data_6X1I # _entry.id 6X1I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6X1I pdb_00006x1i 10.2210/pdb6x1i/pdb WWPDB D_1000249117 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'trimer component of D3 assembly' 1WY1 unspecified PDB 'dimer component of D3 assembly' 3DXO unspecified PDB 'coiled coil component of D3 assembly' 4G1E unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6X1I _pdbx_database_status.recvd_initial_deposition_date 2020-05-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Laniado, J.' 1 0000-0001-9441-616X 'Yeates, T.O.' 2 0000-0001-5709-9839 'Sawaya, M.R.' 3 0000-0003-0874-9043 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Nano' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1936-086X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 15 _citation.language ? _citation.page_first 4277 _citation.page_last 4286 _citation.title 'Geometric Lessons and Design Strategies for Nanoscale Protein Cages.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsnano.0c07167 _citation.pdbx_database_id_PubMed 33683103 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Laniado, J.' 1 ? primary 'Cannon, K.A.' 2 ? primary 'Miller, J.E.' 3 ? primary 'Sawaya, M.R.' 4 ? primary 'McNamara, D.E.' 5 ? primary 'Yeates, T.O.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6X1I _cell.details ? _cell.formula_units_Z ? _cell.length_a 146.340 _cell.length_a_esd ? _cell.length_b 146.340 _cell.length_b_esd ? _cell.length_c 146.340 _cell.length_c_esd ? _cell.volume 3133928.757 _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6X1I _symmetry.cell_setting ? _symmetry.Int_Tables_number 212 _symmetry.space_group_name_Hall 'P 4acd 2ab 3' _symmetry.space_group_name_H-M 'P 43 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cob_adeno_trans domain-containing protein PH0671 fused to a coiled coil' 19430.395 1 ? ? ? ? 2 polymer man 'SnoaL-like Protein fused to a coiled coil' 17644.973 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MSPIIEANGTLDELTSFIGEAKHYVDEEMKGILEEIQNDIYKIMGEIGSKGKIEGISEERIKWLEGLISRYEEMVNLKSF VLPGGTLESAKLDVCRTIARRAERKVATVLREFGIGKEALVYLNRLSDLLFLLARVIEIAAAAQLEKELQALEKENAQLE WELQALEKELAQ ; ;MSPIIEANGTLDELTSFIGEAKHYVDEEMKGILEEIQNDIYKIMGEIGSKGKIEGISEERIKWLEGLISRYEEMVNLKSF VLPGGTLESAKLDVCRTIARRAERKVATVLREFGIGKEALVYLNRLSDLLFLLARVIEIAAAAQLEKELQALEKENAQLE WELQALEKELAQ ; A ? 2 'polypeptide(L)' no no ;MAQLKKKLQALKKKNAQLKWKLQALKKKLAQATQHLTIAQTYLAAWNEEDNERRRHLVGQAWAENTRYVDPLMQGEGQQG IAAMIEAARQKFPGYRFVLAGTPDGHGNFTRFSWRLISPDGDDVAGGTDVVSLNTEGRIDNVVGFLDGAVSHHHHHH ; ;MAQLKKKLQALKKKNAQLKWKLQALKKKLAQATQHLTIAQTYLAAWNEEDNERRRHLVGQAWAENTRYVDPLMQGEGQQG IAAMIEAARQKFPGYRFVLAGTPDGHGNFTRFSWRLISPDGDDVAGGTDVVSLNTEGRIDNVVGFLDGAVSHHHHHH ; B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 PRO n 1 4 ILE n 1 5 ILE n 1 6 GLU n 1 7 ALA n 1 8 ASN n 1 9 GLY n 1 10 THR n 1 11 LEU n 1 12 ASP n 1 13 GLU n 1 14 LEU n 1 15 THR n 1 16 SER n 1 17 PHE n 1 18 ILE n 1 19 GLY n 1 20 GLU n 1 21 ALA n 1 22 LYS n 1 23 HIS n 1 24 TYR n 1 25 VAL n 1 26 ASP n 1 27 GLU n 1 28 GLU n 1 29 MET n 1 30 LYS n 1 31 GLY n 1 32 ILE n 1 33 LEU n 1 34 GLU n 1 35 GLU n 1 36 ILE n 1 37 GLN n 1 38 ASN n 1 39 ASP n 1 40 ILE n 1 41 TYR n 1 42 LYS n 1 43 ILE n 1 44 MET n 1 45 GLY n 1 46 GLU n 1 47 ILE n 1 48 GLY n 1 49 SER n 1 50 LYS n 1 51 GLY n 1 52 LYS n 1 53 ILE n 1 54 GLU n 1 55 GLY n 1 56 ILE n 1 57 SER n 1 58 GLU n 1 59 GLU n 1 60 ARG n 1 61 ILE n 1 62 LYS n 1 63 TRP n 1 64 LEU n 1 65 GLU n 1 66 GLY n 1 67 LEU n 1 68 ILE n 1 69 SER n 1 70 ARG n 1 71 TYR n 1 72 GLU n 1 73 GLU n 1 74 MET n 1 75 VAL n 1 76 ASN n 1 77 LEU n 1 78 LYS n 1 79 SER n 1 80 PHE n 1 81 VAL n 1 82 LEU n 1 83 PRO n 1 84 GLY n 1 85 GLY n 1 86 THR n 1 87 LEU n 1 88 GLU n 1 89 SER n 1 90 ALA n 1 91 LYS n 1 92 LEU n 1 93 ASP n 1 94 VAL n 1 95 CYS n 1 96 ARG n 1 97 THR n 1 98 ILE n 1 99 ALA n 1 100 ARG n 1 101 ARG n 1 102 ALA n 1 103 GLU n 1 104 ARG n 1 105 LYS n 1 106 VAL n 1 107 ALA n 1 108 THR n 1 109 VAL n 1 110 LEU n 1 111 ARG n 1 112 GLU n 1 113 PHE n 1 114 GLY n 1 115 ILE n 1 116 GLY n 1 117 LYS n 1 118 GLU n 1 119 