1 240 TYR 240 238 238 TYR TYR D . n D 1 241 TRP 241 239 239 TRP TRP D . n D 1 242 ASP 242 240 240 ASP ASP D . n D 1 243 GLN 243 241 241 GLN GLN D . n D 1 244 ALA 244 242 242 ALA ALA D . n D 1 245 ILE 245 243 243 ILE ILE D . n D 1 246 LYS 246 244 244 LYS LYS D . n D 1 247 ARG 247 245 245 ARG ARG D . n D 1 248 ALA 248 246 246 ALA ALA D . n D 1 249 ILE 249 247 247 ILE ILE D . n D 1 250 THR 250 248 248 THR THR D . n D 1 251 TRP 251 249 249 TRP TRP D . n D 1 252 MET 252 250 250 MET MET D . n D 1 253 VAL 253 251 251 VAL VAL D . n D 1 254 ASN 254 252 252 ASN ASN D . n D 1 255 ASP 255 253 253 ASP ASP D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 HE4 1 301 301 HE4 HE4 A . F 2 HE4 1 301 301 HE4 HE4 B . G 2 HE4 1 301 301 HE4 HE4 C . H 2 HE4 1 301 301 HE4 HE4 D . I 3 HOH 1 401 2 HOH HOH A . I 3 HOH 2 402 11 HOH HOH A . I 3 HOH 3 403 7 HOH HOH A . I 3 HOH 4 404 1 HOH HOH A . I 3 HOH 5 405 4 HOH HOH A . J 3 HOH 1 401 15 HOH HOH B . J 3 HOH 2 402 3 HOH HOH B . K 3 HOH 1 401 9 HOH HOH C . K 3 HOH 2 402 13 HOH HOH C . K 3 HOH 3 403 6 HOH HOH C . K 3 HOH 4 404 12 HOH HOH C . L 3 HOH 1 401 10 HOH HOH D . L 3 HOH 2 402 8 HOH HOH D . L 3 HOH 3 403 16 HOH HOH D . L 3 HOH 4 404 14 HOH HOH D . L 3 HOH 5 405 17 HOH HOH D . L 3 HOH 6 406 5 HOH HOH D . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,D,E,H,I,L 2 1 B,C,F,G,J,K # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2990 ? 1 MORE -22 ? 1 'SSA (A^2)' 20120 ? 2 'ABSA (A^2)' 3150 ? 2 MORE -22 ? 2 'SSA (A^2)' 20100 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 404 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id I _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-09-16 2 'Structure model' 1 1 2020-10-21 3 'Structure model' 1 2 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model 6 3 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 8 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 9 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 10 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 11 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 12 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 13 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 14 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -35.5093 33.5248 -11.7112 0.2915 ? 0.1166 ? 0.0386 ? 0.3706 ? 0.0610 ? 0.4584 ? 0.5520 ? 0.4651 ? 0.4292 ? 0.4274 ? 0.1461 ? 1.3715 ? -0.0583 ? -0.0986 ? 0.0045 ? -0.0775 ? 0.0006 ? -0.1582 ? 0.1276 ? 0.1486 ? 0.0464 ? 2 'X-RAY DIFFRACTION' ? refined -44.5666 23.3170 -28.1503 0.8051 ? 0.0223 ? 0.2069 ? 0.3674 ? 0.1114 ? 0.5517 ? 0.5831 ? -0.4905 ? 0.6344 ? 1.9194 ? -2.7988 ? 4.0935 ? -0.0571 ? -0.2276 ? -0.4941 ? -0.0242 ? -0.0143 ? -0.0954 ? 0.6286 ? -0.1802 ? 0.0648 ? 3 'X-RAY DIFFRACTION' ? refined -26.9556 23.8965 -13.0050 0.5133 ? 0.2635 ? 0.0938 ? 0.4617 ? 0.1904 ? 0.4220 ? 0.6409 ? -0.2302 ? 0.2049 ? 0.8081 ? 0.3033 ? 1.1287 ? -0.0288 ? 0.0455 ? -0.0761 ? 0.1191 ? 0.0809 ? -0.0399 ? 0.6239 ? 0.4690 ? -0.0576 ? 4 'X-RAY DIFFRACTION' ? refined -36.6169 24.4213 -4.1004 0.3661 ? 0.0077 ? 0.0274 ? 0.3317 ? 0.0982 ? 0.2806 ? 0.8358 ? 0.3278 ? 0.4461 ? 0.8997 ? 0.2734 ? 2.1741 ? 0.1232 ? -0.1073 ? -0.0920 ? 0.2442 ? -0.0866 ? 0.1369 ? 