data_6WP8 # _entry.id 6WP8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6WP8 pdb_00006wp8 10.2210/pdb6wp8/pdb WWPDB D_1000246676 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6WP8 _pdbx_database_status.recvd_initial_deposition_date 2020-04-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Besaw, J.E.' 1 0000-0002-7571-7132 'Ernst, O.P.' 2 0000-0002-8863-9444 'Ou, W.' 3 0000-0002-8069-5927 'Morizumi, T.' 4 0000-0002-2785-209X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 295 _citation.language ? _citation.page_first 14793 _citation.page_last 14804 _citation.title ;The crystal structures of a chloride-pumping microbial rhodopsin and its proton-pumping mutant illuminate proton transfer determinants. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.RA120.014118 _citation.pdbx_database_id_PubMed 32703899 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Besaw, J.E.' 1 ? primary 'Ou, W.L.' 2 ? primary 'Morizumi, T.' 3 ? primary 'Eger, B.T.' 4 ? primary 'Sanchez Vasquez, J.D.' 5 ? primary 'Chu, J.H.Y.' 6 ? primary 'Harris, A.' 7 ? primary 'Brown, L.S.' 8 ? primary 'Miller, R.J.D.' 9 ? primary 'Ernst, O.P.' 10 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6WP8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 103.741 _cell.length_a_esd ? _cell.length_b 103.741 _cell.length_b_esd ? _cell.length_c 55.213 _cell.length_c_esd ? _cell.volume 514603.620 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6WP8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 150 _symmetry.space_group_name_Hall ;P 3 2" ; _symmetry.space_group_name_H-M 'P 3 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Proton-pumping rhodopsin chloride pump' 27145.664 1 ? ? ? ? 2 non-polymer syn RETINAL 284.436 1 ? ? ? ? 3 non-polymer man 'octyl beta-D-glucopyranoside' 292.369 1 ? ? ? ? 4 water nat water 18.015 15 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTQAWLWIGVISMALGSVFFGFGAHNAKNERWQILYTLNFFICLIAAGLYLAMALGLGVNVINGRPTYWVRFVDWFCSTP LLLLDLTFLGRTSLPLTGSLLGANAYMLVTGFVATVTPKPMSYIWYIVSCAAYLAIVYLLAQPYRIAAERKHPRSKQAFR TLVTVHLVLWTLYPIVWILSPEGFSTFTQGSETMFYTLLDIASKVGFGFLSLNTLHTLEQATEPARETHLSYLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MTQAWLWIGVISMALGSVFFGFGAHNAKNERWQILYTLNFFICLIAAGLYLAMALGLGVNVINGRPTYWVRFVDWFCSTP LLLLDLTFLGRTSLPLTGSLLGANAYMLVTGFVATVTPKPMSYIWYIVSCAAYLAIVYLLAQPYRIAAERKHPRSKQAFR TLVTVHLVLWTLYPIVWILSPEGFSTFTQGSETMFYTLLDIASKVGFGFLSLNTLHTLEQATEPARETHLSYLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 GLN n 1 4 ALA n 1 5 TRP n 1 6 LEU n 1 7 TRP n 1 8 ILE n 1 9 GLY n 1 10 VAL n 1 11 ILE n 1 12 SER n 1 13 MET n 1 14 ALA n 1 15 LEU n 1 16 GLY n 1 17 SER n 1 18 VAL n 1 19 PHE n 1 20 PHE n 1 21 GLY n 1 22 PHE n 1 23 GLY n 1 24 ALA n 1 25 HIS n 1 26 ASN n 1 27 ALA n 1 28 LYS n 1 29 ASN n 1 30 GLU n 1 31 ARG n 1 32 TRP n 1 33 GLN n 1 34 ILE n 1 35 LEU n 1 36 TYR n 1 37 THR n 1 38 LEU n 1 39 ASN n 1 40 PHE n 1 41 PHE n 1 42 ILE n 1 43 CYS n 1 44 LEU n 1 45 ILE n 1 46 ALA n 1 47 ALA n 1 48 GLY n 1 49 LEU n 1 50 TYR n 1 51 LEU n 1 52 ALA n 1 53 MET n 1 54 ALA n 1 55 LEU n 1 56 GLY n 1 57 LEU n 1 58 GLY n 1 59 VAL n 1 60 ASN n 1 61 VAL n 1 62 ILE n 1 63 ASN n 1 64 GLY n 1 65 ARG n 1 66 PRO n 1 67 THR n 1 68 TYR n 1 69 TRP n 1 70 VAL n 1 71 ARG n 1 72 PHE n 1 73 VAL n 1 74 ASP n 1 75 TRP n 1 76 PHE n 1 77 CYS n 1 78 SER n 1 79 THR n 1 80 PRO n 1 81 LEU n 1 82 LEU n 1 83 LEU n 1 84 LEU n 1 85 ASP n 1 86 LEU n 1 87 THR n 1 88 PHE n 1 89 LEU n 1 90 GLY n 1 91 ARG n 1 92 THR n 1 93 SER n 1 94 LEU n 1 95 PRO n 1 96 LEU n 1 97 THR n 1 98 GLY n 1 99 SER n 1 100 LEU n 1 101 LEU n 1 102 GLY n 1 103 ALA n 1 104 ASN n 1 105 ALA n 1 106 TYR n 1 107 MET n 1 108 LEU n 1 109 VAL n 1 110 THR n 1 111 GLY n 1 112 PHE n 1 113 VAL n 1 114 ALA n 1 115 THR n 1 116 VAL n 1 117 THR n 1 118 PRO n 1 119 LYS n 1 120 PRO n 1 121 MET n 1 122 SER n 1 123 TYR n 1 124 ILE n 1 125 TRP n 1 126 TYR n 1 127 ILE n 1 128 VAL n 1 129 SER n 1 130 CYS n 1 131 ALA n 1 132 ALA n 1 133 TYR n 1 134 LEU n 1 135 ALA n 1 136 ILE n 1 137 VAL n 1 138 TYR n 1 139 LEU n 1 140 LEU n 1 141 ALA n 1 142 GLN n 1 143 PRO n 1 144 TYR n 1 145 ARG n 1 146 ILE n 1 147 ALA n 1 148 ALA n 1 149 GLU n 1 150 ARG n 1 151 LYS n 1 152 HIS n 1 153 PRO n 1 154 ARG n 1 155 SER n 1 156 LYS n 1 157 GLN n 1 158 ALA n 1 159 PHE n 1 160 ARG n 1 161 THR n 1 162 LEU n 1 163 VAL n 1 164 THR n 1 165 VAL n 1 166 HIS n 1 167 LEU n 1 168 VAL n 1 169 LEU n 1 170 TRP n 1 171 THR n 1 172 LEU n 1 173 TYR n 1 174 PRO n 1 175 ILE n 1 176 VAL