data_6WNM # _entry.id 6WNM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.348 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6WNM pdb_00006wnm 10.2210/pdb6wnm/pdb WWPDB D_1000248255 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6WNM _pdbx_database_status.recvd_initial_deposition_date 2020-04-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Michie, K.A.' 1 0000-0002-2133-2237 'Norrian, P.' 2 0000-0002-4215-1080 'Duggin, I.G.' 3 0000-0003-4868-7350 'McDougald, D.' 4 0000-0001-5827-8441 'Rice, S.A.' 5 0000-0002-9486-2343 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Viruses _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1999-4915 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;The Repressor C Protein, Pf4r, Controls Superinfection of Pseudomonas aeruginosa PAO1 by the Pf4 Filamentous Phage and Regulates Host Gene Expression. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/v13081614 _citation.pdbx_database_id_PubMed 34452479 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ismail, M.H.' 1 0000-0002-2890-0444 primary 'Michie, K.A.' 2 0000-0002-2133-2237 primary 'Goh, Y.F.' 3 ? primary 'Noorian, P.' 4 ? primary 'Kjelleberg, S.' 5 ? primary 'Duggin, I.G.' 6 0000-0003-4868-7350 primary 'McDougald, D.' 7 ? primary 'Rice, S.A.' 8 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6WNM _cell.details ? _cell.formula_units_Z ? _cell.length_a 38.109 _cell.length_a_esd ? _cell.length_b 47.477 _cell.length_b_esd ? _cell.length_c 169.332 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6WNM _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Pf4r 10496.806 2 ? ? ? ? 2 non-polymer nat '[(2R)-3-{[2-(carboxymethoxy)benzene-1-carbonyl]amino}-2-methoxypropyl](hydroxy)mercury' 483.867 1 ? ? ? ? 3 water nat water 18.015 6 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSTPADRARLLIKKIGPKKVSLHGGDYERWKSVSKGAIRVSTEEIDVLVKIFPNYALWIASGSIAPEVGQTSPDYDEANL NLSNQNAGAHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSTPADRARLLIKKIGPKKVSLHGGDYERWKSVSKGAIRVSTEEIDVLVKIFPNYALWIASGSIAPEVGQTSPDYDEANL NLSNQNAGAHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 THR n 1 4 PRO n 1 5 ALA n 1 6 ASP n 1 7 ARG n 1 8 ALA n 1 9 ARG n 1 10 LEU n 1 11 LEU n 1 12 ILE n 1 13 LYS n 1 14 LYS n 1 15 ILE n 1 16 GLY n 1 17 PRO n 1 18 LYS n 1 19 LYS n 1 20 VAL n 1 21 SER n 1 22 LEU n 1 23 HIS n 1 24 GLY n 1 25 GLY n 1 26 ASP n 1 27 TYR n 1 28 GLU n 1 29 ARG n 1 30 TRP n 1 31 LYS n 1 32 SER n 1 33 VAL n 1 34 SER n 1 35 LYS n 1 36 GLY n 1 37 ALA n 1 38 ILE n 1 39 ARG n 1 40 VAL n 1 41 SER n 1 42 THR n 1 43 GLU n 1 44 GLU n 1 45 ILE n 1 46 ASP n 1 47 VAL n 1 48 LEU n 1 49 VAL n 1 50 LYS n 1 51 ILE n 1 52 PHE n 1 53 PRO n 1 54 ASN n 1 55 TYR n 1 56 ALA n 1 57 LEU n 1 58 TRP n 1 59 ILE n 1 60 ALA n 1 61 SER n 1 62 GLY n 1 63 SER n 1 64 ILE n 1 65 ALA n 1 66 PRO n 1 67 GLU n 1 68 VAL n 1 69 GLY n 1 70 GLN n 1 71 THR n 1 72 SER n 1 73 PRO n 1 74 ASP n 1 75 TYR n 1 76 ASP n 1 77 GLU n 1 78 ALA n 1 79 ASN n 1 80 LEU n 1 81 ASN n 1 82 LEU n 1 83 SER n 1 84 ASN n 1 85 GLN n 1 86 ASN n 1 87 ALA n 1 88 GLY n 1 89 ALA n 1 90 HIS n 1 91 HIS n 1 92 HIS n 1 93 HIS n 1 94 HIS n 1 95 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 95 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa PAO1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 208964 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant 'Rosetta T1R' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pNC28-Bsa4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6WNM _struct_ref.pdbx_db_accession 6WNM _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6WNM A 1 ? 