0.5135 ? -0.0276 ? -0.0394 ? 5 'X-RAY DIFFRACTION' ? refined -27.0588 20.7696 3.8653 0.4276 ? 0.0719 ? 0.0258 ? 0.5488 ? 0.1506 ? 0.3355 ? 1.7376 ? -0.2551 ? 0.6805 ? 2.0470 ? 0.8569 ? 1.5716 ? 0.1367 ? -0.2055 ? 0.0614 ? 0.0786 ? -0.0008 ? -0.3239 ? 0.6407 ? 0.3344 ? -0.1222 ? 6 'X-RAY DIFFRACTION' ? refined -30.4212 24.0790 15.1443 0.5964 ? -0.0896 ? -0.0897 ? 0.5500 ? 0.0690 ? 0.3637 ? 3.0215 ? 2.8223 ? -3.1625 ? 6.5933 ? -3.5437 ? 3.3999 ? -0.1571 ? -0.5054 ? -0.1010 ? 0.6514 ? -0.0929 ? -0.3032 ? 0.0801 ? 0.1508 ? 0.2351 ? 7 'X-RAY DIFFRACTION' ? refined -29.2539 9.1892 4.2218 0.7041 ? 0.0736 ? -0.0049 ? 0.3750 ? 0.1180 ? 0.3897 ? 1.8922 ? -0.1350 ? -0.7343 ? 2.2620 ? 0.0388 ? 2.8931 ? -0.2822 ? -0.4864 ? -0.5375 ? 0.2411 ? -0.0532 ? -0.2626 ? 1.0824 ? 0.1938 ? 0.3286 ? 8 'X-RAY DIFFRACTION' ? refined -24.2734 11.4039 -8.7213 0.5067 ? 0.0781 ? -0.0092 ? 0.3683 ? 0.0718 ? 0.3896 ? 1.8544 ? 0.6434 ? -0.0526 ? 2.5106 ? -1.0004 ? 1.9875 ? 0.2895 ? -0.0297 ? -0.5726 ? 0.2214 ? -0.1771 ? -0.3154 ? 0.5919 ? 0.3890 ? -0.0878 ? 9 'X-RAY DIFFRACTION' ? refined -16.7660 48.5130 -15.0326 0.2017 ? 0.0029 ? -0.0046 ? 0.4784 ? 0.0430 ? 0.3664 ? 1.7649 ? 0.2513 ? -0.8090 ? 2.6081 ? 0.1600 ? 2.7609 ? 0.0042 ? 0.3021 ? -0.2464 ? -0.3023 ? -0.0990 ? -0.6058 ? -0.3098 ? 0.4585 ? 0.1003 ? 10 'X-RAY DIFFRACTION' ? refined -23.7618 51.5733 -4.1949 0.1879 ? -0.0453 ? -0.0193 ? 0.3591 ? 0.0449 ? 0.2771 ? 1.1229 ? -0.3386 ? 0.3529 ? 1.1050 ? -0.4096 ? 3.5584 ? 0.0280 ? -0.0575 ? -0.0809 ? 0.0473 ? -0.1060 ? -0.1483 ? -0.4500 ? 0.5755 ? 0.0421 ? 11 'X-RAY DIFFRACTION' ? refined -28.9827 53.4287 11.0280 0.2608 ? 0.0333 ? 0.0650 ? 0.3457 ? 0.0376 ? 0.2464 ? 0.8016 ? 0.1048 ? 1.2859 ? 2.6623 ? 0.6153 ? 2.1107 ? 0.0737 ? -0.1243 ? 0.0561 ? 0.1730 ? 0.1190 ? 0.1190 ? 0.1101 ? -0.2523 ? -0.1878 ? 12 'X-RAY DIFFRACTION' ? refined -31.9460 65.2553 1.4560 0.5519 ? 0.0774 ? 0.0290 ? 0.3674 ? -0.0309 ? 0.3787 ? 2.4388 ? 0.1430 ? 1.1614 ? 2.4824 ? 1.1564 ? 4.2635 ? -0.0537 ? -0.3603 ? 0.4383 ? 0.2391 ? -0.1177 ? 0.1507 ? -0.9164 ? -0.4961 ? 0.1843 ? 13 'X-RAY DIFFRACTION' ? refined -13.6378 43.0879 -17.1989 0.2249 ? 0.0606 ? -0.0120 ? 0.7009 ? -0.0526 ? 0.4555 ? 1.6675 ? 0.7023 ? -0.4407 ? 0.7021 ? 0.0756 ? 1.1777 ? 0.1353 ? -0.5211 ? -0.0450 ? 0.2600 ? 0.0070 ? -0.0119 ? -0.0841 ? 0.5732 ? -0.1044 ? 14 'X-RAY DIFFRACTION' ? refined -12.1890 35.9850 -29.1858 0.0471 ? 0.2851 ? 0.0646 ? 0.9816 ? 0.0500 ? 0.3736 ? 0.5226 ? -0.0957 ? 0.0350 ? 0.1181 ? 0.1090 ? 0.5575 ? 0.0493 ? -0.1501 ? 0.0036 ? -0.0121 ? 0.2094 ? -0.1068 ? -0.0791 ? 0.7368 ? -0.1633 ? 15 'X-RAY DIFFRACTION' ? refined -13.8637 31.8343 -47.6272 0.3487 ? 0.1659 ? 0.0363 ? 0.9529 ? 0.0268 ? 0.3934 ? 6.9571 ? -2.3312 ? 1.3146 ? 1.5285 ? -0.0878 ? 0.4198 ? 0.0860 ? 0.1241 ? -0.5622 ? -0.1225 ? -0.2054 ? 0.1818 ? 0.2716 ? 1.2468 ? 0.1338 ? 16 'X-RAY DIFFRACTION' ? refined -5.4785 22.4216 -34.1816 0.4357 ? 0.3198 ? 0.0031 ? 0.8855 ? -0.0087 ? 0.3801 ? 1.7592 ? 0.1348 ? -1.0298 ? 0.8655 ? -0.0728 ? 1.4464 ? -0.1008 ? -0.1189 ? -0.2566 ? 0.1636 ? 0.1423 ? -0.1345 ? 0.0775 ? 0.0391 ? -0.0649 ? 17 'X-RAY DIFFRACTION' ? refined -41.3163 40.9300 -26.8270 0.2360 ? 0.1221 ? -0.0071 ? 0.4596 ? 0.0560 ? 0.4050 ? 0.1335 ? 0.1633 ? 