n 1 177 TRP n 1 178 ILE n 1 179 LEU n 1 180 SER n 1 181 PRO n 1 182 GLU n 1 183 GLY n 1 184 PHE n 1 185 SER n 1 186 THR n 1 187 PHE n 1 188 THR n 1 189 GLN n 1 190 GLY n 1 191 SER n 1 192 GLU n 1 193 THR n 1 194 MET n 1 195 PHE n 1 196 TYR n 1 197 THR n 1 198 LEU n 1 199 LEU n 1 200 ASP n 1 201 ILE n 1 202 ALA n 1 203 SER n 1 204 LYS n 1 205 VAL n 1 206 GLY n 1 207 PHE n 1 208 GLY n 1 209 PHE n 1 210 LEU n 1 211 SER n 1 212 LEU n 1 213 ASN n 1 214 THR n 1 215 LEU n 1 216 HIS n 1 217 THR n 1 218 LEU n 1 219 GLU n 1 220 GLN n 1 221 ALA n 1 222 THR n 1 223 GLU n 1 224 PRO n 1 225 ALA n 1 226 ARG n 1 227 GLU n 1 228 THR n 1 229 HIS n 1 230 LEU n 1 231 SER n 1 232 TYR n 1 233 LEU n 1 234 GLU n 1 235 HIS n 1 236 HIS n 1 237 HIS n 1 238 HIS n 1 239 HIS n 1 240 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 240 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mastigocladopsis repens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 221287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6WP8 _struct_ref.pdbx_db_accession 6WP8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6WP8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 240 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6WP8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 240 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 240 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BOG D-saccharide n 'octyl beta-D-glucopyranoside' 'Beta-Octylglucoside; octyl beta-D-glucoside; octyl D-glucoside; octyl glucoside' 'C14 H28 O6' 292.369 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RET non-polymer . RETINAL ? 'C20 H28 O' 284.436 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6WP8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.45 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.31 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 307.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '3.6 M sodium phosphate monobasic monohydrate, pH 4.0, 180 mM 1,6 hexanediol, 3.5% triethylene glycol' _exptl_crystal_grow.pdbx_pH_range 4.0-4.3 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-11-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.033 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.033 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-B _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 41.5 _reflns.entry_id 6WP8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.50 _reflns.d_resolution_low 28.92 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11125 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 3.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.98 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.60 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1275 _reflns_shell.percent_possible_all 94.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.30 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 52.66 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6WP8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.50 _refine.ls_d_res_low 28.92 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11093 _refine.ls_number_reflns_R_free 1101 _refine.ls_number_reflns_R_work 9992 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.56 _refine.ls_percent_reflns_R_free 9.93 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2300 _refine.ls_R_factor_R_free 0.2471 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2280 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6NWF _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.3279 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2918 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 28.92 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 1815 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1760 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 40 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0037 ? 1854 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.6610 ? 2533 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0392 ? 295 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0040 ? 303 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 11.0164 ? 1049 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.50 2.61 . . 134 1257 92.98 . . . 0.3223 . 0.2996 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.61 2.75 . . 137 1247 93.45 . . . 0.2984 . 0.2686 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.75 2.92 . . 