95 ? 6WNM 1 ? 95 ? 1 95 2 1 6WNM B 1 ? 95 ? 6WNM 1 ? 95 ? 1 95 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U5J non-polymer . '[(2R)-3-{[2-(carboxymethoxy)benzene-1-carbonyl]amino}-2-methoxypropyl](hydroxy)mercury' ? 'C13 H17 Hg N O6' 483.867 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6WNM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.82 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 32.57 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '50 mg/ml protein, 37% PEG 3350, 50 mM Tris, 5% glycerol, 50 mM KCl. Crystals soaked with 1 mM mersalyl overnight for phasing.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-02-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'silicon double crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0055 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0055 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX1 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate 18.79 _reflns.entry_id 6WNM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.58 _reflns.d_resolution_low 42.333 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5168 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.7 _reflns.pdbx_Rmerge_I_obs 0.172 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.00 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.58 _reflns_shell.d_res_low 2.69 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 607 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.834 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.331 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.861 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6WNM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.580 _refine.ls_d_res_low 42.333 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5135 _refine.ls_number_reflns_R_free 282 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.96 _refine.ls_percent_reflns_R_free 5.49 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2131 _refine.ls_R_factor_R_free 0.2424 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2115 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values MLHL _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 17.45 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.26 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.580 _refine_hist.d_res_low 42.333 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 1228 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1201 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 21 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 1247 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.804 ? 1689 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.474 ? 750 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.052 ? 