0.0851 ? 0.4457 ? -0.2263 ? 0.8253 ? -0.0297 ? 0.0413 ? -0.0173 ? 0.0867 ? 0.0027 ? -0.0784 ? 0.0348 ? 0.0115 ? 0.0190 ? 18 'X-RAY DIFFRACTION' ? refined -40.0684 50.1260 -44.4771 0.3650 ? 0.1381 ? 0.0702 ? 0.3765 ? 0.0993 ? 0.3652 ? 2.7082 ? -0.4757 ? 1.0945 ? 1.2967 ? 0.3009 ? 1.6709 ? -0.0651 ? 0.1752 ? 0.2565 ? -0.1576 ? -0.0978 ? -0.0156 ? -0.3685 ? -0.2702 ? 0.1502 ? 19 'X-RAY DIFFRACTION' ? refined -48.6283 57.9522 -33.8507 0.4705 ? 0.1982 ? -0.0467 ? 0.5118 ? 0.0861 ? 0.4557 ? 1.6502 ? 0.0995 ? 1.0748 ? 0.6967 ? 0.2090 ? 1.7082 ? -0.1340 ? 0.1665 ? 0.2370 ? -0.1575 ? 0.0974 ? 0.2307 ? -0.4678 ? -0.3362 ? 0.0583 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A -1 ? ? A 24 ? ;chain 'A' and (resid -1 through 24 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 25 ? ? A 39 ? ;chain 'A' and (resid 25 through 39 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 40 ? ? A 68 ? ;chain 'A' and (resid 40 through 68 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 69 ? ? A 133 ? ;chain 'A' and (resid 69 through 133 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 134 ? ? A 162 ? ;chain 'A' and (resid 134 through 162 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 163 ? ? A 179 ? ;chain 'A' and (resid 163 through 179 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? A 180 ? ? A 221 ? ;chain 'A' and (resid 180 through 221 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? A 222 ? ? A 253 ? ;chain 'A' and (resid 222 through 253 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? B -1 ? ? B 40 ? ;chain 'B' and (resid -1 through 40 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? B 41 ? ? B 133 ? ;chain 'B' and (resid 41 through 133 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? B 134 ? ? B 189 ? ;chain 'B' and (resid 134 through 189 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? B 190 ? ? B 253 ? ;chain 'B' and (resid 190 through 253 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? C -1 ? ? C 40 ? ;chain 'C' and (resid -1 through 40 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? C 41 ? ? C 146 ? ;chain 'C' and (resid 41 through 146 ) ; 15 'X-RAY DIFFRACTION' 15 ? ? C 147 ? ? C 189 ? ;chain 'C' and (resid 147 through 189 ) ; 16 'X-RAY DIFFRACTION' 16 ? ? C 190 ? ? C 253 ? ;chain 'C' and (resid 190 through 253 ) ; 17 'X-RAY DIFFRACTION' 17 ? ? D -1 ? ? D 133 ? ;chain 'D' and (resid -1 through 133 ) ; 18 'X-RAY DIFFRACTION' 18 ? ? D 134 ? ? D 189 ? ;chain 'D' and (resid 134 through 189 ) ; 19 'X-RAY DIFFRACTION' 19 ? ? D 190 ? ? D 253 ? ;chain 'D' and (resid 190 through 253 ) ; # _pdbx_phasing_MR.entry_id 6WCX _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 7.280 _pdbx_phasing_MR.d_res_low_rotation 49.190 _pdbx_phasing_MR.d_res_high_translation 7.280 _pdbx_phasing_MR.d_res_low_translation 49.190 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18rc1-3769 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 5 # _pdbx_entry_details.entry_id 6WCX _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OG D SER 121 ? ? OAB D HE4 301 ? ? 2.08 2 1 OG C SER 121 ? ? OAB C HE4 301 ? ? 2.12 3 1 OG A SER 121 ? ? OAB A HE4 301 ? ? 2.12 4 1 OG D SER 121 ? ? CAF D HE4 301 ? ? 