133 1245 92.11 . . . 0.2832 . 0.2655 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.92 3.15 . . 139 1247 92.46 . . . 0.2694 . 0.2459 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.15 3.47 . . 136 1254 92.05 . . . 0.2817 . 0.2441 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.47 3.97 . . 144 1243 92.10 . . . 0.2081 . 0.2067 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.97 4.99 . . 134 1255 90.43 . . . 0.2133 . 0.1959 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.99 28.92 . . 144 1244 87.24 . . . 0.2463 . 0.2248 . . . . . . . . . . . # _struct.entry_id 6WP8 _struct.title 'Proton-pumping mutant of Mastigocladopsis repens rhodopsin chloride pump' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6WP8 _struct_keywords.text 'retinal protein, proton pump, ion pump, membrane protein' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 1 ? ASN A 26 ? MET A 1 ASN A 26 1 ? 26 HELX_P HELX_P2 AA2 ASN A 29 ? LEU A 55 ? ASN A 29 LEU A 55 1 ? 27 HELX_P HELX_P3 AA3 VAL A 70 ? ARG A 91 ? VAL A 70 ARG A 91 1 ? 22 HELX_P HELX_P4 AA4 SER A 93 ? THR A 117 ? SER A 93 THR A 117 1 ? 25 HELX_P HELX_P5 AA5 PRO A 120 ? GLN A 142 ? PRO A 120 GLN A 142 1 ? 23 HELX_P HELX_P6 AA6 GLN A 142 ? HIS A 152 ? GLN A 142 HIS A 152 1 ? 11 HELX_P HELX_P7 AA7 SER A 155 ? SER A 180 ? SER A 155 SER A 180 1 ? 26 HELX_P HELX_P8 AA8 THR A 188 ? ALA A 221 ? THR A 188 ALA A 221 1 ? 34 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id LYS _struct_conn.ptnr1_label_seq_id 204 _struct_conn.ptnr1_label_atom_id NZ _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id RET _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C15 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id LYS _struct_conn.ptnr1_auth_seq_id 204 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id RET _struct_conn.ptnr2_auth_seq_id 301 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.307 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 119 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 119 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 120 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 120 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.18 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASN A 60 ? ILE A 62 ? ASN A 60 ILE A 62 AA1 2 ARG A 65 ? THR A 67 ? ARG A 65 THR A 67 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ASN _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 60 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ASN _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 60 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id THR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 67 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id THR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 67 # _atom_sites.entry_id 6WP8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009639 _atom_sites.fract_transf_matrix[1][2] 0.005565 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011131 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018112 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 TRP 5 5 5 TRP TRP A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 TRP 69 69 69 TRP TRP A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 TRP 75 75 75 TRP TRP A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 MET 107 107 107 MET MET A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 TRP 125 125 125 TRP TRP A . n A 1 126 TYR 126 126 126 TYR TYR A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 TYR 144 144 144 TYR TYR A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 ARG 150 150 150 ARG ARG A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 HIS 152 152 152 HIS HIS A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 HIS 166 166 166 HIS HIS A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 TRP 170 170 170 TRP TRP A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 TYR 173 173 173 TYR TYR A . n A 1 174 PRO 174 174 174 PRO PRO A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 TRP 177 177 177 TRP TRP A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 PRO 181 181 181 PRO PRO A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 PHE 184 184 184 PHE PHE A . n A 1 185 SER 185 185 185 SER SER A . n A 1 186 THR 186 186 186 THR THR A . n A 1 187 PHE 187 187 187 PHE PHE A . n A 1 188 THR 188 188 188 THR THR A . n A 1 189 GLN 189 189 189 GLN GLN A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 SER 191 