ALA n 1 120 LEU n 1 121 VAL n 1 122 TYR n 1 123 LEU n 1 124 ASN n 1 125 ARG n 1 126 LEU n 1 127 SER n 1 128 ASP n 1 129 LEU n 1 130 LEU n 1 131 PHE n 1 132 LEU n 1 133 LEU n 1 134 ALA n 1 135 ARG n 1 136 VAL n 1 137 ILE n 1 138 GLU n 1 139 ILE n 1 140 ALA n 1 141 ALA n 1 142 ALA n 1 143 ALA n 1 144 GLN n 1 145 LEU n 1 146 GLU n 1 147 LYS n 1 148 GLU n 1 149 LEU n 1 150 GLN n 1 151 ALA n 1 152 LEU n 1 153 GLU n 1 154 LYS n 1 155 GLU n 1 156 ASN n 1 157 ALA n 1 158 GLN n 1 159 LEU n 1 160 GLU n 1 161 TRP n 1 162 GLU n 1 163 LEU n 1 164 GLN n 1 165 ALA n 1 166 LEU n 1 167 GLU n 1 168 LYS n 1 169 GLU n 1 170 LEU n 1 171 ALA n 1 172 GLN n 2 1 MET n 2 2 ALA n 2 3 GLN n 2 4 LEU n 2 5 LYS n 2 6 LYS n 2 7 LYS n 2 8 LEU n 2 9 GLN n 2 10 ALA n 2 11 LEU n 2 12 LYS n 2 13 LYS n 2 14 LYS n 2 15 ASN n 2 16 ALA n 2 17 GLN n 2 18 LEU n 2 19 LYS n 2 20 TRP n 2 21 LYS n 2 22 LEU n 2 23 GLN n 2 24 ALA n 2 25 LEU n 2 26 LYS n 2 27 LYS n 2 28 LYS n 2 29 LEU n 2 30 ALA n 2 31 GLN n 2 32 ALA n 2 33 THR n 2 34 GLN n 2 35 HIS n 2 36 LEU n 2 37 THR n 2 38 ILE n 2 39 ALA n 2 40 GLN n 2 41 THR n 2 42 TYR n 2 43 LEU n 2 44 ALA n 2 45 ALA n 2 46 TRP n 2 47 ASN n 2 48 GLU n 2 49 GLU n 2 50 ASP n 2 51 ASN n 2 52 GLU n 2 53 ARG n 2 54 ARG n 2 55 ARG n 2 56 HIS n 2 57 LEU n 2 58 VAL n 2 59 GLY n 2 60 GLN n 2 61 ALA n 2 62 TRP n 2 63 ALA n 2 64 GLU n 2 65 ASN n 2 66 THR n 2 67 ARG n 2 68 TYR n 2 69 VAL n 2 70 ASP n 2 71 PRO n 2 72 LEU n 2 73 MET n 2 74 GLN n 2 75 GLY n 2 76 GLU n 2 77 GLY n 2 78 GLN n 2 79 GLN n 2 80 GLY n 2 81 ILE n 2 82 ALA n 2 83 ALA n 2 84 MET n 2 85 ILE n 2 86 GLU n 2 87 ALA n 2 88 ALA n 2 89 ARG n 2 90 GLN n 2 91 LYS n 2 92 PHE n 2 93 PRO n 2 94 GLY n 2 95 TYR n 2 96 ARG n 2 97 PHE n 2 98 VAL n 2 99 LEU n 2 100 ALA n 2 101 GLY n 2 102 THR n 2 103 PRO n 2 104 ASP n 2 105 GLY n 2 106 HIS n 2 107 GLY n 2 108 ASN n 2 109 PHE n 2 110 THR n 2 111 ARG n 2 112 PHE n 2 113 SER n 2 114 TRP n 2 115 ARG n 2 116 LEU n 2 117 ILE n 2 118 SER n 2 119 PRO n 2 120 ASP n 2 121 GLY n 2 122 ASP n 2 123 ASP n 2 124 VAL n 2 125 ALA n 2 126 GLY n 2 127 GLY n 2 128 THR n 2 129 ASP n 2 130 VAL n 2 131 VAL n 2 132 SER n 2 133 LEU n 2 134 ASN n 2 135 THR n 2 136 GLU n 2 137 GLY n 2 138 ARG n 2 139 ILE n 2 140 ASP n 2 141 ASN n 2 142 VAL n 2 143 VAL n 2 144 GLY n 2 145 PHE n 2 146 LEU n 2 147 ASP n 2 148 GLY n 2 149 ALA n 2 150 VAL n 2 151 SER n 2 152 HIS n 2 153 HIS n 2 154 HIS n 2 155 HIS n 2 156 HIS n 2 157 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 139 ? ? PH0671 ? 'ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3' ? ? ? ? 'Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)' 70601 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 140 172 ? ? ? ? ? ? ? ? ? 'Pyrococcus horikoshii OT3' 70601 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 33 ? ? ? ? ? ? ? ? ? 'Agrobacterium fabrum str. C58' 176299 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 2 sample 'Biological sequence' 34 157 ? ? Atu0744 ? 'C58 / ATCC 33970' ? ? ? ? 'Agrobacterium fabrum (strain C58 / ATCC 33970)' 176299 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP O58404_PYRHO O58404 ? 1 ;SPIIEANGTLDELTSFIGEAKHYVDEEMKGILEEIQNDIYKIMGEIGSKGKIEGISEERIKWLEGLISRYEEMVNLKSFV LPGGTLESAKLDVCRTIARRAERKVATVLREFGIGKEALVYLNRLSDLLFLLARVIEI ; 25 2 PDB 6X1I 6X1I ? 1 ? 140 3 PDB 6X1I 6X1I ? 2 ? 1 4 UNP Q7D0S4_AGRFC Q7D0S4 ? 2 ;QHLTIAQTYLAAWNEEDNERRRHLVGQAWAENTRYVDPLMQGEGQQGIAAMIEAARQKFPGYRFVLAGTPDGHGNFTRFS WRLISPDGDDVAGGTDVVSLNTEGRIDNVVGFLDGAVS ; 3 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6X1I A 2 ? 139 ? O58404 25 ? 162 ? 25 162 2 2 6X1I A 140 ? 172 ? 6X1I 163 ? 195 ? 163 195 3 3 6X1I B 1 ? 33 ? 6X1I 70 ? 102 ? 70 102 4 4 6X1I B 34 ? 151 ? Q7D0S4 3 ? 120 ? 103 220 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6X1I MET A 1 ? UNP O58404 ? ? 'initiating methionine' 24 1 4 6X1I HIS B 152 ? UNP Q7D0S4 ? ? 'expression tag' 221 2 4 6X1I HIS B 153 ? UNP Q7D0S4 ? ? 'expression tag' 222 3 4 6X1I HIS B 154 ? UNP Q7D0S4 ? ? 'expression tag' 223 4 4 6X1I HIS B 155 ? UNP Q7D0S4 ? ? 'expression tag' 224 5 4 6X1I HIS B 156 ? UNP Q7D0S4 ? ? 