2.17 5 1 OG B SER 121 ? ? OAB B HE4 301 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 49 ? ? 81.73 -6.15 2 1 ASP A 51 ? ? -153.80 -157.06 3 1 SER A 60 ? ? -117.63 57.87 4 1 ASP A 78 ? ? 62.97 -129.67 5 1 SER A 121 ? ? 55.63 -106.67 6 1 ASP A 229 ? ? -119.82 -158.60 7 1 SER B 49 ? ? 81.72 -14.27 8 1 ASP B 51 ? ? -153.80 -159.81 9 1 SER B 60 ? ? -117.86 60.93 10 1 ASP B 78 ? ? 64.04 -128.26 11 1 SER B 121 ? ? 54.86 -106.79 12 1 ASP B 229 ? ? -117.49 -156.19 13 1 SER C 49 ? ? 78.86 -5.17 14 1 ASP C 51 ? ? -152.24 -158.78 15 1 SER C 60 ? ? -113.96 50.28 16 1 ASP C 78 ? ? 63.96 -131.39 17 1 SER C 121 ? ? 53.51 -110.57 18 1 ASP C 229 ? ? -110.18 -153.41 19 1 ASP C 233 ? ? -123.09 -166.67 20 1 SER D 49 ? ? 77.95 -6.37 21 1 ASP D 51 ? ? -150.77 -157.50 22 1 SER D 60 ? ? -113.68 54.51 23 1 ASP D 78 ? ? 63.19 -133.43 24 1 SER D 121 ? ? 53.45 -110.53 25 1 ASP D 229 ? ? -111.46 -153.94 26 1 ASP D 233 ? ? -122.38 -166.30 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 27 ? CG ? A GLN 29 CG 2 1 Y 1 A GLN 27 ? CD ? A GLN 29 CD 3 1 Y 1 A GLN 27 ? OE1 ? A GLN 29 OE1 4 1 Y 1 A GLN 27 ? NE2 ? A GLN 29 NE2 5 1 Y 1 A LYS 37 ? CG ? A LYS 39 CG 6 1 Y 1 A LYS 37 ? CD ? A LYS 39 CD 7 1 Y 1 A LYS 37 ? CE ? A LYS 39 CE 8 1 Y 1 A LYS 37 ? NZ ? A LYS 39 NZ 9 1 Y 1 A ASN 169 ? CG ? A ASN 171 CG 10 1 Y 1 A ASN 169 ? OD1 ? A ASN 171 OD1 11 1 Y 1 A ASN 169 ? ND2 ? A ASN 171 ND2 12 1 Y 1 A LYS 192 ? CG ? A LYS 194 CG 13 1 Y 1 A LYS 192 ? CD ? A LYS 194 CD 14 1 Y 1 A LYS 192 ? CE ? A LYS 194 CE 15 1 Y 1 A LYS 192 ? NZ ? A LYS 194 NZ 16 1 Y 1 A ASP 216 ? CG ? A ASP 218 CG 17 1 Y 1 A ASP 216 ? OD1 ? A ASP 218 OD1 18 1 Y 1 A ASP 216 ? OD2 ? A ASP 218 OD2 19 1 Y 1 A GLU 228 ? CG ? A GLU 230 CG 20 1 Y 1 A GLU 228 ? CD ? A GLU 230 CD 21 1 Y 1 A GLU 228 ? OE1 ? A GLU 230 OE1 22 1 Y 1 A GLU 228 ? OE2 ? A GLU 230 OE2 23 1 Y 1 A ASP 253 ? CG ? A ASP 255 CG 24 1 Y 1 A ASP 253 ? OD1 ? A ASP 255 OD1 25 1 Y 1 A ASP 253 ? OD2 ? A ASP 255 OD2 26 1 Y 1 B ASN 169 ? CG ? B ASN 171 CG 27 1 Y 1 B ASN 169 ? OD1 ? B ASN 171 OD1 28 1 Y 1 B ASN 169 ? ND2 ? B ASN 171 ND2 29 1 Y 1 B GLN 241 ? CG ? B GLN 243 CG 30 1 Y 1 B GLN 241 ? CD ? B GLN 243 CD 31 1 Y 1 B GLN 241 ? OE1 ? B GLN 243 OE1 32 1 Y 1 B GLN 241 ? NE2 ? B GLN 243 NE2 33 1 Y 1 B ASN 252 ? CG ? B ASN 254 CG 34 1 Y 1 B ASN 252 ? OD1 ? B ASN 254 OD1 35 1 Y 1 B ASN 252 ? ND2 ? B ASN 254 ND2 36 1 Y 1 B ASP 253 ? CG ? B ASP 255 CG 37 1 Y 1 B ASP 253 ? OD1 ? B ASP 255 OD1 38 1 Y 1 B ASP 253 ? OD2 ? B ASP 255 OD2 39 1 Y 1 C LYS 111 ? CG ? C LYS 113 CG 40 1 Y 1 C LYS 111 ? CD ? C LYS 113 CD 41 1 Y 1 C LYS 111 ? CE ? C LYS 113 CE 42 1 Y 1 C LYS 111 ? NZ ? C LYS 113 NZ 43 1 Y 1 C GLU 157 ? CG ? C GLU 159 CG 44 1 Y 1 C GLU 157 ? CD ? C GLU 159 CD 45 1 Y 1 C GLU 157 ? OE1 ? C GLU 159 OE1 46 1 Y 1 C GLU 157 ? OE2 ? C GLU 159 OE2 47 1 Y 1 C GLU 177 ? CG ? C GLU 179 CG 48 1 Y 1 C GLU 177 ? CD ? C GLU 179 CD 49 1 Y 1 C GLU 177 ? OE1 ? C GLU 179 OE1 50 1 Y 1 C GLU 177 ? OE2 ? C GLU 179 OE2 51 1 Y 1 C ASP 191 ? CG ? C ASP 193 CG 52 1 Y 1 C ASP 191 ? OD1 ? C ASP 193 OD1 53 1 Y 1 C ASP 191 ? OD2 ? C ASP 193 OD2 54 1 Y 1 C LYS 203 ? CG ? C LYS 205 CG 55 1 Y 1 C LYS 203 ? CD ? C LYS 205 CD 56 1 Y 1 C LYS 203 ? CE ? C LYS 205 CE 57 1 Y 1 C