189 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 213 ? f_plane_restr ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.5802 _refine_ls_shell.d_res_low 3.2506 _refine_ls_shell.number_reflns_all . _refine_ls_shell.number_reflns_obs . _refine_ls_shell.number_reflns_R_free 150 _refine_ls_shell.number_reflns_R_work 2353 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free . _refine_ls_shell.R_factor_all . _refine_ls_shell.R_factor_obs . _refine_ls_shell.R_factor_R_free 0.2542 _refine_ls_shell.R_factor_R_free_error . _refine_ls_shell.R_factor_R_work 0.2107 _refine_ls_shell.redundancy_reflns_all . _refine_ls_shell.redundancy_reflns_obs . _refine_ls_shell.wR_factor_all . _refine_ls_shell.wR_factor_obs . _refine_ls_shell.wR_factor_R_free . _refine_ls_shell.wR_factor_R_work . _refine_ls_shell.pdbx_R_complete . _refine_ls_shell.pdbx_total_number_of_bins_used . _refine_ls_shell.pdbx_phase_error . _refine_ls_shell.pdbx_fsc_work . _refine_ls_shell.pdbx_fsc_free . # _struct.entry_id 6WNM _struct.title 'The structure of Pf4r from a superinfective isolate of the filamentous phage Pf4 of Pseudomonas aeruginosa PA01' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6WNM _struct_keywords.text 'DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 3 ? LYS A 13 ? THR A 3 LYS A 13 1 ? 11 HELX_P HELX_P2 AA2 GLY A 16 ? HIS A 23 ? GLY A 16 HIS A 23 1 ? 8 HELX_P HELX_P3 AA3 ASP A 26 ? LYS A 35 ? ASP A 26 LYS A 35 1 ? 10 HELX_P HELX_P4 AA4 SER A 41 ? PHE A 52 ? SER A 41 PHE A 52 1 ? 12 HELX_P HELX_P5 AA5 TYR A 55 ? GLY A 62 ? TYR A 55 GLY A 62 1 ? 8 HELX_P HELX_P6 AA6 ALA A 65 ? GLY A 69 ? ALA A 65 GLY A 69 5 ? 5 HELX_P HELX_P7 AA7 SER A 72 ? ASN A 79 ? SER A 72 ASN A 79 1 ? 8 HELX_P HELX_P8 AA8 THR B 3 ? GLY B 16 ? THR B 3 GLY B 16 1 ? 14 HELX_P HELX_P9 AA9 GLY B 16 ? GLY B 24 ? GLY B 16 GLY B 24 1 ? 9 HELX_P HELX_P10 AB1 ASP B 26 ? SER B 34 ? ASP B 26 SER B 34 1 ? 9 HELX_P HELX_P11 AB2 SER B 41 ? PHE B 52 ? SER B 41 PHE B 52 1 ? 12 HELX_P HELX_P12 AB3 TYR B 55 ? GLY B 62 ? TYR B 55 GLY B 62 1 ? 8 HELX_P HELX_P13 AB4 ALA B 65 ? GLY B 69 ? ALA B 65 GLY B 69 5 ? 5 HELX_P HELX_P14 AB5 SER B 72 ? ASN B 79 ? SER B 72 ASN B 79 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id HIS _struct_conn.ptnr1_label_seq_id 23 _struct_conn.ptnr1_label_atom_id NE2 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id C _struct_conn.ptnr2_label_comp_id U5J _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id HG2 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id HIS _struct_conn.ptnr1_auth_seq_id 23 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id U5J _struct_conn.ptnr2_auth_seq_id 101 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.197 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id U5J _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'binding site for residue U5J A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 LEU A 22 ? LEU A 22 . ? 1_555 ? 2 AC1 7 HIS A 23 ? HIS A 23 . ? 1_555 ? 3 AC1 7 LYS A 35 ? LYS A 35 . ? 5_455 ? 4 AC1 7 GLY A 36 ? GLY A 36 . ? 5_455 ? 5 AC1 7 LYS A 50 ? LYS A 50 . ? 1_555 ? 6 AC1 7 ILE A 51 ? ILE A 51 . ? 1_555 ? 7 AC1 7 TYR A 75 ? TYR A 75 . ? 5_555 ? # _atom_sites.entry_id 6WNM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.026241 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021063 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005906 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H HG N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ASN 81 81 ? ? ? A . n A 1 82 LEU 82 82 ? ? ? A . n A 1 83 SER 83 83 ? ? ? A . n A 1 84 ASN 84 84 ? ? ? A . n A 1 85 GLN 85 85 ? ? ? A . n A 1 86 ASN 86 86 ? ? ? A . n A 1 87 ALA 87 87 ? ? ? A . n A 1 88 GLY 88 88 ? ? ? A . n A 1 89 ALA 89 89 ? ? ? A . n A 1 90 HIS 90 90 ? ? ? A . n A 1 91 HIS 91 