'expression tag' 225 6 4 6X1I HIS B 157 ? UNP Q7D0S4 ? ? 'expression tag' 226 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6X1I _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.52 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 65.08 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Reagent Well: - 10ul of Silver Bullets additive screen reagent B9: 0.25% w/v Hexamminecobalt(III) chloride, 0.25% w/v Salicylamide, 0.25% w/v Sulfanilamide, 0.25% w/v Vanillic acid, 0.02 M HEPES sodium pH 6.8 - 90ul of crystallization reagent: 0.10 M Sodium Acetate pH 5.4, 66% MPD Drop: - 2:1 protein sample to well reagent ratio - Protein sample: 2.8mg/ml of purified protein in 0.5M NaCl, 5% Glycerol, 2.8mM beta-mercaptoethanol, 50 mM Tris pH 7.5, 5mM MgCl2 sample buffer ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-11-06 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9790 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9790 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 237.211 _reflns.entry_id 6X1I _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 4.320 _reflns.d_resolution_low 84.5 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3945 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 17.657 _reflns.pdbx_Rmerge_I_obs 0.095 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.998 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.099 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 4.320 4.440 ? 1.300 ? ? ? ? 281 96.900 ? ? ? ? 2.374 ? ? ? ? ? ? ? ? 16.765 ? ? ? ? 2.449 ? ? 1 1 0.411 ? ? 4.440 4.560 ? 1.950 ? ? ? ? 264 100.000 ? ? ? ? 1.887 ? ? ? ? ? ? ? ? 18.856 ? ? ? ? 1.939 ? ? 2 1 0.746 ? ? 4.560 4.690 ? 2.280 ? ? ? ? 258 99.600 ? ? ? ? 1.577 ? ? ? ? ? ? ? ? 17.950 ? ? ? ? 1.623 ? ? 3 1 0.790 ? ? 4.690 4.830 ? 3.240 ? ? ? ? 265 100.000 ? ? ? ? 0.998 ? ? ? ? ? ? ? ? 16.868 ? ? ? ? 1.029 ? ? 4 1 0.879 ? ? 4.830 4.990 ? 5.170 ? ? ? ? 247 100.000 ? ? ? ? 0.607 ? ? ? ? ? ? ? ? 19.336 ? ? ? ? 0.624 ? ? 5 1 0.988 ? ? 4.990 5.170 ? 5.670 ? ? ? ? 247 100.000 ? ? ? ? 0.558 ? ? ? ? ? ? ? ? 19.559 ? ? ? ? 0.573 ? ? 6 1 0.983 ? ? 5.170 5.360 ? 6.000 ? ? ? ? 242 100.000 ? ? ? ? 0.498 ? ? ? ? ? ? ? ? 19.000 ? ? ? ? 0.512 ? ? 7 1 0.993 ? ? 5.360 5.580 ? 5.870 ? ? ? ? 226 100.000 ? ? ? ? 0.536 ? ? ? ? ? ? ? ? 19.022 ? ? ? ? 0.551 ? ? 8 1 0.986 ? ? 5.580 5.830 ? 5.360 ? ? ? ? 213 100.000 ? ? ? ? 0.616 ? ? ? ? ? ? ? ? 18.371 ? ? ? ? 0.634 ? ? 9 1 0.970 ? ? 5.830 6.110 ? 6.130 ? ? ? ? 218 100.000 ? ? ? ? 0.533 ? ? ? ? ? ? ? ? 17.729 ? ? ? ? 0.548 ? ? 10 1 0.974 ? ? 6.110 6.440 ? 7.450 ? ? ? ? 204 100.000 ? ? ? ? 0.428 ? ? ? ? ? ? ? ? 16.623 ? ? ? ? 0.442 ? ? 11 1 0.966 ? ? 6.440 6.830 ? 15.210 ? ? ? ? 191 100.000 ? ? ? ? 0.204 ? ? ? ? ? ? ? ? 19.120 ? ? ? ? 0.209 ? ? 12 1 0.993 ? ? 6.830 7.310 ? 22.440 ? ? ? ? 185 100.000 ? ? ? ? 0.131 ? ? ? ? ? ? ? ? 18.568 ? ? ? ? 0.135 ? ? 13 1 0.998 ? ? 7.310 7.890 ? 31.200 ? ? ? ? 172 100.000 ? ? ? ? 0.092 ? ? ? ? ? ? ? ? 17.965 ? ? ? ? 0.094 ? ? 14 1 0.998 ? ? 7.890 8.650 ? 36.030 ? ? ? ? 165 100.000 ? ? ? ? 0.072 ? ? ? ? ? ? ? ? 16.515 ? ? ? ? 0.074 ? ? 15 1 0.998 ? ? 8.650 9.670 ? 42.660 ? ? ? ? 146 100.000 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 14.884 ? ? ? ? 0.061 ? ? 16 1 0.998 ? ? 9.670 11.160 ? 49.340 ? ? ? ? 135 100.000 ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 16.356 ? ? ? ? 0.056 ? ? 17 1 0.999 ? ? 11.160 13.670 ? 49.600 ? ? ? ? 119 100.000 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 15.210 ? ? ? ? 0.051 ? ? 18 1 0.999 ? ? 13.670 19.330 ? 47.320 ? ? ? ? 98 100.000 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 13.173 ? ? ? ? 0.044 ? ? 19 1 0.999 ? ? 19.330 84.5 ? 46.800 ? ? ? ? 69 97.200 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 11.739 ? ? ? ? 0.048 ? ? 