191 191 SER SER A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 THR 193 193 193 THR THR A . n A 1 194 MET 194 194 194 MET MET A . n A 1 195 PHE 195 195 195 PHE PHE A . n A 1 196 TYR 196 196 196 TYR TYR A . n A 1 197 THR 197 197 197 THR THR A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 ALA 202 202 202 ALA ALA A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 LYS 204 204 204 LYS LYS A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 GLY 206 206 206 GLY GLY A . n A 1 207 PHE 207 207 207 PHE PHE A . n A 1 208 GLY 208 208 208 GLY GLY A . n A 1 209 PHE 209 209 209 PHE PHE A . n A 1 210 LEU 210 210 210 LEU LEU A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 ASN 213 213 213 ASN ASN A . n A 1 214 THR 214 214 214 THR THR A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 HIS 216 216 216 HIS HIS A . n A 1 217 THR 217 217 217 THR THR A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 GLN 220 220 220 GLN GLN A . n A 1 221 ALA 221 221 221 ALA ALA A . n A 1 222 THR 222 222 222 THR THR A . n A 1 223 GLU 223 223 ? ? ? A . n A 1 224 PRO 224 224 ? ? ? A . n A 1 225 ALA 225 225 ? ? ? A . n A 1 226 ARG 226 226 ? ? ? A . n A 1 227 GLU 227 227 ? ? ? A . n A 1 228 THR 228 228 ? ? ? A . n A 1 229 HIS 229 229 ? ? ? A . n A 1 230 LEU 230 230 ? ? ? A . n A 1 231 SER 231 231 ? ? ? A . n A 1 232 TYR 232 232 ? ? ? A . n A 1 233 LEU 233 233 ? ? ? A . n A 1 234 GLU 234 234 ? ? ? A . n A 1 235 HIS 235 235 ? ? ? A . n A 1 236 HIS 236 236 ? ? ? A . n A 1 237 HIS 237 237 ? ? ? A . n A 1 238 HIS 238 238 ? ? ? A . n A 1 239 HIS 239 239 ? ? ? A . n A 1 240 HIS 240 240 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 RET 1 301 1 RET RET A . C 3 BOG 1 302 1 BOG BOG A . D 4 HOH 1 401 5 HOH HOH A . D 4 HOH 2 402 13 HOH HOH A . D 4 HOH 3 403 12 HOH HOH A . D 4 HOH 4 404 8 HOH HOH A . D 4 HOH 5 405 15 HOH HOH A . D 4 HOH 6 406 9 HOH HOH A . D 4 HOH 7 407 3 HOH HOH A . D 4 HOH 8 408 10 HOH HOH A . D 4 HOH 9 409 4 HOH HOH A . D 4 HOH 10 410 2 HOH HOH A . D 4 HOH 11 411 11 HOH HOH A . D 4 HOH 12 412 7 HOH HOH A . D 4 HOH 13 413 6 HOH HOH A . D 4 HOH 14 414 14 HOH HOH A . D 4 HOH 15 415 1 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6920 ? 1 MORE -38 ? 1 'SSA (A^2)' 27340 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_775 -y+2,x-y+2,z -0.5000000000 -0.8660254038 0.0000000000 103.7410000000 0.8660254038 -0.5000000000 0.0000000000 179.6846828280 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_575 -x+y,-x+2,z -0.5000000000 0.8660254038 0.0000000000 -103.7410000000 -0.8660254038 -0.5000000000 0.0000000000 179.6846828280 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-07-29 2 'Structure model' 1 1 2020-08-12 3 'Structure model' 1 2 2020-11-11 4 'Structure model' 1 3 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp 2 2 'Structure model' citation 3 2 'Structure model' citation_author 4 3 'Structure model' citation 5 3 'Structure model' citation_author 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 9 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_chem_comp.pdbx_synonyms' 2 2 'Structure model' '_citation.pdbx_database_id_DOI' 3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 2 'Structure model' '_citation_author.name' 7 3 'Structure model' '_citation.journal_volume' 8 3 'Structure model' '_citation.page_first' 9 3 'Structure model' '_citation.page_last' 10 3 'Structure model' '_citation_author.identifier_ORCID' 11 4 'Structure model' '_database_2.pdbx_DOI' 12 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z 3 -x+y,-x,z 4 x-y,-y,-z 5 -x,-x+y,-z 6 y,x,-z # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15.2_3472 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 6WP8 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 28 ? ? -61.23 -80.94 2 1 ASN A 29 ? ? -113.80 -158.90 3 1 GLN A 142 ? ? -117.70 -75.06 4 1 ARG A 154 ? ? -97.91 32.74 5 1 SER A 155 ? ? -149.67 42.07 6 1 ALA A 221 ? ? -83.95 43.28 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 223 ? A GLU 223 2 1 Y 1 A PRO 224 ? A PRO 224 3 1 Y 1 A ALA 225 ? A ALA 225 4 1 Y 1 A ARG 226 ? A ARG 226 5 1 Y 1 A GLU 227 ? A GLU 227 6 1 Y 1 A THR 228 ? A THR 228 7 1 Y 1 A HIS 229 ? A HIS 229 8 1 Y 1 A LEU 230 ? A LEU 230 9 1 Y 1 A SER 231 ? A SER 231 10 1 Y 1 A TYR 232 ? A TYR 232 11 1 Y 1 A LEU 233 ? A LEU 233 12 1 Y 1 A GLU 234 ? A GLU 234 13 1 Y 1 A HIS 235 ? A HIS 235 14 1 Y 1 A HIS 236 ? A HIS 236 15 1 Y 1 A HIS 237 ? A HIS 237 16 1 Y 1 A HIS 238 ? A HIS 238 17 1 