91 ? ? ? A . n A 1 92 HIS 92 92 ? ? ? A . n A 1 93 HIS 93 93 ? ? ? A . n A 1 94 HIS 94 94 ? ? ? A . n A 1 95 HIS 95 95 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 SER 2 2 2 SER SER B . n B 1 3 THR 3 3 3 THR THR B . n B 1 4 PRO 4 4 4 PRO PRO B . n B 1 5 ALA 5 5 5 ALA ALA B . n B 1 6 ASP 6 6 6 ASP ASP B . n B 1 7 ARG 7 7 7 ARG ARG B . n B 1 8 ALA 8 8 8 ALA ALA B . n B 1 9 ARG 9 9 9 ARG ARG B . n B 1 10 LEU 10 10 10 LEU LEU B . n B 1 11 LEU 11 11 11 LEU LEU B . n B 1 12 ILE 12 12 12 ILE ILE B . n B 1 13 LYS 13 13 13 LYS LYS B . n B 1 14 LYS 14 14 14 LYS LYS B . n B 1 15 ILE 15 15 15 ILE ILE B . n B 1 16 GLY 16 16 16 GLY GLY B . n B 1 17 PRO 17 17 17 PRO PRO B . n B 1 18 LYS 18 18 18 LYS LYS B . n B 1 19 LYS 19 19 19 LYS LYS B . n B 1 20 VAL 20 20 20 VAL VAL B . n B 1 21 SER 21 21 21 SER SER B . n B 1 22 LEU 22 22 22 LEU LEU B . n B 1 23 HIS 23 23 23 HIS HIS B . n B 1 24 GLY 24 24 24 GLY GLY B . n B 1 25 GLY 25 25 25 GLY GLY B . n B 1 26 ASP 26 26 26 ASP ASP B . n B 1 27 TYR 27 27 27 TYR TYR B . n B 1 28 GLU 28 28 28 GLU GLU B . n B 1 29 ARG 29 29 29 ARG ARG B . n B 1 30 TRP 30 30 30 TRP TRP B . n B 1 31 LYS 31 31 31 LYS LYS B . n B 1 32 SER 32 32 32 SER SER B . n B 1 33 VAL 33 33 33 VAL VAL B . n B 1 34 SER 34 34 34 SER SER B . n B 1 35 LYS 35 35 ? ? ? B . n B 1 36 GLY 36 36 ? ? ? B . n B 1 37 ALA 37 37 ? ? ? B . n B 1 38 ILE 38 38 ? ? ? B . n B 1 39 ARG 39 39 ? ? ? B . n B 1 40 VAL 40 40 40 VAL VAL B . n B 1 41 SER 41 41 41 SER SER B . n B 1 42 THR 42 42 42 THR THR B . n B 1 43 GLU 43 43 43 GLU GLU B . n B 1 44 GLU 44 44 44 GLU GLU B . n B 1 45 ILE 45 45 45 ILE ILE B . n B 1 46 ASP 46 46 46 ASP ASP B . n B 1 47 VAL 47 47 47 VAL VAL B . n B 1 48 LEU 48 48 48 LEU LEU B . n B 1 49 VAL 49 49 49 VAL VAL B . n B 1 50 LYS 50 50 50 LYS LYS B . n B 1 51 ILE 51 51 51 ILE ILE B . n B 1 52 PHE 52 52 52 PHE PHE B . n B 1 53 PRO 53 53 53 PRO PRO B . n B 1 54 ASN 54 54 54 ASN ASN B . n B 1 55 TYR 55 55 55 TYR TYR B . n B 1 56 ALA 56 56 56 ALA ALA B . n B 1 57 LEU 57 57 57 LEU LEU B . n B 1 58 TRP 58 58 58 TRP TRP B . n B 1 59 ILE 59 59 59 ILE ILE B . n B 1 60 ALA 60 60 60 ALA ALA B . n B 1 61 SER 61 61 61 SER SER B . n B 1 62 GLY 62 62 62 GLY GLY B . n B 1 63 SER 63 63 63 SER SER B . n B 1 64 ILE 64 64 64 ILE ILE B . n B 1 65 ALA 65 65 65 ALA ALA B . n B 1 66 PRO 66 66 66 PRO PRO B . n B 1 67 GLU 67 67 67 GLU GLU B . n B 1 68 VAL 68 68 68 VAL VAL B . n B 1 69 GLY 69 69 69 GLY GLY B . n B 1 70 GLN 70 70 70 GLN GLN B . n B 1 71 THR 71 71 71 THR THR B . n B 1 72 SER 72 72 72 SER SER B . n B 1 73 PRO 73 73 73 PRO PRO B . n B 1 74 ASP 74 74 74 ASP ASP B . n B 1 75 TYR 75 75 75 TYR TYR B . n B 1 76 ASP 76 76 76 ASP ASP B . n B 1 77 GLU 77 77 77 GLU GLU B . n B 1 78 ALA 78 78 78 ALA ALA B . n B 1 79 ASN 79 79 79 ASN ASN B . n B 1 80 LEU 80 80 80 LEU LEU B . n B 1 81 ASN 81 81 81 ASN ASN B . n B 1 82 LEU 82 82 82 LEU LEU B . n B 1 83 SER 83 83 ? ? ? B . n B 1 84 ASN 84 84 ? ? ? B . n B 1 85 GLN 85 85 ? ? ? B . n B 1 86 ASN 86 86 ? ? ? B . n B 1 87 ALA 87 87 ? ? ? B . n B 1 88 GLY 88 88 ? ? ? B . n B 1 89 ALA 89 89 ? ? ? B . n B 1 90 HIS 90 90 ? ? ? B . n B 1 91 HIS 91 91 ? ? ? B . n B 1 92 HIS 92 92 ? ? ? B . n B 1 93 HIS 93 93 ? ? ? B . n B 1 94 HIS 94 94 ? ? ? B . n B 1 95 HIS 95 95 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 U5J 1 101 1 U5J LIG A . D 3 HOH 1 201 2 HOH HOH A . D 3 HOH 2 202 3 HOH HOH A . D 3 HOH 3 203 5 HOH HOH A . D 3 HOH 4 204 1 HOH HOH A . D 3 HOH 5 205 6 HOH HOH A . E 3 HOH 1 101 4 HOH HOH B . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,3 A,C,D 2 1,2 B,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1670 ? 1 MORE -13 ? 1 'SSA (A^2)' 8530 ? 2 'ABSA (A^2)' 1350 ? 2 MORE -12 ? 2 'SSA (A^2)' 8430 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_555 -x,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 84.6660000000 3 'crystal symmetry operation' 4_566 x,-y+1,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 47.4770000000 0.0000000000 0.0000000000 -1.0000000000 169.3320000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 23 ? A HIS 23 ? 1_555 HG2 ? C U5J . ? A U5J 101 ? 1_555 C03 ? C U5J . ? A U5J 101 ? 1_555 126.9 ? 2 NE2 ? A HIS 23 ? A HIS 23 ? 1_555 HG2 ? C U5J . ? A U5J 101 ? 1_555 O01 ? C U5J . ? A U5J 101 ? 1_555 100.6 ? 3 C03 ? C U5J . ? A U5J 101 ? 1_555 HG2 ? C U5J . ? A U5J 101 ? 1_555 O01 ? C U5J . ? A U5J 101 ? 1_555 120.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-04-07 2 'Structure model' 1 1 2021-08-25 3 'Structure model' 1 2 2021-09-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 3 'Structure model' citation 5 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 2 'Structure model' '_database_2.pdbx_DOI' 10 2 'Structure model' '_database_2.pdbx_database_accession' 11 3 'Structure model' '_citation.pdbx_database_id_PubMed' 12 3 'Structure model' '_citation.title' 13 3 'Structure model' '_citation_author.identifier_ORCID' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 14.1625 24.9710 72.8299 0.1587 ? 0.0344 ? 0.1435 ? 0.0704 ? -0.0094 ? 0.0054 ? 0.8876 ? 0.2435 ? 0.4042 ? 0.1487 ? 0.0421 ? 0.7858 ? 0.1728 ? 0.0456 ? -0.4902 ? -0.1986 ? 0.1711 ? -0.3311 ? 0.6174 ? -0.0213 ? 0.7751 ? 2 'X-RAY DIFFRACTION' ? refined 21.4224 29.6863 73.3333 0.1122 ? -0.0099 ? 0.0859 ? 0.2839 ? -0.0305 ? 0.3416 ? 0.6494 ? -0.3985 ? 0.4759 ? 0.4374 ? -0.4349 ? 0.4633 ? 0.1433 ? -0.3142 ? -0.3155 ? -0.1249 ? -0.0022 ? -0.0792 ? 0.1297 ? 0.2448 ? 0.3387 ? 3 'X-RAY DIFFRACTION' ? refined 17.2247 26.8312 79.0353 0.1183 ? 0.0434 ? 0.0168 ? 0.2135 ? 0.0665 ? 0.3256 ? 0.6839 ? -0.0143 ? 0.2136 ? 0.1413 ? 0.0984 ? 0.1760 ? 0.0611 ? -0.2891 ? -0.1662 ? 0.0135 ? -0.1994 ? -0.0144 ? -0.0107 ? 0.3031 ? -0.5914 ? 4 'X-RAY DIFFRACTION' ? refined 0.8122 22.0602 75.7857 0.1293 ? 0.0181 ? -0.0495 ? 0.0678 ? -0.0368 ? 0.1413 ? 1.2906 ? 0.2381 ? 0.4764 ? 0.3038 ? -0.1936 ? 0.4023 ? -0.1052 ? -0.1704 ? -0.4584 ? -0.3966 ? 0.3315 ? -0.1026 ? 0.1728 ? -0.1021 ? 0.3889 ? 5 'X-RAY DIFFRACTION' ? refined 9.2932 14.4317 49.4456 0.6706 ? 0.2578 ? 0.0221 ? 0.6949 ? -0.0083 ? 0.2862 ? 0.0378 ? 0.0548 ? -0.0198 ? 0.0743 ? -0.0286 ? 0.0070 ? -0.0440 ? -0.1805 ? -0.2137 ? -0.4019 ? -0.1195 ? -0.2091 ? 0.3580 ? 0.1618 ? 0.0020 ? 6 'X-RAY DIFFRACTION' ? refined 2.6039 14.3832 62.2153 0.2784 ? 0.0710 ? 0.0179 ? 0.4557 ? -0.0190 ? 0.1947 ? 1.6536 ? 1.2114 ? 0.0576 ? 0.9013 ? 0.0372 ? 0.0039 ? 0.0413 ? -0.1695 ? 0.8223 ? 0.0153 ? 0.0939 ? 0.1653 ? -0.1342 ? 0.3192 ? 0.0003 ? 7 'X-RAY DIFFRACTION' ? refined 2.9327 6.2765 57.8680 0.7007 ? 0.0413 ? -0.0422 ? 0.3822 ? 0.0451 ? 0.2065 ? 0.7129 ? 0.9250 ? -0.0944 ? 1.1860 ? -0.1166 ? 0.0047 ? 0.0039 ? -0.2797 ? -0.4062 ? -0.0449 ? -0.4107 ? 0.1072 ? 0.6994 ? 0.5967 ? -0.1123 ? 8 'X-RAY DIFFRACTION' ? refined 0.6288 16.7309 48.8236 0.3564 ? -0.0660 ? 0.1121 ? 0.3678 ? -0.0503 ? 