20 1 1.000 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 267.69 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6X1I _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 4.32 _refine.ls_d_res_low 84.49 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3910 _refine.ls_number_reflns_R_free 391 _refine.ls_number_reflns_R_work 3519 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.47 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2796 _refine.ls_R_factor_R_free 0.2926 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2778 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model '1WY1, 3DXO' _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 43.6380 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.6069 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 4.32 _refine_hist.d_res_low 84.49 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2507 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2507 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0042 ? 2543 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9202 ? 3421 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0522 ? 380 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0039 ? 443 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.7134 ? 966 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 4.32 4.95 . . 124 1122 98.97 . . . 0.4251 . 0.4039 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.95 6.23 . . 127 1145 99.45 . . . 0.4557 . 0.4519 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.24 84.49 . . 140 1252 100.00 . . . 0.2468 . 0.2268 . . . . . . . . . . . # _struct.entry_id 6X1I _struct.title 'Two-Component D3 Assembly Constructed by Fusing Symmetric Oligomers to Coiled Coils' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6X1I _struct_keywords.text 'Two-Component, Self-Assembling, Symmetric, D3, Coiled Coil, Helical Fusion, Design, BIOSYNTHETIC PROTEIN' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? LYS A 22 ? SER A 25 LYS A 45 1 ? 21 HELX_P HELX_P2 AA2 HIS A 23 ? VAL A 25 ? HIS A 46 VAL A 48 5 ? 3 HELX_P HELX_P3 AA3 ASP A 26 ? SER A 49 ? ASP A 49 SER A 72 1 ? 24 HELX_P HELX_P4 AA4 SER A 57 ? GLU A 73 ? SER A 80 GLU A 96 1 ? 17 HELX_P HELX_P5 AA5 THR A 86 ? GLY A 114 ? THR A 109 GLY A 137 1 ? 29 HELX_P HELX_P6 AA6 GLY A 116 ? ALA A 171 ? GLY A 139 ALA A 194 1 ? 56 HELX_P HELX_P7 AA7 LEU B 4 ? GLU B 48 ? LEU B 73 GLU B 117 1 ? 45 HELX_P HELX_P8 AA8 ASP B 50 ? ALA B 61 ? ASP B 119 ALA B 130 1 ? 12 HELX_P HELX_P9 AA9 GLY B 77 ? PHE B 92 ? GLY B 146 PHE B 161 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN B 74 ? GLU B 76 ? GLN B 143 GLU B 145 AA1 2 TRP B 62 ? VAL B 69 ? TRP B 131 VAL B 138 AA1 3 ILE B 139 ? ASP B 147 ? ILE B 208 ASP B 216 AA1 4 ASP B 123 ? LEU B 133 ? ASP B 192 LEU B 202 AA1 5 PHE B 109 ? ILE B 117 ? PHE B 178 ILE B 186 AA1 6 ARG B 96 ? HIS B 106 ? ARG B 165 HIS B 175 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLY B 75 ? O GLY B 144 N TYR B 68 ? N TYR B 137 AA1 2 3 N ARG B 67 ? N ARG B 136 O VAL B 142 ? O VAL B 211 AA1 3 4 O ASN B 141 ? O ASN B 210 N SER B 132 ? N SER B 201 AA1 4 5 O GLY B 127 ? O GLY B 196 N TRP B 114 ? N TRP B 183 AA1 5 6 O ARG B 111 ? O ARG B 180 N ASP B 104 ? N ASP B 173 # _atom_sites.entry_id 6X1I _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.006833 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006833 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006833 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 5.96793 ? ? ? 14.89577 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 15.91112 ? ? ? 10.84690 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 24 ? ? ? A . n A 1 2 SER 2 25 25 SER SER A . n A 1 3 PRO 3 26 26 PRO PRO A . n A 1 4 ILE 4 27 27 ILE ILE A . n A 1 5 ILE 5 28 28 ILE ILE A . n A 1 6 GLU 6 29 29 GLU GLU A . n A 1 7 ALA 7 30 30 ALA ALA A . n A 1 8 ASN 8 31 31 ASN ASN A . n A 1 9 GLY 9 32 32 GLY GLY A . n A 1 10 THR 10 33 33 THR THR A . n A 1 11 LEU 11 34 34 LEU LEU A . n A 1 12 ASP 12 35 35 ASP ASP A . n A 1 13 GLU 13 36 36 GLU GLU A . n A 1 14 LEU 14 37 37 LEU LEU A . n A 1 15 THR 15 38 38 THR THR A . n A 1 16 SER 16 39 39 SER SER A . n A 1 17 PHE 17 40 40 PHE PHE A . n A 1 18 ILE 18 41 41 ILE ILE A . n A 1 19 GLY 19 42 42 GLY GLY A . n A 1 20 GLU 20 43 43 GLU GLU A . n A 1 21 ALA 21 44 