LYS 203 ? NZ ? C LYS 205 NZ 58 1 Y 1 C GLU 228 ? CG ? C GLU 230 CG 59 1 Y 1 C GLU 228 ? CD ? C GLU 230 CD 60 1 Y 1 C GLU 228 ? OE1 ? C GLU 230 OE1 61 1 Y 1 C GLU 228 ? OE2 ? C GLU 230 OE2 62 1 Y 1 D LYS 37 ? CG ? D LYS 39 CG 63 1 Y 1 D LYS 37 ? CD ? D LYS 39 CD 64 1 Y 1 D LYS 37 ? CE ? D LYS 39 CE 65 1 Y 1 D LYS 37 ? NZ ? D LYS 39 NZ 66 1 Y 1 D LYS 174 ? CG ? D LYS 176 CG 67 1 Y 1 D LYS 174 ? CD ? D LYS 176 CD 68 1 Y 1 D LYS 174 ? CE ? D LYS 176 CE 69 1 Y 1 D LYS 174 ? NZ ? D LYS 176 NZ 70 1 Y 1 D GLU 177 ? CG ? D GLU 179 CG 71 1 Y 1 D GLU 177 ? CD ? D GLU 179 CD 72 1 Y 1 D GLU 177 ? OE1 ? D GLU 179 OE1 73 1 Y 1 D GLU 177 ? OE2 ? D GLU 179 OE2 74 1 Y 1 D LYS 186 ? CG ? D LYS 188 CG 75 1 Y 1 D LYS 186 ? CD ? D LYS 188 CD 76 1 Y 1 D LYS 186 ? CE ? D LYS 188 CE 77 1 Y 1 D LYS 186 ? NZ ? D LYS 188 NZ 78 1 Y 1 D ASP 233 ? CG ? D ASP 235 CG 79 1 Y 1 D ASP 233 ? OD1 ? D ASP 235 OD1 80 1 Y 1 D ASP 233 ? OD2 ? D ASP 235 OD2 81 1 Y 1 D GLN 241 ? CG ? D GLN 243 CG 82 1 Y 1 D GLN 241 ? CD ? D GLN 243 CD 83 1 Y 1 D GLN 241 ? OE1 ? D GLN 243 OE1 84 1 Y 1 D GLN 241 ? NE2 ? D GLN 243 NE2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HE4 CAA C N N 137 HE4 CAC C N N 138 HE4 CAE C N N 139 HE4 CAG C N N 140 HE4 CAH C N N 141 HE4 CAF C N N 142 HE4 CAD C N N 143 HE4 OAB O N N 144 HE4 HAA1 H N N 145 HE4 HAA2 H N N 146 HE4 HAA3 H N N 147 HE4 HAC1 H N N 148 HE4 HAC2 H N N 149 HE4 HAE1 H N N 150 HE4 HAE2 H N N 151 HE4 HAG1 H N N 152 HE4 HAG2 H N N 153 HE4 HAH1 H N N 154 HE4 HAH2 H N N 155 HE4 HAF1 H N N 156 HE4 HAF2 H N N 157 HE4 HAD1 H N N 158 HE4 HAD2 H N N 159 HE4 HAB H N N 160 HIS N N N N 161 HIS CA C N S 162 HIS C C N N 163 HIS O O N N 164 HIS CB C N N 165 HIS CG C Y N 166 HIS ND1 N Y N 167 HIS CD2 C Y N 168 HIS CE1 C Y N 169 HIS NE2 N Y N 170 HIS OXT O N N 171 HIS H H N N 172 HIS H2 H N N 173 HIS HA H N N 174 HIS HB2 H N N 175 HIS HB3 H N N 176 HIS HD1 H N N 177 HIS HD2 H N N 178 HIS HE1 H N N 179 HIS HE2 H N N 180 HIS HXT H N N 181 HOH O O N N 182 HOH H1 H N N 183 HOH H2 H N N 184 ILE N N N N 185 ILE CA C N S 186 ILE C C N N 187 ILE O O N N 188 ILE CB C N S 189 ILE CG1 C N N 190 ILE CG2 C N N 191 ILE CD1 C N N 192 ILE OXT O N N 193 ILE H H N N 194 ILE H2 H N N 195 ILE HA H N N 196 ILE HB H N N 197 ILE HG12 H N N 198 ILE HG13 H N N 199 ILE HG21 H N N 200 ILE HG22 H N N 201 ILE HG23 H N N 202 ILE HD11 H N N 203 ILE HD12 H N N 204 ILE HD13 H N N 205 ILE HXT H N N 206 LEU N N N N 207 LEU CA C N S 208 LEU C C N N 209 LEU O O N N 210 LEU CB C N N 211 LEU CG C N N 212 LEU CD1 C N N 213 LEU CD2 C N N 214 LEU OXT O N N 215 LEU H H N N 216 LEU H2 H N N 217 LEU HA H N N 218 LEU HB2 H N N 219 LEU HB3 H N N 220 LEU HG H N N 221 LEU HD11 H N N 222 LEU HD12 H N N 223 LEU HD13 H N N 224 LEU HD21 H N N 225 LEU HD22 H N N 226 LEU HD23 H N N 227 LEU HXT H N N 228 LYS N N N N 229 LYS CA C N S 230 LYS C C N N 231 LYS O O N N 232 LYS CB C N N 233 LYS CG C N N 234 LYS CD C N N 235 LYS CE C N N 236 LYS NZ N N N 237 LYS OXT O N N 238 LYS H H N N 239 LYS H2 H N N 240 LYS HA H N N 241 LYS HB2 H N N 242 LYS HB3 H N N 243 LYS HG2 H N N 244 LYS HG3 H N N 245 LYS HD2 H N N 246 LYS HD3 H N N 247 LYS HE2 H N N 248 LYS HE3 H N N 249 LYS HZ1 H N N 250 LYS HZ2 H N N 251 LYS HZ3 H N