0.0724 ? 5.5646 ? -0.5911 ? 2.4901 ? 1.3245 ? -0.9558 ? 1.5306 ? -0.4521 ? -0.0877 ? 0.9414 ? 0.4822 ? -0.0177 ? 0.0387 ? -0.1079 ? -0.1658 ? -0.7168 ? 9 'X-RAY DIFFRACTION' ? refined 4.2270 29.7006 46.0067 0.5022 ? -0.2148 ? -0.0197 ? 0.6109 ? 0.1074 ? 0.2527 ? 2.0160 ? 0.5040 ? 1.0958 ? 0.5708 ? 1.2153 ? 2.5622 ? -0.3710 ? -0.0210 ? 0.1899 ? -0.4584 ? -0.3824 ? -0.1218 ? 0.0542 ? 0.0229 ? -0.5839 ? 10 'X-RAY DIFFRACTION' ? refined 11.4016 30.3793 55.1638 0.6374 ? -0.1246 ? 0.0496 ? 0.6075 ? -0.0306 ? 0.2347 ? 0.2255 ? 0.0459 ? -0.0166 ? 0.2434 ? -0.0913 ? 0.0348 ? 0.0337 ? 0.6224 ? 0.0108 ? 0.0132 ? -0.3198 ? 0.1371 ? -0.2320 ? 0.4042 ? -0.1854 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 2 through 22 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 23 through 34 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 35 through 51 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 52 through 80 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 2 through 15 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 16 through 23 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 24 through 33 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 34 through 61 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 62 through 72 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 73 through 82 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.14_3260: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . 4 # _pdbx_entry_details.entry_id 6WNM _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id THR _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 71 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -125.99 _pdbx_validate_torsion.psi -167.48 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASN 81 ? A ASN 81 3 1 Y 1 A LEU 82 ? A LEU 82 4 1 Y 1 A SER 83 ? A SER 83 5 1 Y 1 A ASN 84 ? A ASN 84 6 1 Y 1 A GLN 85 ? A GLN 85 7 1 Y 1 A ASN 86 ? A ASN 86 8 1 Y 1 A ALA 87 ? A ALA 87 9 1 Y 1 A GLY 88 ? A GLY 88 10 1 Y 1 A ALA 89 ? A ALA 89 11 1 Y 1 A HIS 90 ? A HIS 90 12 1 Y 1 A HIS 91 ? A HIS 91 13 1 Y 1 A HIS 92 ? A HIS 92 14 1 Y 1 A HIS 93 ? A HIS 93 15 1 Y 1 A HIS 94 ? A HIS 94 16 1 Y 1 A HIS 95 ? A HIS 95 17 1 Y 1 B MET 1 ? B MET 1 18 1 Y 1 B LYS 35 ? B LYS 35 19 1 Y 1 B GLY 36 ? B GLY 36 20 1 Y 1 B ALA 37 ? B ALA 37 21 1 Y 1 B ILE 38 ? B ILE 38 22 1 Y 1 B ARG 39 ? B ARG 39 23 1 Y 1 B SER 83 ? B SER 83 24 1 Y 1 B ASN 84 ? B ASN 84 25 1 Y 1 B GLN 85 ? B GLN 85 26 1 Y 1 B ASN 86 ? B ASN 86 27 1 Y 1 B ALA 87 ? B ALA 87 28 1 Y 1 B GLY 88 ? B GLY 88 29 1 Y 1 B ALA 89 ? B ALA 89 30 1 Y 1 B HIS 90 ? B HIS 90 31 1 Y 1 B HIS 91 ? B HIS 91 32 1 Y 1 B HIS 92 ? B HIS 92 33 1 Y 1 B HIS 93 ? B HIS 93 34 1 Y 1 B HIS 94 ? B HIS 94 35 1 Y 1 B HIS 95 ? B HIS 95 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Research Foundation (NRF, Singapore)' Singapore ? 1 'Australian Research Council (ARC)' Australia FT160100010 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '[(2R)-3-{[2-(carboxymethoxy)benzene-1-carbonyl]amino}-2-methoxypropyl](hydroxy)mercury' U5J 3 water HOH # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'gel filtration' 'Sample in biological buffer gel filtrates as a monomer.' 2 1 'light scattering' 'MALS gives a molecular mass of a monomer.' 3 2 'gel filtration' 'Sample in biological buffer gel filtrates as a monomer.' 4 2 'light scattering' 'MALS gives a molecular mass of a monomer.' #