Y 1 A HIS 239 ? A HIS 239 18 1 Y 1 A HIS 240 ? A HIS 240 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BOG C1 C N R 74 BOG O1 O N N 75 BOG C2 C N R 76 BOG O2 O N N 77 BOG C3 C N S 78 BOG O3 O N N 79 BOG C4 C N S 80 BOG O4 O N N 81 BOG C5 C N R 82 BOG O5 O N N 83 BOG C6 C N N 84 BOG O6 O N N 85 BOG "C1'" C N N 86 BOG "C2'" C N N 87 BOG "C3'" C N N 88 BOG "C4'" C N N 89 BOG "C5'" C N N 90 BOG "C6'" C N N 91 BOG "C7'" C N N 92 BOG "C8'" C N N 93 BOG H1 H N N 94 BOG H2 H N N 95 BOG HO2 H N N 96 BOG H3 H N N 97 BOG HO3 H N N 98 BOG H4 H N N 99 BOG HO4 H N N 100 BOG H5 H N N 101 BOG H61 H N N 102 BOG H62 H N N 103 BOG HO6 H N N 104 BOG "H1'1" H N N 105 BOG "H1'2" H N N 106 BOG "H2'1" H N N 107 BOG "H2'2" H N N 108 BOG "H3'1" H N N 109 BOG "H3'2" H N N 110 BOG "H4'1" H N N 111 BOG "H4'2" H N N 112 BOG "H5'1" H N N 113 BOG "H5'2" H N N 114 BOG "H6'1" H N N 115 BOG "H6'2" H N N 116 BOG "H7'1" H N N 117 BOG "H7'2" H N N 118 BOG "H8'1" H N N 119 BOG "H8'2" H N N 120 BOG "H8'3" H N N 121 CYS N N N N 122 CYS CA C N R 123 CYS C C N N 124 CYS O O N N 125 CYS CB C N N 126 CYS SG S N N 127 CYS OXT O N N 128 CYS H H N N 129 CYS H2 H N N 130 CYS HA H N N 131 CYS HB2 H N N 132 CYS HB3 H N N 133 CYS HG H N N 134 CYS HXT H N N 135 GLN N N N N 136 GLN CA C N S 137 GLN C C N N 138 GLN O O N N 139 GLN CB C N N 140 GLN CG C N N 141 GLN CD C N N 142 GLN OE1 O N N 143 GLN NE2 N N N 144 GLN OXT O N N 145 GLN H H N N 146 GLN H2 H N N 147 GLN HA H N N 148 GLN HB2 H N N 149 GLN HB3 H N N 150 GLN HG2 H N N 151 GLN HG3 H N N 152 GLN HE21 H N N 153 GLN HE22 H N N 154 GLN HXT H N N 155 GLU N N N N 156 GLU CA C N S 157 GLU C C N N 158 GLU O O N N 159 GLU CB C N N 160 GLU CG C N N 161 GLU CD C N N 162 GLU OE1 O N N 163 GLU OE2 O N N 164 GLU OXT O N N 165 GLU H H N N 166 GLU H2 H N N 167 GLU HA H N N 168 GLU HB2 H N N 169 GLU HB3 H N N 170 GLU HG2 H N N 171 GLU HG3 H N N 172 GLU HE2 H N N 173 GLU HXT H N N 174 GLY N N N N 175 GLY CA C N N 176 GLY C C N N 177 GLY O O N N 178 GLY OXT O N N 179 GLY H H N N 180 GLY H2 H N N 181 GLY HA2 H N N 182 GLY HA3 H N N 183 GLY HXT H N N 184 HIS N N N N 185 HIS CA C N S 186 HIS C C N N 187 HIS O O N N 188 HIS CB C N N 189 HIS CG C Y N 190 HIS ND1 N Y N 191 HIS CD2 C Y N 192 HIS CE1 C Y N 193 HIS NE2 N Y N 194 HIS OXT O N N 195 HIS H H N N 196 HIS H2 H N N 197 HIS HA H N N 198 HIS HB2 H N N 199 HIS HB3 H N N 200 HIS HD1 H N N 201 HIS HD2 H N N 202 HIS HE1 H N N 203 HIS HE2 H N N 204 HIS HXT H N N 205 HOH O O N N 206 HOH H1 H N N 207 HOH H2 H N N 208 ILE N N N N 209 ILE CA C N S 210 ILE C C N N 211 ILE O O N N 212 ILE CB C N S 213 ILE CG1 C N N 214 ILE CG2 C N N 215 ILE CD1 C N N 216 ILE OXT O N N 217 ILE H H N N 218 ILE H2 H N N 219 ILE HA H N N 220 ILE HB H N N 221 ILE HG12 H N N 222 ILE HG13 H N N 223 ILE HG21 H N N 224 ILE HG22 H N N 225 ILE HG23 H N N 226 ILE HD11 H N N 227 ILE HD12 H N N 228 ILE HD13 H N N 229 ILE HXT H N N 230 LEU N N N N 231 LEU CA C N S 232 LEU C C N N 233 LEU O O N N 234 LEU CB C N N 235 LEU CG C N N 236 LEU CD1 C N N 237 LEU CD2 C N N 238 LEU OXT O N N 239 LEU H H N N 240 LEU H2 H N N 241 LEU HA H N N 242 LEU HB2 H N N 243 LEU HB3 H N N 244 LEU HG H N N 245 LEU HD11 H N N 246 LEU HD12 H N N 247 LEU HD13 H N N 248 LEU HD21 H N N 249 LEU HD22 H N N 250 LEU HD23 H N N 251 LEU HXT H N N 252 LYS N N N N 253 LYS CA C N S 254 LYS C C N N 255 LYS O O N N 256 LYS CB C N N 257 LYS CG C N N 258 LYS CD C N N 259 LYS CE C N N 260 LYS NZ N N N 261 LYS OXT O N N 262 LYS H H N N 263 LYS H2 H N N 264 LYS HA H N N 265 LYS HB2 H N N 266 LYS HB3 H N N 267 LYS HG2 H N N 268 LYS HG3 H N N 269 LYS HD2 H N N 270 LYS HD3 H N N 271 LYS HE2 H N N 272 LYS HE3 H N N 273 LYS HZ1 H N N 274 LYS HZ2 H N N 275 LYS HZ3 H N N 276 LYS HXT H N N 277 MET N N N N 278 MET CA C N S 279 MET C C N N 280 MET O O N N 281 MET CB C N N 282 MET CG C N N 283 MET SD S N N 284 MET CE C N N 285 MET OXT O N N 286 MET H H N N 287 MET H2 H N N 288 MET HA H N N 289 MET HB2 H N N 290 MET HB3 H N N 291 MET HG2 H N N 292 MET HG3 H N N 293 MET HE1 H N N 294 MET HE2 H N N 295 MET HE3 H N N 296 MET HXT H N N 297 PHE N N N N 298 PHE CA C N S 299 PHE C C N N 300 PHE O O N N 301 PHE CB C N N 302 PHE CG C Y N 303 PHE CD1 C Y N 304 PHE CD2 C Y N 305 PHE CE1 C Y N 306 PHE CE2 C Y N 307 PHE CZ C Y N 308 PHE OXT O N N 309 PHE H H N N 310 PHE H2 H N N 311 PHE HA H N N 312 PHE HB2 H N N 313 PHE HB3 H N N 314 PHE HD1 H N N 315 PHE HD2 H N N 316 PHE HE1 H N N 317 PHE HE2 H N N 318 PHE HZ H N N 319 PHE HXT H N N 320 