N 252 LYS HXT H N N 253 MET N N N N 254 MET CA C N S 255 MET C C N N 256 MET O O N N 257 MET CB C N N 258 MET CG C N N 259 MET SD S N N 260 MET CE C N N 261 MET OXT O N N 262 MET H H N N 263 MET H2 H N N 264 MET HA H N N 265 MET HB2 H N N 266 MET HB3 H N N 267 MET HG2 H N N 268 MET HG3 H N N 269 MET HE1 H N N 270 MET HE2 H N N 271 MET HE3 H N N 272 MET HXT H N N 273 PHE N N N N 274 PHE CA C N S 275 PHE C C N N 276 PHE O O N N 277 PHE CB C N N 278 PHE CG C Y N 279 PHE CD1 C Y N 280 PHE CD2 C Y N 281 PHE CE1 C Y N 282 PHE CE2 C Y N 283 PHE CZ C Y N 284 PHE OXT O N N 285 PHE H H N N 286 PHE H2 H N N 287 PHE HA H N N 288 PHE HB2 H N N 289 PHE HB3 H N N 290 PHE HD1 H N N 291 PHE HD2 H N N 292 PHE HE1 H N N 293 PHE HE2 H N N 294 PHE HZ H N N 295 PHE HXT H N N 296 PRO N N N N 297 PRO CA C N S 298 PRO C C N N 299 PRO O O N N 300 PRO CB C N N 301 PRO CG C N N 302 PRO CD C N N 303 PRO OXT O N N 304 PRO H H N N 305 PRO HA H N N 306 PRO HB2 H N N 307 PRO HB3 H N N 308 PRO HG2 H N N 309 PRO HG3 H N N 310 PRO HD2 H N N 311 PRO HD3 H N N 312 PRO HXT H N N 313 SER N N N N 314 SER CA C N S 315 SER C C N N 316 SER O O N N 317 SER CB C N N 318 SER OG O N N 319 SER OXT O N N 320 SER H H N N 321 SER H2 H N N 322 SER HA H N N 323 SER HB2 H N N 324 SER HB3 H N N 325 SER HG H N N 326 SER HXT H N N 327 THR N N N N 328 THR CA C N S 329 THR C C N N 330 THR O O N N 331 THR CB C N R 332 THR OG1 O N N 333 THR CG2 C N N 334 THR OXT O N N 335 THR H H N N 336 THR H2 H N N 337 THR HA H N N 338 THR HB H N N 339 THR HG1 H N N 340 THR HG21 H N N 341 THR HG22 H N N 342 THR HG23 H N N 343 THR HXT H N N 344 TRP N N N N 345 TRP CA C N S 346 TRP C C N N 347 TRP O O N N 348 TRP CB C N N 349 TRP CG C Y N 350 TRP CD1 C Y N 351 TRP CD2 C Y N 352 TRP NE1 N Y N 353 TRP CE2 C Y N 354 TRP CE3 C Y N 355 TRP CZ2 C Y N 356 TRP CZ3 C Y N 357 TRP CH2 C Y N 358 TRP OXT O N N 359 TRP H H N N 360 TRP H2 H N N 361 TRP HA H N N 362 TRP HB2 H N N 363 TRP HB3 H N N 364 TRP HD1 H N N 365 TRP HE1 H N N 366 TRP HE3 H N N 367 TRP HZ2 H N N 368 TRP HZ3 H N N 369 TRP HH2 H N N 370 TRP HXT H N N 371 TYR N N N N 372 TYR CA C N S 373 TYR C C N N 374 TYR O O N N 375 TYR CB C N N 376 TYR CG C Y N 377 TYR CD1 C Y N 378 TYR CD2 C Y N 379 TYR CE1 C Y N 380 TYR CE2 C Y N 381 TYR CZ C Y N 382 TYR OH O N N 383 TYR OXT O N N 384 TYR H H N N 385 TYR H2 H N N 386 TYR HA H N N 387 TYR HB2 H N N 388 TYR HB3 H N N 389 TYR HD1 H N N 390 TYR HD2 H N N 391 TYR HE1 H N N 392 TYR HE2 H N N 393 TYR HH H N N 394 TYR HXT H N N 395 VAL N N N N 396 VAL CA C N S 397 VAL C C N N 398 VAL O O N N 399 VAL CB C N N 400 VAL CG1 C N N 401 VAL CG2 C N N 402 VAL OXT O N N 403 VAL H H N N 404 VAL H2 H N N 405 VAL HA H N N 406 VAL HB H N N 407 VAL HG11 H N N 408 VAL HG12 H N N 409 VAL HG13 H N N 410 VAL HG21 H N N 411 VAL HG22 H N N 412 VAL HG23 H N N 413 VAL HXT H N N 414 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HE4 CAA CAC sing N N 129 HE4 CAA HAA1 sing N N 130 HE4 CAA HAA2 sing N N 131 HE4 CAA HAA3 sing N N 132 HE4 CAC CAE sing N N 133 HE4 CAC HAC1 sing N N 134 HE4 CAC HAC2 sing N N 135 HE4 CAE CAG sing N N 136 HE4 CAE HAE1 sing N N 137 HE4 CAE HAE2 sing N N 138 HE4 CAG CAH sing N N 139 HE4 CAG HAG1 sing N N 140 HE4 CAG HAG2 