44 ALA ALA A . n A 1 22 LYS 22 45 45 LYS LYS A . n A 1 23 HIS 23 46 46 HIS HIS A . n A 1 24 TYR 24 47 47 TYR TYR A . n A 1 25 VAL 25 48 48 VAL VAL A . n A 1 26 ASP 26 49 49 ASP ASP A . n A 1 27 GLU 27 50 50 GLU GLU A . n A 1 28 GLU 28 51 51 GLU GLU A . n A 1 29 MET 29 52 52 MET MET A . n A 1 30 LYS 30 53 53 LYS LYS A . n A 1 31 GLY 31 54 54 GLY GLY A . n A 1 32 ILE 32 55 55 ILE ILE A . n A 1 33 LEU 33 56 56 LEU LEU A . n A 1 34 GLU 34 57 57 GLU GLU A . n A 1 35 GLU 35 58 58 GLU GLU A . n A 1 36 ILE 36 59 59 ILE ILE A . n A 1 37 GLN 37 60 60 GLN GLN A . n A 1 38 ASN 38 61 61 ASN ASN A . n A 1 39 ASP 39 62 62 ASP ASP A . n A 1 40 ILE 40 63 63 ILE ILE A . n A 1 41 TYR 41 64 64 TYR TYR A . n A 1 42 LYS 42 65 65 LYS LYS A . n A 1 43 ILE 43 66 66 ILE ILE A . n A 1 44 MET 44 67 67 MET MET A . n A 1 45 GLY 45 68 68 GLY GLY A . n A 1 46 GLU 46 69 69 GLU GLU A . n A 1 47 ILE 47 70 70 ILE ILE A . n A 1 48 GLY 48 71 71 GLY GLY A . n A 1 49 SER 49 72 72 SER SER A . n A 1 50 LYS 50 73 73 LYS LYS A . n A 1 51 GLY 51 74 74 GLY GLY A . n A 1 52 LYS 52 75 75 LYS LYS A . n A 1 53 ILE 53 76 76 ILE ILE A . n A 1 54 GLU 54 77 77 GLU GLU A . n A 1 55 GLY 55 78 78 GLY GLY A . n A 1 56 ILE 56 79 79 ILE ILE A . n A 1 57 SER 57 80 80 SER SER A . n A 1 58 GLU 58 81 81 GLU GLU A . n A 1 59 GLU 59 82 82 GLU GLU A . n A 1 60 ARG 60 83 83 ARG ARG A . n A 1 61 ILE 61 84 84 ILE ILE A . n A 1 62 LYS 62 85 85 LYS LYS A . n A 1 63 TRP 63 86 86 TRP TRP A . n A 1 64 LEU 64 87 87 LEU LEU A . n A 1 65 GLU 65 88 88 GLU GLU A . n A 1 66 GLY 66 89 89 GLY GLY A . n A 1 67 LEU 67 90 90 LEU LEU A . n A 1 68 ILE 68 91 91 ILE ILE A . n A 1 69 SER 69 92 92 SER SER A . n A 1 70 ARG 70 93 93 ARG ARG A . n A 1 71 TYR 71 94 94 TYR TYR A . n A 1 72 GLU 72 95 95 GLU GLU A . n A 1 73 GLU 73 96 96 GLU GLU A . n A 1 74 MET 74 97 97 MET MET A . n A 1 75 VAL 75 98 98 VAL VAL A . n A 1 76 ASN 76 99 99 ASN ASN A . n A 1 77 LEU 77 100 100 LEU LEU A . n A 1 78 LYS 78 101 101 LYS LYS A . n A 1 79 SER 79 102 102 SER SER A . n A 1 80 PHE 80 103 103 PHE PHE A . n A 1 81 VAL 81 104 104 VAL VAL A . n A 1 82 LEU 82 105 105 LEU LEU A . n A 1 83 PRO 83 106 106 PRO PRO A . n A 1 84 GLY 84 107 107 GLY GLY A . n A 1 85 GLY 85 108 108 GLY GLY A . n A 1 86 THR 86 109 109 THR THR A . n A 1 87 LEU 87 110 110 LEU LEU A . n A 1 88 GLU 88 111 111 GLU GLU A . n A 1 89 SER 89 112 112 SER SER A . n A 1 90 ALA 90 113 113 ALA ALA A . n A 1 91 LYS 91 114 114 LYS LYS A . n A 1 92 LEU 92 115 115 LEU LEU A . n A 1 93 ASP 93 116 116 ASP ASP A . n A 1 94 VAL 94 117 117 VAL VAL A . n A 1 95 CYS 95 118 118 CYS CYS A . n A 1 96 ARG 96 119 119 ARG ARG A . n A 1 97 THR 97 120 120 THR THR A . n A 1 98 ILE 98 121 121 ILE ILE A . n A 1 99 ALA 99 122 122 ALA ALA A . n A 1 100 ARG 100 123 123 ARG ARG A . n A 1 101 ARG 101 124 124 ARG ARG A . n A 1 102 ALA 102 125 125 ALA ALA A . n A 1 103 GLU 103 126 126 GLU GLU A . n A 1 104 ARG 104 127 127 ARG ARG A . n A 1 105 LYS 105 128 128 LYS LYS A . n A 1 106 VAL 106 129 129 VAL VAL A . n A 1 107 ALA 107 130 130 ALA ALA A . n A 1 108 THR 108 131 131 THR THR A . n A 1 109 VAL 109 132 132 VAL VAL A . n A 1 110 LEU 110 133 133 LEU LEU A . n A 1 111 ARG 111 134 134 ARG ARG A . n A 1 112 GLU 112 135 135 GLU GLU A . n A 1 113 PHE 113 136 136 PHE PHE A . n A 1 114 GLY 114 137 137 GLY GLY A . n A 1 115 ILE 115 138 138 ILE ILE A . n A 1 116 GLY 116 139 139 GLY GLY A . n A 1 117 LYS 117 140 140 LYS LYS A . n A 1 118 GLU 118 141 141 GLU GLU A . n A 1 119 ALA 119 142 142 ALA ALA A . n A 1 120 LEU 120 143 143 LEU LEU A . n A 1 121 VAL 121 144 144 VAL VAL A . n A 1 122 TYR 122 145 145 TYR TYR A . n A 1 123 LEU 123 146 146 LEU LEU A . n A 1 124 ASN 124 147 147 ASN ASN A . n A 1 125 ARG 125 148 148 ARG ARG A . n A 1 126 LEU 126 149 149 LEU LEU A . n A 1 127 SER 127 150 150 SER SER A . n A 1 128 ASP 128 151 151 ASP ASP A . n A 1 129 LEU 129 152 152 LEU LEU A . n A 1 130 LEU 130 153 153 LEU LEU A . n A 1 131 PHE 131 154 154 PHE PHE A . n A 1 132 LEU 132 155 155 LEU LEU A . n A 1 133 LEU 133 156 156 LEU LEU A . n A 1 134 ALA 134 157 157 ALA ALA A . n