PRO N N N N 321 PRO CA C N S 322 PRO C C N N 323 PRO O O N N 324 PRO CB C N N 325 PRO CG C N N 326 PRO CD C N N 327 PRO OXT O N N 328 PRO H H N N 329 PRO HA H N N 330 PRO HB2 H N N 331 PRO HB3 H N N 332 PRO HG2 H N N 333 PRO HG3 H N N 334 PRO HD2 H N N 335 PRO HD3 H N N 336 PRO HXT H N N 337 RET C1 C N N 338 RET C2 C N N 339 RET C3 C N N 340 RET C4 C N N 341 RET C5 C N N 342 RET C6 C N N 343 RET C7 C N N 344 RET C8 C N N 345 RET C9 C N N 346 RET C10 C N N 347 RET C11 C N N 348 RET C12 C N N 349 RET C13 C N N 350 RET C14 C N N 351 RET C15 C N N 352 RET O1 O N N 353 RET C16 C N N 354 RET C17 C N N 355 RET C18 C N N 356 RET C19 C N N 357 RET C20 C N N 358 RET H21 H N N 359 RET H22 H N N 360 RET H31 H N N 361 RET H32 H N N 362 RET H41 H N N 363 RET H42 H N N 364 RET H7 H N N 365 RET H8 H N N 366 RET H10 H N N 367 RET H11 H N N 368 RET H12 H N N 369 RET H14 H N N 370 RET H15 H N N 371 RET H161 H N N 372 RET H162 H N N 373 RET H163 H N N 374 RET H171 H N N 375 RET H172 H N N 376 RET H173 H N N 377 RET H181 H N N 378 RET H182 H N N 379 RET H183 H N N 380 RET H191 H N N 381 RET H192 H N N 382 RET H193 H N N 383 RET H201 H N N 384 RET H202 H N N 385 RET H203 H N N 386 SER N N N N 387 SER CA C N S 388 SER C C N N 389 SER O O N N 390 SER CB C N N 391 SER OG O N N 392 SER OXT O N N 393 SER H H N N 394 SER H2 H N N 395 SER HA H N N 396 SER HB2 H N N 397 SER HB3 H N N 398 SER HG H N N 399 SER HXT H N N 400 THR N N N N 401 THR CA C N S 402 THR C C N N 403 THR O O N N 404 THR CB C N R 405 THR OG1 O N N 406 THR CG2 C N N 407 THR OXT O N N 408 THR H H N N 409 THR H2 H N N 410 THR HA H N N 411 THR HB H N N 412 THR HG1 H N N 413 THR HG21 H N N 414 THR HG22 H N N 415 THR HG23 H N N 416 THR HXT H N N 417 TRP N N N N 418 TRP CA C N S 419 TRP C C N N 420 TRP O O N N 421 TRP CB C N N 422 TRP CG C Y N 423 TRP CD1 C Y N 424 TRP CD2 C Y N 425 TRP NE1 N Y N 426 TRP CE2 C Y N 427 TRP CE3 C Y N 428 TRP CZ2 C Y N 429 TRP CZ3 C Y N 430 TRP CH2 C Y N 431 TRP OXT O N N 432 TRP H H N N 433 TRP H2 H N N 434 TRP HA H N N 435 TRP HB2 H N N 436 TRP HB3 H N N 437 TRP HD1 H N N 438 TRP HE1 H N N 439 TRP HE3 H N N 440 TRP HZ2 H N N 441 TRP HZ3 H N N 442 TRP HH2 H N N 443 TRP HXT H N N 444 TYR N N N N 445 TYR CA C N S 446 TYR C C N N 447 TYR O O N N 448 TYR CB C N N 449 TYR CG C Y N 450 TYR CD1 C Y N 451 TYR CD2 C Y N 452 TYR CE1 C Y N 453 TYR CE2 C Y N 454 TYR CZ C Y N 455 TYR OH O N N 456 TYR OXT O N N 457 TYR H H N N 458 TYR H2 H N N 459 TYR HA H N N 460 TYR HB2 H N N 461 TYR HB3 H N N 462 TYR HD1 H N N 463 TYR HD2 H N N 464 TYR HE1 H N N 465 TYR HE2 H N N 466 TYR HH H N N 467 TYR HXT H N N 468 VAL N N N N 469 VAL CA C N S 470 VAL C C N N 471 VAL O O N N 472 VAL CB C N N 473 VAL CG1 C N N 474 VAL CG2 C N N 475 VAL OXT O N N 476 VAL H H N N 477 VAL H2 H N N 478 VAL HA H N N 479 VAL HB H N N 480 VAL HG11 H N N 481 VAL HG12 H N N 482 VAL HG13 H N N 483 VAL HG21 H N N 484 VAL HG22 H N N 485 VAL HG23 H N N 486 VAL HXT H N N 487 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BOG C1 O1 sing N N 70 BOG C1 C2 sing N N 71 BOG C1 O5 sing N N 72 BOG C1 H1 sing N N 73 BOG O1 "C1'" sing N N 74 BOG C2 O2 sing N N 75 BOG C2 C3 sing N N 76 BOG C2 H2 sing N N 77 BOG O2 HO2 sing N N 78 BOG C3 O3 sing N N 79 BOG C3 C4 sing N N 80 BOG C3 H3 sing N N 81 BOG O3 HO3 sing N N 82 BOG C4 O4 sing N N 83 BOG C4 C5 sing N N 84 BOG C4 H4 sing N N 85 BOG O4 HO4 sing N N 86 BOG C5 O5 sing N N 87 BOG C5 C6 sing N N 88 BOG C5 H5 sing N N 89 BOG C6 O6 sing N N 90 BOG C6 H61 sing N N 91 BOG C6 H62 sing N N 92 BOG O6 HO6 sing N N 93 BOG "C1'" "C2'" sing N N 94 BOG "C1'" "H1'1" sing N N 95 BOG "C1'" "H1'2" sing N N 96 BOG "C2'" "C3'" sing N N 97 BOG "C2'" "H2'1" sing N N 98 BOG "C2'" "H2'2" sing N N 99 BOG "C3'" "C4'" sing N N 100 BOG "C3'" "H3'1" sing N N 101 BOG "C3'" "H3'2" sing N N 102 BOG "C4'" "C5'" sing N N 103 BOG "C4'" "H4'1" sing N N 104 BOG "C4'" "H4'2" sing N N 105 BOG "C5'" "C6'" sing N N 106 BOG "C5'" "H5'1" sing N N 107 BOG "C5'" "H5'2" sing N N 108 BOG "C6'" "C7'" sing N N 109 BOG "C6'" "H6'1" sing N N 110 BOG "C6'" "H6'2" sing N N 111 BOG "C7'" "C8'" sing N N 112 BOG "C7'" "H7'1" sing N N 113 BOG "C7'" "H7'2" sing N N 114 BOG "C8'" "H8'1" sing N N 115 BOG "C8'" "H8'2" sing N N 116 BOG "C8'" "H8'3" sing N N 117 CYS N CA sing N N 118 CYS N H sing N N 119 CYS N H2 sing N N 120 CYS CA C sing N N 121 CYS CA CB sing N N 122 CYS CA HA sing N N 123 CYS C O doub N N 124 CYS C OXT sing N N 125 CYS CB SG sing N N 126 CYS CB HB2 sing N N 127 CYS CB HB3 sing N N 128 CYS SG HG sing N N 129 CYS OXT HXT sing N N 130 GLN N CA sing N N 131 GLN N H sing N N 132 GLN N H2 sing N N 133 GLN CA C sing N N 134 GLN CA CB sing N N 135 GLN CA HA sing N N 136 GLN C O doub N N 137 GLN C OXT sing N N 138 GLN CB CG sing N N 139 GLN CB HB2 sing N N 140 GLN CB HB3 sing N N 141 GLN CG CD sing N N 142 GLN CG HG2 sing N N 143 GLN CG HG3 sing N N 144 GLN CD OE1 doub N N 145 GLN CD NE2 sing N N 146 GLN NE2 HE21 sing N N 147 GLN NE2 HE22 sing N N 148 GLN OXT HXT sing N N 149 GLU N CA sing N N 150 GLU N H sing N N 151 GLU N H2 sing N N 152 GLU CA C sing N N 153 GLU CA CB sing N N 154 GLU CA HA sing N N 155 GLU C O doub N N 156 GLU C OXT sing N N 157 GLU CB CG sing N N 158 GLU CB HB2 sing N N 159 GLU CB HB3 sing N N 160 GLU CG CD sing N N 161 GLU CG HG2 sing N N 162 GLU CG HG3 sing N N 163 GLU CD OE1 doub N N 164 GLU CD OE2 sing N N 165 GLU OE2 HE2 sing N N 166 GLU OXT HXT sing N N 167 GLY N CA sing N N 168 GLY N H sing N N 169 GLY N H2 sing N N 170 GLY CA C sing N N 171 GLY CA HA2 sing N N 172 GLY CA HA3 sing N N 173 GLY C O doub N N 174 GLY C OXT sing N N 175 GLY OXT HXT sing N N 176 HIS N CA sing N N 177 HIS N H sing N N 178 HIS N H2 sing N N 179 HIS CA C sing N N 180 HIS CA CB sing N N 181 HIS CA HA sing N N 182 HIS C O doub N N 183 HIS C OXT sing N N 184 HIS CB CG sing N N 185 HIS CB HB2 sing N N 186 HIS CB HB3 sing N N 187 HIS CG ND1 sing Y N 188 HIS CG CD2 doub Y N 189 HIS ND1 CE1 doub Y N 190 HIS ND1 HD1 sing N N 191 HIS CD2 NE2 sing Y N 192 HIS CD2 HD2 sing N N 193 HIS CE1 NE2 sing Y N 194 HIS CE1 HE1 sing N N 195 HIS NE2 HE2 sing N N 196 HIS OXT HXT sing N N 197 HOH O H1 sing N N 198 HOH O H2 sing N N 199 ILE N CA sing N N 200 ILE N H sing N N 201 ILE N H2 sing N N 202 ILE CA C sing N N 203 ILE CA CB sing N N 204 ILE CA HA sing N N 205 ILE C O doub N N 206 ILE C OXT sing N N 207 ILE CB CG1 sing N N 208 ILE CB CG2 sing N N 209 ILE CB HB sing N N 210 ILE CG1 CD1 sing N N 211 ILE CG1 HG12 sing N N 212 ILE CG1 HG13 sing N N 213 ILE CG2 HG21 sing N N 214 ILE CG2 HG22 sing N N 215 ILE CG2 HG23 sing N N 216 ILE CD1 HD11 sing N N 217 ILE CD1 HD12 sing N N 218 ILE CD1 HD13 sing N N 219 ILE OXT HXT sing N N 220 LEU N CA sing N N 221 LEU N H sing N N 222 LEU N H2 sing N N 223 LEU CA C sing N N 224 LEU CA CB sing N N 225 LEU CA HA sing N N 226 LEU C O doub N N 227 LEU C OXT sing N N 228 LEU CB CG sing N N 229 LEU CB HB2 sing N N 230 LEU CB HB3 sing N N 231 LEU CG CD1 sing N N 232 LEU CG CD2 sing N N 233 LEU CG HG sing N N 234 LEU CD1 HD11 sing N N 235 LEU CD1 HD12 sing N N 236 LEU CD1 HD13 sing N N 237 LEU CD2 HD21 sing N N 238 LEU CD2 HD22 sing N N 239 LEU CD2 HD23 sing N N 240 LEU OXT HXT sing N N 241 LYS N CA sing N N 242 LYS N H sing N N 243 LYS N H2 sing N N 244 LYS CA C sing N N 245 LYS CA CB sing N N 246 LYS CA HA sing N N 247 LYS C O doub N N 248 LYS C OXT sing N N 249 LYS CB CG sing N N 250 LYS CB HB2 sing N N 251 LYS CB HB3 sing N N 252 LYS CG CD sing N N 253 LYS CG HG2 sing N N 254 LYS CG HG3 sing N N 255 LYS CD CE sing N N 256 LYS CD HD2 sing N N 257 LYS CD HD3 sing N N 258 LYS CE NZ sing N N 259 LYS CE HE2 sing N N 260 LYS CE HE3 sing N N 261 LYS NZ HZ1 sing N N 262 LYS NZ HZ2 sing N N 263 LYS NZ HZ3 sing N N 264 LYS OXT HXT sing N N 265 MET N CA sing N N 266 MET N H sing N N 267 MET N H2 sing N N 268 MET CA C sing N N 269 MET CA CB sing N N 270 MET CA HA sing N N 271 MET C O doub N N 272 MET C OXT sing N N 273 MET CB CG sing N N 274 MET CB HB2 sing N N 275 MET CB HB3 sing N N 276 MET CG SD sing N N 277 MET CG HG2 sing N N 278 MET CG HG3 sing N N 279 MET SD CE sing N N 280 MET CE HE1 sing N N 281 MET CE HE2 sing N N 282 MET CE HE3 sing N N 283 MET OXT HXT sing N N 284 PHE N CA sing N N 285 PHE N H sing N N 286 PHE N H2 sing N N 287 PHE CA C sing N N 288 PHE CA CB sing N N 289 PHE CA HA sing N N 290 PHE C O doub N N 291 PHE C OXT sing N N 292 PHE CB CG sing N N 293 PHE CB HB2 sing N N 294 PHE CB HB3 sing N N 295 PHE CG CD1 doub Y N 296 PHE CG CD2 sing Y N 297 PHE CD1 CE1 sing Y N 298 PHE CD1 HD1 sing N N 299 PHE CD2 CE2 doub Y N 300 PHE CD2 HD2 sing N N 301 PHE CE1 CZ doub Y N 302 PHE CE1 HE1 sing N N 303 PHE CE2 CZ sing Y N 304 PHE CE2 HE2 sing N N 305 PHE CZ HZ sing N N 306 PHE OXT HXT sing N N 307 PRO N CA sing N N 308 PRO N CD sing N N 309 PRO N H sing N N 310 PRO CA C sing N N 311 PRO CA CB sing N N 312 PRO CA HA sing N N 313 PRO C O doub N N 314 PRO C OXT sing N N 315 PRO CB CG sing N N 316 PRO CB HB2 sing N N 317 