sing N N 141 HE4 CAH CAF sing N N 142 HE4 CAH HAH1 sing N N 143 HE4 CAH HAH2 sing N N 144 HE4 CAF CAD sing N N 145 HE4 CAF HAF1 sing N N 146 HE4 CAF HAF2 sing N N 147 HE4 CAD OAB sing N N 148 HE4 CAD HAD1 sing N N 149 HE4 CAD HAD2 sing N N 150 HE4 OAB HAB sing N N 151 HIS N CA sing N N 152 HIS N H sing N N 153 HIS N H2 sing N N 154 HIS CA C sing N N 155 HIS CA CB sing N N 156 HIS CA HA sing N N 157 HIS C O doub N N 158 HIS C OXT sing N N 159 HIS CB CG sing N N 160 HIS CB HB2 sing N N 161 HIS CB HB3 sing N N 162 HIS CG ND1 sing Y N 163 HIS CG CD2 doub Y N 164 HIS ND1 CE1 doub Y N 165 HIS ND1 HD1 sing N N 166 HIS CD2 NE2 sing Y N 167 HIS CD2 HD2 sing N N 168 HIS CE1 NE2 sing Y N 169 HIS CE1 HE1 sing N N 170 HIS NE2 HE2 sing N N 171 HIS OXT HXT sing N N 172 HOH O H1 sing N N 173 HOH O H2 sing N N 174 ILE N CA sing N N 175 ILE N H sing N N 176 ILE N H2 sing N N 177 ILE CA C sing N N 178 ILE CA CB sing N N 179 ILE CA HA sing N N 180 ILE C O doub N N 181 ILE C OXT sing N N 182 ILE CB CG1 sing N N 183 ILE CB CG2 sing N N 184 ILE CB HB sing N N 185 ILE CG1 CD1 sing N N 186 ILE CG1 HG12 sing N N 187 ILE CG1 HG13 sing N N 188 ILE CG2 HG21 sing N N 189 ILE CG2 HG22 sing N N 190 ILE CG2 HG23 sing N N 191 ILE CD1 HD11 sing N N 192 ILE CD1 HD12 sing N N 193 ILE CD1 HD13 sing N N 194 ILE OXT HXT sing N N 195 LEU N CA sing N N 196 LEU N H sing N N 197 LEU N H2 sing N N 198 LEU CA C sing N N 199 LEU CA CB sing N N 200 LEU CA HA sing N N 201 LEU C O doub N N 202 LEU C OXT sing N N 203 LEU CB CG sing N N 204 LEU CB HB2 sing N N 205 LEU CB HB3 sing N N 206 LEU CG CD1 sing N N 207 LEU CG CD2 sing N N 208 LEU CG HG sing N N 209 LEU CD1 HD11 sing N N 210 LEU CD1 HD12 sing N N 211 LEU CD1 HD13 sing N N 212 LEU CD2 HD21 sing N N 213 LEU CD2 HD22 sing N N 214 LEU CD2 HD23 sing N N 215 LEU OXT HXT sing N N 216 LYS N CA sing N N 217 LYS N H sing N N 218 LYS N H2 sing N N 219 LYS CA C sing N N 220 LYS CA CB sing N N 221 LYS CA HA sing N N 222 LYS C O doub N N 223 LYS C OXT sing N N 224 LYS CB CG sing N N 225 LYS CB HB2 sing N N 226 LYS CB HB3 sing N N 227 LYS CG CD sing N N 228 LYS CG HG2 sing N N 229 LYS CG HG3 sing N N 230 LYS CD CE sing N N 231 LYS CD HD2 sing N N 232 LYS CD HD3 sing N N 233 LYS CE NZ sing N N 234 LYS CE HE2 sing N N 235 LYS CE HE3 sing N N 236 LYS NZ HZ1 sing N N 237 LYS NZ HZ2 sing N N 238 LYS NZ HZ3 sing N N 239 LYS OXT HXT sing N N 240 MET N CA sing N N 241 MET N H sing N N 242 MET N H2 sing N N 243 MET CA C sing N N 244 MET CA CB sing N N 245 MET CA HA sing N N 246 MET C O doub N N 247 MET C OXT sing N N 248 MET CB CG sing N N 249 MET CB HB2 sing N N 250 MET CB HB3 sing N N 251 MET CG SD sing N N 252 MET CG HG2 sing N N 253 MET CG HG3 sing N N 254 MET SD CE sing N N 255 MET CE HE1 sing N N 256 MET CE HE2 sing N N 257 MET CE HE3 sing N N 258 MET OXT HXT sing N N 259 PHE N CA sing N N 260 PHE N H sing N N 261 PHE N H2 sing N N 262 PHE CA C sing N N 263 PHE CA CB sing N N 264 PHE CA HA sing N N 265 PHE C O doub N N 266 PHE C OXT sing N N 267 PHE CB CG sing N N 268 PHE CB HB2 sing N N 269 PHE CB HB3 sing N N 270 PHE CG CD1 doub Y N 271 PHE CG CD2 sing Y N 272 PHE CD1 CE1 sing Y N 273 PHE CD1 HD1 sing N N 274 PHE CD2 CE2 doub Y N 275 PHE CD2 