A 1 135 ARG 135 158 158 ARG ARG A . n A 1 136 VAL 136 159 159 VAL VAL A . n A 1 137 ILE 137 160 160 ILE ILE A . n A 1 138 GLU 138 161 161 GLU GLU A . n A 1 139 ILE 139 162 162 ILE ILE A . n A 1 140 ALA 140 163 163 ALA ALA A . n A 1 141 ALA 141 164 164 ALA ALA A . n A 1 142 ALA 142 165 165 ALA ALA A . n A 1 143 ALA 143 166 166 ALA ALA A . n A 1 144 GLN 144 167 167 GLN GLN A . n A 1 145 LEU 145 168 168 LEU LEU A . n A 1 146 GLU 146 169 169 GLU GLU A . n A 1 147 LYS 147 170 170 LYS LYS A . n A 1 148 GLU 148 171 171 GLU GLU A . n A 1 149 LEU 149 172 172 LEU LEU A . n A 1 150 GLN 150 173 173 GLN GLN A . n A 1 151 ALA 151 174 174 ALA ALA A . n A 1 152 LEU 152 175 175 LEU LEU A . n A 1 153 GLU 153 176 176 GLU GLU A . n A 1 154 LYS 154 177 177 LYS LYS A . n A 1 155 GLU 155 178 178 GLU GLU A . n A 1 156 ASN 156 179 179 ASN ASN A . n A 1 157 ALA 157 180 180 ALA ALA A . n A 1 158 GLN 158 181 181 GLN GLN A . n A 1 159 LEU 159 182 182 LEU LEU A . n A 1 160 GLU 160 183 183 GLU GLU A . n A 1 161 TRP 161 184 184 TRP TRP A . n A 1 162 GLU 162 185 185 GLU GLU A . n A 1 163 LEU 163 186 186 LEU LEU A . n A 1 164 GLN 164 187 187 GLN GLN A . n A 1 165 ALA 165 188 188 ALA ALA A . n A 1 166 LEU 166 189 189 LEU LEU A . n A 1 167 GLU 167 190 190 GLU GLU A . n A 1 168 LYS 168 191 191 LYS LYS A . n A 1 169 GLU 169 192 192 GLU GLU A . n A 1 170 LEU 170 193 193 LEU LEU A . n A 1 171 ALA 171 194 194 ALA ALA A . n A 1 172 GLN 172 195 195 GLN GLN A . n B 2 1 MET 1 70 ? ? ? B . n B 2 2 ALA 2 71 ? ? ? B . n B 2 3 GLN 3 72 72 GLN GLN B . n B 2 4 LEU 4 73 73 LEU LEU B . n B 2 5 LYS 5 74 74 LYS LYS B . n B 2 6 LYS 6 75 75 LYS LYS B . n B 2 7 LYS 7 76 76 LYS LYS B . n B 2 8 LEU 8 77 77 LEU LEU B . n B 2 9 GLN 9 78 78 GLN GLN B . n B 2 10 ALA 10 79 79 ALA ALA B . n B 2 11 LEU 11 80 80 LEU LEU B . n B 2 12 LYS 12 81 81 LYS LYS B . n B 2 13 LYS 13 82 82 LYS LYS B . n B 2 14 LYS 14 83 83 LYS LYS B . n B 2 15 ASN 15 84 84 ASN ASN B . n B 2 16 ALA 16 85 85 ALA ALA B . n B 2 17 GLN 17 86 86 GLN GLN B . n B 2 18 LEU 18 87 87 LEU LEU B . n B 2 19 LYS 19 88 88 LYS LYS B . n B 2 20 TRP 20 89 89 TRP TRP B . n B 2 21 LYS 21 90 90 LYS LYS B . n B 2 22 LEU 22 91 91 LEU LEU B . n B 2 23 GLN 23 92 92 GLN GLN B . n B 2 24 ALA 24 93 93 ALA ALA B . n B 2 25 LEU 25 94 94 LEU LEU B . n B 2 26 LYS 26 95 95 LYS LYS B . n B 2 27 LYS 27 96 96 LYS LYS B . n B 2 28 LYS 28 97 97 LYS LYS B . n B 2 29 LEU 29 98 98 LEU LEU B . n B 2 30 ALA 30 99 99 ALA ALA B . n B 2 31 GLN 31 100 100 GLN GLN B . n B 2 32 ALA 32 101 101 ALA ALA B . n B 2 33 THR 33 102 102 THR THR B . n B 2 34 GLN 34 103 103 GLN GLN B . n B 2 35 HIS 35 104 104 HIS HIS B . n B 2 36 LEU 36 105 105 LEU LEU B . n B 2 37 THR 37 106 106 THR THR B . n B 2 38 ILE 38 107 107 ILE ILE B . n B 2 39 ALA 39 108 108 ALA ALA B . n B 2 40 GLN 40 109 109 GLN GLN B . n B 2 41 THR 41 110 110 THR THR B . n B 2 42 TYR 42 111 111 TYR TYR B . n B 2 43 LEU 43 112 112 LEU LEU B . n B 2 44 ALA 44 113 113 ALA ALA B . n B 2 45 ALA 45 114 114 ALA ALA B . n B 2 46 TRP 46 115 115 TRP TRP B . n B 2 47 ASN 47 116 116 ASN ASN B . n B 2 48 GLU 48 117 117 GLU GLU B . n B 2 49 GLU 49 118 118 GLU GLU B . n B 2 50 ASP 50 119 119 ASP ASP B . n B 2 51 ASN 51 120 120 ASN ASN B . n B 2 52 GLU 52 121 121 GLU GLU B . n B 2 53 ARG 53 122 122 ARG ARG B . n B 2 54 ARG 54 123 123 ARG ARG B . n B 2 55 ARG 55 124 124 ARG ARG B . n B 2 56 HIS 56 125 125 HIS HIS B . n B 2 57 LEU 57 126 126 LEU LEU B . n B 2 58 VAL 58 127 127 VAL VAL B . n B 2 59 GLY 59 128 128 GLY GLY B . n B 2 60 GLN 60 129 129 GLN GLN B . n B 2 61 ALA 61 130 130 ALA ALA B . n B 2 62 TRP 62 131 131 TRP TRP B . n B 2 63 ALA 63 132 132 ALA ALA B . n B 2 64 GLU 64 133 133 GLU GLU B . n B 2 65 ASN 65 134 134 ASN ASN B . n B 2 66 THR 66 135 135 THR THR B . n B 2 67 ARG 67 136 136 ARG ARG B . n B 2 68 TYR 68 137 137 TYR TYR B . n B 2 69 VAL 69 138 138 VAL VAL B . n B 2 70 ASP 70 139 139 ASP ASP B . n B 2 71 PRO 71 140 140 PRO PRO B . n B 2 72 LEU 72 141 141 LEU LEU B . n B 2 73 MET 73 142 142 MET MET B . n B 2 74 GLN 74 143 143 GLN GLN B . n B 2 75 GLY 75 144 144 GLY GLY B . n B 2 76 GLU 76 145 145 GLU GLU B . n B 2 77 GLY 77 146 146 GLY GLY B . n B 2 78 GLN 78 147 147 GLN GLN B . n B 2 79 GLN 79 148 148 GLN GLN B . n B 2 80 GLY 80 149 149 GLY GLY B . n B 2 81 ILE 81 150 150 ILE ILE B . n B 2 82 ALA 82 151 151 ALA ALA B . n B 2 83 ALA 83 152 152 ALA ALA B . n B 2 84 MET 84 153 153 MET MET B . n B 2 85 ILE 85 154 154 ILE ILE B . n B 2 86 GLU 86 155 155 GLU GLU B . n B 2 87 ALA 87 156 156 ALA ALA B . n B 2 88 ALA 88 157 157 ALA ALA B . n B 2 89 ARG 89 158 158 ARG ARG B . n B 2 90 GLN 90 159 159 GLN GLN B . n B 2 91 LYS 91 160 160 LYS LYS B . n B 2 92 PHE 92 161 161 PHE PHE B . n B 2 93 PRO 93 162 162 PRO PRO B . n B 2 94 GLY 94 163 163 GLY GLY B . n B 2 95 TYR 95 164 164 TYR TYR B . n B 2 96 ARG 96 165 165 ARG ARG B . n B 2 97 PHE 97 166 166 PHE PHE B . n B 2 98 VAL 98 167 167 VAL VAL B . n B 2 99 LEU 99 168 168 LEU LEU B . n B 2 100 ALA 100 169 169 ALA ALA B . n B 2 101 GLY 101 170 170 GLY GLY B . n B 2 102 THR 102 171 171 THR THR B . n B 2 103 PRO 103 172 172 PRO PRO B . n B 2 104 ASP 104 173 173 ASP ASP B . n B 2 105 GLY 105 174 174 GLY GLY B . n B 2 106 HIS 106 175 175 HIS HIS B . n B 2 107 GLY 107 176 176 GLY GLY B . n B 2 108 ASN 108 177 177 ASN ASN B . n B 2 109 PHE 109 178 178 PHE PHE B . n B 2 110 THR 110 179 179 THR THR B . n B 2 111 ARG 111 180 180 ARG ARG B . n B 2 112 PHE 112 181 181 PHE PHE B . n B 2 113 SER 113 182 182 SER SER B . n B 2 114 TRP 114 183 183 TRP TRP B . n B 2 115 ARG 115 184 184 ARG ARG B . n B 2 116 LEU 116 185 185 LEU LEU B . n B 2 117 ILE 117 186 186 ILE ILE B . n B 2 118 SER 118 187 187 SER SER B . n B 2 119 PRO 119 188 188 PRO PRO B . n B 2 120 ASP 120 189 189 ASP ASP B . n B 2 121 GLY 121 190 190 GLY GLY B . n B 2 122 ASP 122 191 191 ASP ASP B . n B 2 123 ASP 123 192 192 ASP ASP B . n B 2 124 VAL 124 193 193 VAL VAL B . n B 2 125 ALA 125 194 194 ALA ALA B . n B 2 126 GLY 126 195 195 GLY GLY B . n B 2 127 GLY 127 196 196 GLY GLY B . n B 2 128 THR 128 197 197 THR THR B . n B 2 129 ASP 129 198 198 ASP ASP B . n B 2 130 VAL 130 199 199 VAL VAL B . n B 2 131 VAL 131 200 200 VAL VAL B . n B 2 132 SER 132 201 201 SER SER B . n B 2 133 LEU 133 202 202 LEU LEU B . n B 2 134 ASN 134 203 203 ASN ASN B . n B 2 135 THR 135 204 204 THR THR B . n B 2 136 GLU 136 205 205 GLU GLU B . n B 2 137 GLY 137 206 206 GLY GLY B . n B 2 138 ARG 138 207 207 ARG ARG B . n B 2 139 ILE 139 208 208 ILE ILE B . n B 2 140 ASP 140 209 209 ASP ASP B . n B 2 141 ASN 141 210 210 ASN ASN B . n B 2 142 VAL 142 211 211 VAL VAL B . n B 2 143 VAL 143 212 212 VAL VAL B . n B 2 144 GLY 144 213 213 GLY GLY B . n B 2 145 PHE 145 214 214 PHE PHE B . n B 2 146 LEU 146 215 215 LEU LEU B . n B 2 147 ASP 147 216 216 ASP ASP B . n B 2 148 GLY 148 217 217 GLY GLY B . n B 2 149 ALA 149 218 ? ? ? B . n B 2 150 VAL 150 219 ? ? ? B . n B 2 151 SER 151 220 ? ? ? B . n B 2 152 HIS 152 221 ? ? ? B . n B 2 153 HIS 153 222 ? ? ? B . n B 2 154 HIS 154 223 ? ? ? B . n B 2 155 HIS 155 224 ? ? ? B . n B 2 156 HIS 156 225 ? ? ? B . n B 2 157 HIS 157 226 ? ? ? B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dodecameric _pdbx_struct_assembly.oligomeric_count 12 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 1 2 A,B 1 3 A,B 1 4 A,B 1 5 A,B 1 6 A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 4 'crystal symmetry operation' 14_555 -y+1/4,-x+1/4,-z+1/4 0.0000000000 -1.0000000000 0.0000000000 36.5850000000 -1.0000000000 0.0000000000 0.0000000000 36.5850000000 0.0000000000 0.0000000000 -1.0000000000 36.5850000000 5 'crystal symmetry operation' 19_555 -x+1/4,-z+1/4,-y+1/4 -1.0000000000 0.0000000000 0.0000000000 36.5850000000 0.0000000000 0.0000000000 -1.0000000000 36.5850000000 0.0000000000 -1.0000000000 0.0000000000 36.5850000000 6 'crystal symmetry operation' 24_555 -z+1/4,-y+1/4,-x+1/4 0.0000000000 0.0000000000 -1.0000000000 36.5850000000 0.0000000000 -1.0000000000 0.0000000000 36.5850000000 -1.0000000000 0.0000000000 0.0000000000 36.5850000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-03-03 2 'Structure model' 1 1 2021-03-24 3 'Structure model' 1 2 2021-04-07 4 'Structure model' 1 3 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 2 'Structure model' '_citation_author.identifier_ORCID' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation_author.identifier_ORCID' 14 4 'Structure model' '_database_2.pdbx_DOI' 15 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+3/4,-z+3/4,y+1/4 3 x+1/4,z+3/4,-y+3/4 4 z+1/4,y+3/4,-x+3/4 5 -z+3/4,y+1/4,x+3/4 6 -y+3/4,x+1/4,z+3/4 7 y+3/4,-x+3/4,z+1/4 8 z,x,y 9 y,z,x 10 -y+1/2,-z,x+1/2 11 z+1/2,-x+1/2,-y 12 -y,z+1/2,-x+1/2 13 -z+1/2,-x,y+1/2 14 -z,x+1/2,-y+1/2 15 y+1/2,-z+1/2,-x 16 x+1/2,-y+1/2,-z 17 -x,y+1/2,-z+1/2 18 -x+1/2,-y,z+1/2 19 y+1/4,x+3/4,-z+3/4 20 -y+1/4,-x+1/4,-z+1/4 21 z+3/4,-y+3/4,x+1/4 22 -z+1/4,-y+1/4,-x+1/4 23 -x+3/4,z+1/4,y+3/4 24 -x+1/4,-z+1/4,-y+1/4 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -21.6837214664 _pdbx_refine_tls.origin_y -3.49920025763 _pdbx_refine_tls.origin_z 4.27013204244 _pdbx_refine_tls.T[1][1] 1.75171890574 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.43226750827 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0701406520304 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 2.06183065063 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.313834654617 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 1.44975340898 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.89094022973 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 2.48600199681 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.932657103822 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 8.82866925215 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 4.03708450741 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 2.90858788207 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.835757290141 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.462621168491 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.045012249451 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.551176001079 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -1.55494478699 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.479707903664 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.124552175224 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.755072867776 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.570331786576 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 25 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id B _pdbx_refine_tls_group.end_label_seq_id 146 _pdbx_refine_tls_group.end_auth_asym_id B _pdbx_refine_tls_group.end_auth_seq_id 217 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'VERSION Oct 15, 2015' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? 'VERSION Oct 15, 2015' 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 'dev 3724' 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 194 ? ? -68.91 3.88 2 1 HIS B 175 ? ? -170.50 149.03 3 1 ALA B 194 ? ? 173.89 -174.72 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 24 ? A MET 1 2 1 Y 1 B MET 70 ? B MET 1 3 1 Y 1 B ALA 71 ? B ALA 2 4 1 Y 1 B ALA 218 ? B ALA 149 5 1 Y 1 B VAL 219 ? B VAL 150 6 1 Y 1 B SER 220 ? B SER 151 7 1 Y 1 B HIS 221 ? B HIS 152 8 1 Y 1 B HIS 222 ? B HIS 153 9 1 Y 1 B HIS 223 ? B HIS 154 10 1 Y 1 B HIS 224 ? B HIS 155 11 1 Y 1 B HIS 225 ? B HIS 156 12 1 Y 1 B HIS 226 ? B HIS 157 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'National Science Foundation (NSF, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number CHE-1629214 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_initial_refinement_model.id _pdbx_initial_refinement_model.entity_id_list _pdbx_initial_refinement_model.type _pdbx_initial_refinement_model.source_name _pdbx_initial_refinement_model.accession_code _pdbx_initial_refinement_model.details 1 ? 'experimental model' PDB 1WY1 '1WY1, 3DXO' 2 ? 'experimental model' PDB 3DXO '1WY1, 3DXO' # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 43 3 2' _space_group.name_Hall 'P 4acd 2ab 3' _space_group.IT_number 212 _space_group.crystal_system cubic _space_group.id 1 #