PRO CB HB3 sing N N 318 PRO CG CD sing N N 319 PRO CG HG2 sing N N 320 PRO CG HG3 sing N N 321 PRO CD HD2 sing N N 322 PRO CD HD3 sing N N 323 PRO OXT HXT sing N N 324 RET C1 C2 sing N N 325 RET C1 C6 sing N N 326 RET C1 C16 sing N N 327 RET C1 C17 sing N N 328 RET C2 C3 sing N N 329 RET C2 H21 sing N N 330 RET C2 H22 sing N N 331 RET C3 C4 sing N N 332 RET C3 H31 sing N N 333 RET C3 H32 sing N N 334 RET C4 C5 sing N N 335 RET C4 H41 sing N N 336 RET C4 H42 sing N N 337 RET C5 C6 doub N N 338 RET C5 C18 sing N N 339 RET C6 C7 sing N N 340 RET C7 C8 doub N E 341 RET C7 H7 sing N N 342 RET C8 C9 sing N N 343 RET C8 H8 sing N N 344 RET C9 C10 doub N E 345 RET C9 C19 sing N N 346 RET C10 C11 sing N N 347 RET C10 H10 sing N N 348 RET C11 C12 doub N E 349 RET C11 H11 sing N N 350 RET C12 C13 sing N N 351 RET C12 H12 sing N N 352 RET C13 C14 doub N E 353 RET C13 C20 sing N N 354 RET C14 C15 sing N N 355 RET C14 H14 sing N N 356 RET C15 O1 doub N N 357 RET C15 H15 sing N N 358 RET C16 H161 sing N N 359 RET C16 H162 sing N N 360 RET C16 H163 sing N N 361 RET C17 H171 sing N N 362 RET C17 H172 sing N N 363 RET C17 H173 sing N N 364 RET C18 H181 sing N N 365 RET C18 H182 sing N N 366 RET C18 H183 sing N N 367 RET C19 H191 sing N N 368 RET C19 H192 sing N N 369 RET C19 H193 sing N N 370 RET C20 H201 sing N N 371 RET C20 H202 sing N N 372 RET C20 H203 sing N N 373 SER N CA sing N N 374 SER N H sing N N 375 SER N H2 sing N N 376 SER CA C sing N N 377 SER CA CB sing N N 378 SER CA HA sing N N 379 SER C O doub N N 380 SER C OXT sing N N 381 SER CB OG sing N N 382 SER CB HB2 sing N N 383 SER CB HB3 sing N N 384 SER OG HG sing N N 385 SER OXT HXT sing N N 386 THR N CA sing N N 387 THR N H sing N N 388 THR N H2 sing N N 389 THR CA C sing N N 390 THR CA CB sing N N 391 THR CA HA sing N N 392 THR C O doub N N 393 THR C OXT sing N N 394 THR CB OG1 sing N N 395 THR CB CG2 sing N N 396 THR CB HB sing N N 397 THR OG1 HG1 sing N N 398 THR CG2 HG21 sing N N 399 THR CG2 HG22 sing N N 400 THR CG2 HG23 sing N N 401 THR OXT HXT sing N N 402 TRP N CA sing N N 403 TRP N H sing N N 404 TRP N H2 sing N N 405 TRP CA C sing N N 406 TRP CA CB sing N N 407 TRP CA HA sing N N 408 TRP C O doub N N 409 TRP C OXT sing N N 410 TRP CB CG sing N N 411 TRP CB HB2 sing N N 412 TRP CB HB3 sing N N 413 TRP CG CD1 doub Y N 414 TRP CG CD2 sing Y N 415 TRP CD1 NE1 sing Y N 416 TRP CD1 HD1 sing N N 417 TRP CD2 CE2 doub Y N 418 TRP CD2 CE3 sing Y N 419 TRP NE1 CE2 sing Y N 420 TRP NE1 HE1 sing N N 421 TRP CE2 CZ2 sing Y N 422 TRP CE3 CZ3 doub Y N 423 TRP CE3 HE3 sing N N 424 TRP CZ2 CH2 doub Y N 425 TRP CZ2 HZ2 sing N N 426 TRP CZ3 CH2 sing Y N 427 TRP CZ3 HZ3 sing N N 428 TRP CH2 HH2 sing N N 429 TRP OXT HXT sing N N 430 TYR N CA sing N N 431 TYR N H sing N N 432 TYR N H2 sing N N 433 TYR CA C sing N N 434 TYR CA CB sing N N 435 TYR CA HA sing N N 436 TYR C O doub N N 437 TYR C OXT sing N N 438 TYR CB CG sing N N 439 TYR CB HB2 sing N N 440 TYR CB HB3 sing N N 441 TYR CG CD1 doub Y N 442 TYR CG CD2 sing Y N 443 TYR CD1 CE1 sing Y N 444 TYR CD1 HD1 sing N N 445 TYR CD2 CE2 doub Y N 446 TYR CD2 HD2 sing N N 447 TYR CE1 CZ doub Y N 448 TYR CE1 HE1 sing N N 449 TYR CE2 CZ sing Y N 450 TYR CE2 HE2 sing N N 451 TYR CZ OH sing N N 452 TYR OH HH sing N N 453 TYR OXT HXT sing N N 454 VAL N CA sing N N 455 VAL N H sing N N 456 VAL N H2 sing N N 457 VAL CA C sing N N 458 VAL CA CB sing N N 459 VAL CA HA sing N N 460 VAL C O doub N N 461 VAL C OXT sing N N 462 VAL CB CG1 sing N N 463 VAL CB CG2 sing N N 464 VAL CB HB sing N N 465 VAL CG1 HG11 sing N N 466 VAL CG1 HG12 sing N N 467 VAL CG1 HG13 sing N N 468 VAL CG2 HG21 sing N N 469 VAL CG2 HG22 sing N N 470 VAL CG2 HG23 sing N N 471 VAL OXT HXT sing N N 472 # _pdbx_audit_support.funding_organization 'Natural Sciences and Engineering Research Council (NSERC, Canada)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_chem_comp_identifier.comp_id BOG _pdbx_chem_comp_identifier.type 'IUPAC CARBOHYDRATE SYMBOL' _pdbx_chem_comp_identifier.program PDB-CARE _pdbx_chem_comp_identifier.program_version 1.0 _pdbx_chem_comp_identifier.identifier b-octylglucoside # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 RETINAL RET 3 'octyl beta-D-glucopyranoside' BOG 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6NWF _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 3 2 1' _space_group.name_Hall ;P 3 2" ; _space_group.IT_number 150 _space_group.crystal_system trigonal _space_group.id 1 #