HD2 sing N N 276 PHE CE1 CZ doub Y N 277 PHE CE1 HE1 sing N N 278 PHE CE2 CZ sing Y N 279 PHE CE2 HE2 sing N N 280 PHE CZ HZ sing N N 281 PHE OXT HXT sing N N 282 PRO N CA sing N N 283 PRO N CD sing N N 284 PRO N H sing N N 285 PRO CA C sing N N 286 PRO CA CB sing N N 287 PRO CA HA sing N N 288 PRO C O doub N N 289 PRO C OXT sing N N 290 PRO CB CG sing N N 291 PRO CB HB2 sing N N 292 PRO CB HB3 sing N N 293 PRO CG CD sing N N 294 PRO CG HG2 sing N N 295 PRO CG HG3 sing N N 296 PRO CD HD2 sing N N 297 PRO CD HD3 sing N N 298 PRO OXT HXT sing N N 299 SER N CA sing N N 300 SER N H sing N N 301 SER N H2 sing N N 302 SER CA C sing N N 303 SER CA CB sing N N 304 SER CA HA sing N N 305 SER C O doub N N 306 SER C OXT sing N N 307 SER CB OG sing N N 308 SER CB HB2 sing N N 309 SER CB HB3 sing N N 310 SER OG HG sing N N 311 SER OXT HXT sing N N 312 THR N CA sing N N 313 THR N H sing N N 314 THR N H2 sing N N 315 THR CA C sing N N 316 THR CA CB sing N N 317 THR CA HA sing N N 318 THR C O doub N N 319 THR C OXT sing N N 320 THR CB OG1 sing N N 321 THR CB CG2 sing N N 322 THR CB HB sing N N 323 THR OG1 HG1 sing N N 324 THR CG2 HG21 sing N N 325 THR CG2 HG22 sing N N 326 THR CG2 HG23 sing N N 327 THR OXT HXT sing N N 328 TRP N CA sing N N 329 TRP N H sing N N 330 TRP N H2 sing N N 331 TRP CA C sing N N 332 TRP CA CB sing N N 333 TRP CA HA sing N N 334 TRP C O doub N N 335 TRP C OXT sing N N 336 TRP CB CG sing N N 337 TRP CB HB2 sing N N 338 TRP CB HB3 sing N N 339 TRP CG CD1 doub Y N 340 TRP CG CD2 sing Y N 341 TRP CD1 NE1 sing Y N 342 TRP CD1 HD1 sing N N 343 TRP CD2 CE2 doub Y N 344 TRP CD2 CE3 sing Y N 345 TRP NE1 CE2 sing Y N 346 TRP NE1 HE1 sing N N 347 TRP CE2 CZ2 sing Y N 348 TRP CE3 CZ3 doub Y N 349 TRP CE3 HE3 sing N N 350 TRP CZ2 CH2 doub Y N 351 TRP CZ2 HZ2 sing N N 352 TRP CZ3 CH2 sing Y N 353 TRP CZ3 HZ3 sing N N 354 TRP CH2 HH2 sing N N 355 TRP OXT HXT sing N N 356 TYR N CA sing N N 357 TYR N H sing N N 358 TYR N H2 sing N N 359 TYR CA C sing N N 360 TYR CA CB sing N N 361 TYR CA HA sing N N 362 TYR C O doub N N 363 TYR C OXT sing N N 364 TYR CB CG sing N N 365 TYR CB HB2 sing N N 366 TYR CB HB3 sing N N 367 TYR CG CD1 doub Y N 368 TYR CG CD2 sing Y N 369 TYR CD1 CE1 sing Y N 370 TYR CD1 HD1 sing N N 371 TYR CD2 CE2 doub Y N 372 TYR CD2 HD2 sing N N 373 TYR CE1 CZ doub Y N 374 TYR CE1 HE1 sing N N 375 TYR CE2 CZ sing Y N 376 TYR CE2 HE2 sing N N 377 TYR CZ OH sing N N 378 TYR OH HH sing N N 379 TYR OXT HXT sing N N 380 VAL N CA sing N N 381 VAL N H sing N N 382 VAL N H2 sing N N 383 VAL CA C sing N N 384 VAL CA CB sing N N 385 VAL CA HA sing N N 386 VAL C O doub N N 387 VAL C OXT sing N N 388 VAL CB CG1 sing N N 389 VAL CB CG2 sing N N 390 VAL CB HB sing N N 391 VAL CG1 HG11 sing N N 392 VAL CG1 HG12 sing N N 393 VAL CG1 HG13 sing N N 394 VAL CG2 HG21 sing N N 395 VAL CG2 HG22 sing N N 396 VAL CG2 HG23 sing N N 397 VAL OXT HXT sing N N 398 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id HE4 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id HE4 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 HEPTAN-1-OL HE4 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6VH9 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #