data_6X2Q # _entry.id 6X2Q # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6X2Q pdb_00006x2q 10.2210/pdb6x2q/pdb WWPDB D_1000249455 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 6LWU _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6X2Q _pdbx_database_status.recvd_initial_deposition_date 2020-05-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Qin, Z.' 1 ? 'Wang, Y.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Complex of Gynuella sunshinyii GH46 chitosanase GsCsn46A with chitotetraose' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, Z.' 1 ? primary 'Wang, Y.' 2 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6X2Q _cell.details ? _cell.formula_units_Z ? _cell.length_a 83.756 _cell.length_a_esd ? _cell.length_b 83.756 _cell.length_b_esd ? _cell.length_c 117.31 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 9 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6X2Q _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Chitosanase 27057.549 1 ? ? ? ? 2 branched nat '2-amino-2-deoxy-beta-D-glucopyranose-(1-4)-2-amino-2-deoxy-beta-D-glucopyranose-(1-4)-2-amino-2-deoxy-beta-D-glucopyranose' 501.483 1 ? ? ? ? 3 non-polymer nat 2-amino-2-deoxy-beta-D-glucopyranose 179.171 1 ? ? ? ? 4 water nat water 18.015 54 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AQLTAQQRLLADQIISIFANNTPELQYGYAEVLDDGRGITAGRAGFTSATGDMLEVIQRYSRLRPDNILVPFLPRLQQLA ASEDGSIEGLQGLPQRWADASQNPVFRQVQDDVVDELYFQPAMERAAELGAQMPLTLLALYDAIIQHGEGDDGDGLPAMI ARTTAKVNGIPAEGVDERRWLKTFLKIRKQVLRHPANLETEDEWSESTGRVDSLMKLLKQGNTDLHPPIRISTWGDVFIL PIR ; _entity_poly.pdbx_seq_one_letter_code_can ;AQLTAQQRLLADQIISIFANNTPELQYGYAEVLDDGRGITAGRAGFTSATGDMLEVIQRYSRLRPDNILVPFLPRLQQLA ASEDGSIEGLQGLPQRWADASQNPVFRQVQDDVVDELYFQPAMERAAELGAQMPLTLLALYDAIIQHGEGDDGDGLPAMI ARTTAKVNGIPAEGVDERRWLKTFLKIRKQVLRHPANLETEDEWSESTGRVDSLMKLLKQGNTDLHPPIRISTWGDVFIL PIR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLN n 1 3 LEU n 1 4 THR n 1 5 ALA n 1 6 GLN n 1 7 GLN n 1 8 ARG n 1 9 LEU n 1 10 LEU n 1 11 ALA n 1 12 ASP n 1 13 GLN n 1 14 ILE n 1 15 ILE n 1 16 SER n 1 17 ILE n 1 18 PHE n 1 19 ALA n 1 20 ASN n 1 21 ASN n 1 22 THR n 1 23 PRO n 1 24 GLU n 1 25 LEU n 1 26 GLN n 1 27 TYR n 1 28 GLY n 1 29 TYR n 1 30 ALA n 1 31 GLU n 1 32 VAL n 1 33 LEU n 1 34 ASP n 1 35 ASP n 1 36 GLY n 1 37 ARG n 1 38 GLY n 1 39 ILE n 1 40 THR n 1 41 ALA n 1 42 GLY n 1 43 ARG n 1 44 ALA n 1 45 GLY n 1 46 PHE n 1 47 THR n 1 48 SER n 1 49 ALA n 1 50 THR n 1 51 GLY n 1 52 ASP n 1 53 MET n 1 54 LEU n 1 55 GLU n 1 56 VAL n 1 57 ILE n 1 58 GLN n 1 59 ARG n 1 60 TYR n 1 61 SER n 1 62 ARG n 1 63 LEU n 1 64 ARG n 1 65 PRO n 1 66 ASP n 1 67 ASN n 1 68 ILE n 1 69 LEU n 1 70 VAL n 1 71 PRO n 1 72 PHE n 1 73 LEU n 1 74 PRO n 1 75 ARG n 1 76 LEU n 1 77 GLN n 1 78 GLN n 1 79 LEU n 1 80 ALA n 1 81 ALA n 1 82 SER n 1 83 GLU n 1 84 ASP n 1 85 GLY n 1 86 SER n 1 87 ILE n 1 88 GLU n 1 89 GLY n 1 90 LEU n 1 91 GLN n 1 92 GLY n 1 93 LEU n 1 94 PRO n 1 95 GLN n 1 96 ARG n 1 97 TRP n 1 98 ALA n 1 99 ASP n 1 100 ALA n 1 101 SER n 1 102 GLN n 1 103 ASN n 1 104 PRO n 1 105 VAL n 1 106 PHE n 1 107 ARG n 1 108 GLN n 1 109 VAL n 1 110 GLN n 1 111 ASP n 1 112 ASP n 1 113 VAL n 1 114 VAL n 1 115 ASP n 1 116 GLU n 1 117 LEU n 1 118 TYR n 1 119 PHE n 1 120 GLN n 1 121 PRO n 1 122 ALA n 1 123 MET n 1 124 GLU n 1 125 ARG n 1 126 ALA n 1 127 ALA n 1 128 GLU n 1 129 LEU n 1 130 GLY n 1 131 ALA n 1 132 GLN n 1 133 MET n 1 134 PRO n 1 135 LEU n 1 136 THR n 1 137 LEU n 1 138 LEU n 1 139 ALA n 1 140 LEU n 1 141 TYR n 1 142 ASP n 1 143 ALA n 1 144 ILE n 1 145 ILE n 1 146 GLN n 1 147 HIS n 1 148 GLY n 1 149 GLU n 1 150 GLY n 1 151 ASP n 1 152 ASP n 1 153 GLY n 1 154 ASP n 1 155 GLY n 1 156 LEU n 1 157 PRO n 1 158 ALA n 1 159 MET n 1 160 ILE n 1 161 ALA n 1 162 ARG n 1 163 THR n 1 164 THR n 1 165 ALA n 1 166 LYS n 1 167 VAL n 1 168 ASN n 1 169 GLY n 1 170 ILE n 1 171 PRO n 1 172 ALA n 1 173 GLU n 1 174 GLY n 1 175 VAL n 1 176 ASP n 1 177 GLU n 1 178 ARG n 1 179 ARG n 1 180 TRP n 1 181 LEU n 1 182 LYS n 1 183 THR n 1 184 PHE n 1 185 LEU n 1 186 LYS n 1 187 ILE n 1 188 ARG n 1 189 LYS n 1 190 GLN n 1 191 VAL n 1 192 LEU n 1 193 ARG n 1 194 HIS n 1 195 PRO n 1 196 ALA n 1 197 ASN n 1 198 LEU n 1 199 GLU n 1 200 THR n 1 201 GLU n 1 202 ASP n 1 203 GLU n 1 204 TRP n 1 205 SER n 1 206 GLU n 1 207 SER n 1 208 THR n 1 209 GLY n 1 210 ARG n 1 211 VAL n 1 212 ASP n 1 213 SER n 1 214 LEU n 1 215 MET n 1 216 LYS n 1 217 LEU n 1 218 LEU n 1 219 LYS n 1 220 GLN n 1 221 GLY n 1 222 ASN n 1 223 THR n 1 224 ASP n 1 225 LEU n 1 226 HIS n 1 227 PRO n 1 228 PRO n 1 229 ILE n 1 230 ARG n 1 231 ILE n 1 232 SER n 1 233 THR n 1 234 TRP n 1 235 GLY n 1 236 ASP n 1 237 VAL n 1 238 PHE n 1 239 ILE n 1 240 LEU n 1 241 PRO n 1 242 ILE n 1 243 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 243 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene YC6258_05941 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gynuella sunshinyii YC6258' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1445510 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0C5VFC0_9GAMM _struct_ref.pdbx_db_accession A0A0C5VFC0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AQLTAQQRLLADQIISIFENNTPELQYGYAEVLDDGRGITAGRAGFTSATGDMLEVIQRYSRLRPDNILVPFLPRLQQLA ASEDGSIEGLQGLPQRWADASQNPVFRQVQDDVVDELYFQPAMERAAELGAQMPLTLLALYDAIIQHGEGDDGDGLPAMI ARTTAKVNGIPAEGVDERRWLKTFLKIRKQVLRHPANLETEDEWSESTGRVDSLMKLLKQGNTDLHPPIRISTWGDVFIL PIR ; _struct_ref.pdbx_align_begin 24 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6X2Q _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 243 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0C5VFC0 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 266 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 243 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6X2Q _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 19 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A0A0C5VFC0 _struct_ref_seq_dif.db_mon_id GLU _struct_ref_seq_dif.pdbx_seq_db_seq_num 42 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 19 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GCS 'D-saccharide, beta linking' . 2-amino-2-deoxy-beta-D-glucopyranose 'beta-D-glucosamine; 2-amino-2-deoxy-beta-D-glucose; 2-amino-2-deoxy-D-glucose; 2-amino-2-deoxy-glucose; D-GLUCOSAMINE' 'C6 H13 N O5' 179.171 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6X2Q _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.93 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.08 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Nacl, tris-HCl, pH8.0,glycol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR CCD 130 mm' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-04-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6X2Q _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.270 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13857 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.300 _reflns.pdbx_Rmerge_I_obs 0.043 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 2.220 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.050 _reflns.pdbx_Rpim_I_all 0.025 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 60055 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.270 2.310 ? ? ? ? ? ? 705 99.900 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? 4.500 ? 0.956 ? ? 0.095 0.046 ? 1 1 0.994 ? ? 2.310 2.350 ? ? ? ? ? ? 694 99.700 ? ? ? ? 0.075 ? ? ? ? ? ? ? ? 4.200 ? 0.938 ? ? 0.087 0.042 ? 2 1 0.994 ? ? 2.350 2.400 ? ? ? ? ? ? 722 99.700 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 4.600 ? 1.105 ? ? 0.087 0.041 ? 3 1 0.990 ? ? 2.400 2.450 ? ? ? ? ? ? 684 99.900 ? ? ? ? 0.071 ? ? ? ? ? ? ? ? 4.700 ? 1.405 ? ? 0.081 0.038 ? 4 1 0.992 ? ? 2.450 2.500 ? ? ? ? ? ? 722 100.000 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 4.600 ? 0.986 ? ? 0.075 0.036 ? 5 1 0.994 ? ? 2.500 2.560 ? ? ? ? ? ? 705 99.900 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 4.500 ? 0.991 ? ? 0.077 0.037 ? 6 1 0.995 ? ? 2.560 2.620 ? ? ? ? ? ? 727 99.500 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 4.500 ? 1.453 ? ? 0.071 0.034 ? 7 1 0.994 ? ? 2.620 2.690 ? ? ? ? ? ? 687 98.600 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 4.200 ? 1.367 ? ? 0.064 0.032 ? 8 1 0.995 ? ? 2.690 2.770 ? ? ? ? ? ? 689 98.700 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 4.300 ? 1.463 ? ? 0.060 0.029 ? 9 1 0.995 ? ? 2.770 2.860 ? ? ? ? ? ? 687 98.700 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 4.500 ? 1.158 ? ? 0.058 0.028 ? 10 1 0.997 ? ? 2.860 2.960 ? ? ? ? ? ? 725 98.600 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 4.400 ? 1.192 ? ? 0.056 0.028 ? 11 1 0.994 ? ? 2.960 3.080 ? ? ? ? ? ? 697 98.600 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 4.400 ? 1.385 ? ? 0.052 0.025 ? 12 1 0.997 ? ? 3.080 3.220 ? ? ? ? ? ? 675 97.700 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 4.100 ? 4.409 ? ? 0.057 0.028 ? 13 1 0.991 ? ? 3.220 3.390 ? ? ? ? ? ? 686 96.800 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 4.200 ? 2.917 ? ? 0.051 0.026 ? 14 1 0.995 ? ? 3.390 3.600 ? ? ? ? ? ? 694 96.800 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 4.100 ? 2.730 ? ? 0.049 0.024 ? 15 1 0.996 ? ? 3.600 3.880 ? ? ? ? ? ? 689 95.700 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 4.100 ? 4.396 ? ? 0.047 0.024 ? 16 1 0.996 ? ? 3.880 4.270 ? ? ? ? ? ? 650 94.600 ? ? ? ? 0.036 ? ? ? ? ? ? ? ? 3.900 ? 3.213 ? ? 0.043 0.022 ? 17 1 0.997 ? ? 4.270 4.890 ? ? ? ? ? ? 693 96.400 ? ? ? ? 0.039 ? ? ? ? ? ? ? ? 4.300 ? 3.806 ? ? 0.045 0.022 ? 18 1 0.993 ? ? 4.890 6.160 ? ? ? ? ? ? 712 98.800 ? ? ? ? 0.036 ? ? ? ? ? ? ? ? 4.400 ? 4.872 ? ? 0.041 0.020 ? 19 1 0.997 ? ? 6.160 50.000 ? ? ? ? ? ? 614 87.000 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 4.200 ? 5.292 ? ? 0.048 0.024 ? 20 1 0.984 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 89.720 _refine.B_iso_mean 39.9298 _refine.B_iso_min 23.220 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6X2Q _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.270 _refine.ls_d_res_low 45.609 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13852 _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.74 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2275 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1850 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4ILY _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.270 _refine_hist.d_res_low 45.609 _refine_hist.number_atoms_solvent 54 _refine_hist.number_atoms_total 1975 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1876 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 45 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # _struct.entry_id 6X2Q _struct.title 'Complex of Gynuella sunshinyii GH46 chitosanase GsCsn46A with chitotetraose' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6X2Q _struct_keywords.text 'SUGAR BINDING PROTEIN' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 4 ? ASN A 21 ? THR A 4 ASN A 21 1 ? 18 HELX_P HELX_P2 AA2 GLY A 51 ? ARG A 64 ? GLY A 51 ARG A 64 1 ? 14 HELX_P HELX_P3 AA3 LEU A 69 ? PRO A 71 ? LEU A 69 PRO A 71 5 ? 3 HELX_P HELX_P4 AA4 PHE A 72 ? GLU A 83 ? PHE A 72 GLU A 83 1 ? 12 HELX_P HELX_P5 AA5 GLY A 92 ? SER A 101 ? GLY A 92 SER A 101 1 ? 10 HELX_P HELX_P6 AA6 ASN A 103 ? TYR A 118 ? ASN A 103 TYR A 118 1 ? 16 HELX_P HELX_P7 AA7 TYR A 118 ? GLY A 130 ? TYR A 118 GLY A 130 1 ? 13 HELX_P HELX_P8 AA8 MET A 133 ? GLY A 148 ? MET A 133 GLY A 148 1 ? 16 HELX_P HELX_P9 AA9 GLY A 155 ? ASN A 168 ? GLY A 155 ASN A 168 1 ? 14 HELX_P HELX_P10 AB1 ILE A 170 ? GLY A 174 ? ILE A 170 GLY A 174 5 ? 5 HELX_P HELX_P11 AB2 ASP A 176 ? HIS A 194 ? ASP A 176 HIS A 194 1 ? 19 HELX_P HELX_P12 AB3 ASN A 197 ? GLU A 199 ? ASN A 197 GLU A 199 5 ? 3 HELX_P HELX_P13 AB4 THR A 200 ? GLU A 206 ? THR A 200 GLU A 206 1 ? 7 HELX_P HELX_P14 AB5 THR A 208 ? GLN A 220 ? THR A 208 GLN A 220 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B GCS . O4 ? ? ? 1_555 B GCS . C1 ? ? B GCS 1 B GCS 2 1_555 ? ? ? ? ? ? ? 1.427 sing ? covale2 covale both ? B GCS . O4 ? ? ? 1_555 B GCS . C1 ? ? B GCS 2 B GCS 3 1_555 ? ? ? ? ? ? ? 1.193 sing ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 88 A . ? GLU 88 A GLY 89 A ? GLY 89 A 1 -7.33 2 PRO 227 A . ? PRO 227 A PRO 228 A ? PRO 228 A 1 -5.70 3 LEU 240 A . ? LEU 240 A PRO 241 A ? PRO 241 A 1 1.25 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 30 ? VAL A 32 ? ALA A 30 VAL A 32 AA1 2 ILE A 39 ? ALA A 41 ? ILE A 39 ALA A 41 AA1 3 PHE A 46 ? THR A 47 ? PHE A 46 THR A 47 AA2 1 ILE A 229 ? ILE A 231 ? ILE A 229 ILE A 231 AA2 2 PHE A 238 ? LEU A 240 ? PHE A 238 LEU A 240 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 31 ? N GLU A 31 O THR A 40 ? O THR A 40 AA1 2 3 N ALA A 41 ? N ALA A 41 O PHE A 46 ? O PHE A 46 AA2 1 2 N ILE A 229 ? N ILE A 229 O LEU A 240 ? O LEU A 240 # _atom_sites.entry_id 6X2Q _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011939 _atom_sites.fract_transf_matrix[1][2] 0.006893 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013786 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008524 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 TRP 97 97 97 TRP TRP A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 MET 123 123 123 MET MET A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 GLN 132 132 132 GLN GLN A . n A 1 133 MET 133 133 133 MET MET A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 TYR 141 141 141 TYR TYR A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 MET 159 159 159 MET MET A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 ASN 168 168 168 ASN ASN A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 PRO 171 171 171 PRO PRO A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 ARG 178 178 178 ARG ARG A . n A 1 179 ARG 179 179 179 ARG ARG A . n A 1 180 TRP 180 180 180 TRP TRP A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 THR 183 183 183 THR THR A . n A 1 184 PHE 184 184 184 PHE PHE A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 GLN 190 190 190 GLN GLN A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 ARG 193 193 193 ARG ARG A . n A 1 194 HIS 194 194 194 HIS HIS A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 ASN 197 197 197 ASN ASN A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 THR 200 200 200 THR THR A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 ASP 202 202 202 ASP ASP A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 TRP 204 204 204 TRP TRP A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 GLU 206 206 206 GLU GLU A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 THR 208 208 208 THR THR A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 ARG 210 210 210 ARG ARG A . n A 1 211 VAL 211 211 211 VAL VAL A . n A 1 212 ASP 212 212 212 ASP ASP A . n A 1 213 SER 213 213 213 SER SER A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 MET 215 215 215 MET MET A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 GLN 220 220 220 GLN GLN A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 ASN 222 222 222 ASN ASN A . n A 1 223 THR 223 223 223 THR THR A . n A 1 224 ASP 224 224 224 ASP ASP A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 HIS 226 226 226 HIS HIS A . n A 1 227 PRO 227 227 227 PRO PRO A . n A 1 228 PRO 228 228 228 PRO PRO A . n A 1 229 ILE 229 229 229 ILE ILE A . n A 1 230 ARG 230 230 230 ARG ARG A . n A 1 231 ILE 231 231 231 ILE ILE A . n A 1 232 SER 232 232 232 SER SER A . n A 1 233 THR 233 233 233 THR THR A . n A 1 234 TRP 234 234 234 TRP TRP A . n A 1 235 GLY 235 235 235 GLY GLY A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 VAL 237 237 237 VAL VAL A . n A 1 238 PHE 238 238 238 PHE PHE A . n A 1 239 ILE 239 239 239 ILE ILE A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 PRO 241 241 241 PRO PRO A . n A 1 242 ILE 242 242 242 ILE ILE A . n A 1 243 ARG 243 243 243 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GCS 1 304 4 GCS GCS A . D 4 HOH 1 401 6 HOH HOH A . D 4 HOH 2 402 4 HOH HOH A . D 4 HOH 3 403 3 HOH HOH A . D 4 HOH 4 404 45 HOH HOH A . D 4 HOH 5 405 27 HOH HOH A . D 4 HOH 6 406 5 HOH HOH A . D 4 HOH 7 407 50 HOH HOH A . D 4 HOH 8 408 46 HOH HOH A . D 4 HOH 9 409 48 HOH HOH A . D 4 HOH 10 410 21 HOH HOH A . D 4 HOH 11 411 22 HOH HOH A . D 4 HOH 12 412 12 HOH HOH A . D 4 HOH 13 413 43 HOH HOH A . D 4 HOH 14 414 19 HOH HOH A . D 4 HOH 15 415 36 HOH HOH A . D 4 HOH 16 416 32 HOH HOH A . D 4 HOH 17 417 42 HOH HOH A . D 4 HOH 18 418 25 HOH HOH A . D 4 HOH 19 419 37 HOH HOH A . D 4 HOH 20 420 2 HOH HOH A . D 4 HOH 21 421 31 HOH HOH A . D 4 HOH 22 422 16 HOH HOH A . D 4 HOH 23 423 53 HOH HOH A . D 4 HOH 24 424 54 HOH HOH A . D 4 HOH 25 425 15 HOH HOH A . D 4 HOH 26 426 24 HOH HOH A . D 4 HOH 27 427 26 HOH HOH A . D 4 HOH 28 428 51 HOH HOH A . D 4 HOH 29 429 7 HOH HOH A . D 4 HOH 30 430 14 HOH HOH A . D 4 HOH 31 431 8 HOH HOH A . D 4 HOH 32 432 41 HOH HOH A . D 4 HOH 33 433 9 HOH HOH A . D 4 HOH 34 434 17 HOH HOH A . D 4 HOH 35 435 18 HOH HOH A . D 4 HOH 36 436 23 HOH HOH A . D 4 HOH 37 437 1 HOH HOH A . D 4 HOH 38 438 11 HOH HOH A . D 4 HOH 39 439 13 HOH HOH A . D 4 HOH 40 440 44 HOH HOH A . D 4 HOH 41 441 28 HOH HOH A . D 4 HOH 42 442 38 HOH HOH A . D 4 HOH 43 443 33 HOH HOH A . D 4 HOH 44 444 34 HOH HOH A . D 4 HOH 45 445 20 HOH HOH A . D 4 HOH 46 446 35 HOH HOH A . D 4 HOH 47 447 29 HOH HOH A . D 4 HOH 48 448 55 HOH HOH A . D 4 HOH 49 449 40 HOH HOH A . D 4 HOH 50 450 52 HOH HOH A . D 4 HOH 51 451 10 HOH HOH A . D 4 HOH 52 452 30 HOH HOH A . D 4 HOH 53 453 39 HOH HOH A . D 4 HOH 54 454 47 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-05-26 2 'Structure model' 1 1 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _pdbx_entry_details.entry_id 6X2Q _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O1 B GCS 1 ? ? C4 A GCS 304 ? ? 1.66 2 1 O4 B GCS 2 ? ? O5 B GCS 3 ? ? 2.05 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 24 ? CG ? A GLU 24 CG 2 1 Y 1 A GLU 24 ? CD ? A GLU 24 CD 3 1 Y 1 A GLU 24 ? OE1 ? A GLU 24 OE1 4 1 Y 1 A GLU 24 ? OE2 ? A GLU 24 OE2 5 1 Y 1 A ASP 66 ? CG ? A ASP 66 CG 6 1 Y 1 A ASP 66 ? OD1 ? A ASP 66 OD1 7 1 Y 1 A ASP 66 ? OD2 ? A ASP 66 OD2 8 1 Y 1 A GLN 78 ? CG ? A GLN 78 CG 9 1 Y 1 A GLN 78 ? CD ? A GLN 78 CD 10 1 Y 1 A GLN 78 ? OE1 ? A GLN 78 OE1 11 1 Y 1 A GLN 78 ? NE2 ? A GLN 78 NE2 12 1 Y 1 A GLU 88 ? CG ? A GLU 88 CG 13 1 Y 1 A GLU 88 ? CD ? A GLU 88 CD 14 1 Y 1 A GLU 88 ? OE1 ? A GLU 88 OE1 15 1 Y 1 A GLU 88 ? OE2 ? A GLU 88 OE2 16 1 Y 1 A GLN 91 ? CG ? A GLN 91 CG 17 1 Y 1 A GLN 91 ? CD ? A GLN 91 CD 18 1 Y 1 A GLN 91 ? OE1 ? A GLN 91 OE1 19 1 Y 1 A GLN 91 ? NE2 ? A GLN 91 NE2 20 1 Y 1 A GLU 124 ? CG ? A GLU 124 CG 21 1 Y 1 A GLU 124 ? CD ? A GLU 124 CD 22 1 Y 1 A GLU 124 ? OE1 ? A GLU 124 OE1 23 1 Y 1 A GLU 124 ? OE2 ? A GLU 124 OE2 24 1 N 1 A GCS 304 ? O4 ? C GCS 1 O4 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id ALA _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id ALA _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GCS C1 C N R 74 GCS C2 C N R 75 GCS C3 C N R 76 GCS C4 C N S 77 GCS C5 C N R 78 GCS C6 C N N 79 GCS N2 N N N 80 GCS O1 O N N 81 GCS O3 O N N 82 GCS O4 O N N 83 GCS O5 O N N 84 GCS O6 O N N 85 GCS H1 H N N 86 GCS H2 H N N 87 GCS H3 H N N 88 GCS H4 H N N 89 GCS H5 H N N 90 GCS H61 H N N 91 GCS H62 H N N 92 GCS HN21 H N N 93 GCS HN22 H N N 94 GCS HO1 H N N 95 GCS HO3 H N N 96 GCS HO4 H N N 97 GCS HO6 H N N 98 GLN N N N N 99 GLN CA C N S 100 GLN C C N N 101 GLN O O N N 102 GLN CB C N N 103 GLN CG C N N 104 GLN CD C N N 105 GLN OE1 O N N 106 GLN NE2 N N N 107 GLN OXT O N N 108 GLN H H N N 109 GLN H2 H N N 110 GLN HA H N N 111 GLN HB2 H N N 112 GLN HB3 H N N 113 GLN HG2 H N N 114 GLN HG3 H N N 115 GLN HE21 H N N 116 GLN HE22 H N N 117 GLN HXT H N N 118 GLU N N N N 119 GLU CA C N S 120 GLU C C N N 121 GLU O O N N 122 GLU CB C N N 123 GLU CG C N N 124 GLU CD C N N 125 GLU OE1 O N N 126 GLU OE2 O N N 127 GLU OXT O N N 128 GLU H H N N 129 GLU H2 H N N 130 GLU HA H N N 131 GLU HB2 H N N 132 GLU HB3 H N N 133 GLU HG2 H N N 134 GLU HG3 H N N 135 GLU HE2 H N N 136 GLU HXT H N N 137 GLY N N N N 138 GLY CA C N N 139 GLY C C N N 140 GLY O O N N 141 GLY OXT O N N 142 GLY H H N N 143 GLY H2 H N N 144 GLY HA2 H N N 145 GLY HA3 H N N 146 GLY HXT H N N 147 HIS N N N N 148 HIS CA C N S 149 HIS C C N N 150 HIS O O N N 151 HIS CB C N N 152 HIS CG C Y N 153 HIS ND1 N Y N 154 HIS CD2 C Y N 155 HIS CE1 C Y N 156 HIS NE2 N Y N 157 HIS OXT O N N 158 HIS H H N N 159 HIS H2 H N N 160 HIS HA H N N 161 HIS HB2 H N N 162 HIS HB3 H N N 163 HIS HD1 H N N 164 HIS HD2 H N N 165 HIS HE1 H N N 166 HIS HE2 H N N 167 HIS HXT H N N 168 HOH O O N N 169 HOH H1 H N N 170 HOH H2 H N N 171 ILE N N N N 172 ILE CA C N S 173 ILE C C N N 174 ILE O O N N 175 ILE CB C N S 176 ILE CG1 C N N 177 ILE CG2 C N N 178 ILE CD1 C N N 179 ILE OXT O N N 180 ILE H H N N 181 ILE H2 H N N 182 ILE HA H N N 183 ILE HB H N N 184 ILE HG12 H N N 185 ILE HG13 H N N 186 ILE HG21 H N N 187 ILE HG22 H N N 188 ILE HG23 H N N 189 ILE HD11 H N N 190 ILE HD12 H N N 191 ILE HD13 H N N 192 ILE HXT H N N 193 LEU N N N N 194 LEU CA C N S 195 LEU C C N N 196 LEU O O N N 197 LEU CB C N N 198 LEU CG C N N 199 LEU CD1 C N N 200 LEU CD2 C N N 201 LEU OXT O N N 202 LEU H H N N 203 LEU H2 H N N 204 LEU HA H N N 205 LEU HB2 H N N 206 LEU HB3 H N N 207 LEU HG H N N 208 LEU HD11 H N N 209 LEU HD12 H N N 210 LEU HD13 H N N 211 LEU HD21 H N N 212 LEU HD22 H N N 213 LEU HD23 H N N 214 LEU HXT H N N 215 LYS N N N N 216 LYS CA C N S 217 LYS C C N N 218 LYS O O N N 219 LYS CB C N N 220 LYS CG C N N 221 LYS CD C N N 222 LYS CE C N N 223 LYS NZ N N N 224 LYS OXT O N N 225 LYS H H N N 226 LYS H2 H N N 227 LYS HA H N N 228 LYS HB2 H N N 229 LYS HB3 H N N 230 LYS HG2 H N N 231 LYS HG3 H N N 232 LYS HD2 H N N 233 LYS HD3 H N N 234 LYS HE2 H N N 235 LYS HE3 H N N 236 LYS HZ1 H N N 237 LYS HZ2 H N N 238 LYS HZ3 H N N 239 LYS HXT H N N 240 MET N N N N 241 MET CA C N S 242 MET C C N N 243 MET O O N N 244 MET CB C N N 245 MET CG C N N 246 MET SD S N N 247 MET CE C N N 248 MET OXT O N N 249 MET H H N N 250 MET H2 H N N 251 MET HA H N N 252 MET HB2 H N N 253 MET HB3 H N N 254 MET HG2 H N N 255 MET HG3 H N N 256 MET HE1 H N N 257 MET HE2 H N N 258 MET HE3 H N N 259 MET HXT H N N 260 PHE N N N N 261 PHE CA C N S 262 PHE C C N N 263 PHE O O N N 264 PHE CB C N N 265 PHE CG C Y N 266 PHE CD1 C Y N 267 PHE CD2 C Y N 268 PHE CE1 C Y N 269 PHE CE2 C Y N 270 PHE CZ C Y N 271 PHE OXT O N N 272 PHE H H N N 273 PHE H2 H N N 274 PHE HA H N N 275 PHE HB2 H N N 276 PHE HB3 H N N 277 PHE HD1 H N N 278 PHE HD2 H N N 279 PHE HE1 H N N 280 PHE HE2 H N N 281 PHE HZ H N N 282 PHE HXT H N N 283 PRO N N N N 284 PRO CA C N S 285 PRO C C N N 286 PRO O O N N 287 PRO CB C N N 288 PRO CG C N N 289 PRO CD C N N 290 PRO OXT O N N 291 PRO H H N N 292 PRO HA H N N 293 PRO HB2 H N N 294 PRO HB3 H N N 295 PRO HG2 H N N 296 PRO HG3 H N N 297 PRO HD2 H N N 298 PRO HD3 H N N 299 PRO HXT H N N 300 SER N N N N 301 SER CA C N S 302 SER C C N N 303 SER O O N N 304 SER CB C N N 305 SER OG O N N 306 SER OXT O N N 307 SER H H N N 308 SER H2 H N N 309 SER HA H N N 310 SER HB2 H N N 311 SER HB3 H N N 312 SER HG H N N 313 SER HXT H N N 314 THR N N N N 315 THR CA C N S 316 THR C C N N 317 THR O O N N 318 THR CB C N R 319 THR OG1 O N N 320 THR CG2 C N N 321 THR OXT O N N 322 THR H H N N 323 THR H2 H N N 324 THR HA H N N 325 THR HB H N N 326 THR HG1 H N N 327 THR HG21 H N N 328 THR HG22 H N N 329 THR HG23 H N N 330 THR HXT H N N 331 TRP N N N N 332 TRP CA C N S 333 TRP C C N N 334 TRP O O N N 335 TRP CB C N N 336 TRP CG C Y N 337 TRP CD1 C Y N 338 TRP CD2 C Y N 339 TRP NE1 N Y N 340 TRP CE2 C Y N 341 TRP CE3 C Y N 342 TRP CZ2 C Y N 343 TRP CZ3 C Y N 344 TRP CH2 C Y N 345 TRP OXT O N N 346 TRP H H N N 347 TRP H2 H N N 348 TRP HA H N N 349 TRP HB2 H N N 350 TRP HB3 H N N 351 TRP HD1 H N N 352 TRP HE1 H N N 353 TRP HE3 H N N 354 TRP HZ2 H N N 355 TRP HZ3 H N N 356 TRP HH2 H N N 357 TRP HXT H N N 358 TYR N N N N 359 TYR CA C N S 360 TYR C C N N 361 TYR O O N N 362 TYR CB C N N 363 TYR CG C Y N 364 TYR CD1 C Y N 365 TYR CD2 C Y N 366 TYR CE1 C Y N 367 TYR CE2 C Y N 368 TYR CZ C Y N 369 TYR OH O N N 370 TYR OXT O N N 371 TYR H H N N 372 TYR H2 H N N 373 TYR HA H N N 374 TYR HB2 H N N 375 TYR HB3 H N N 376 TYR HD1 H N N 377 TYR HD2 H N N 378 TYR HE1 H N N 379 TYR HE2 H N N 380 TYR HH H N N 381 TYR HXT H N N 382 VAL N N N N 383 VAL CA C N S 384 VAL C C N N 385 VAL O O N N 386 VAL CB C N N 387 VAL CG1 C N N 388 VAL CG2 C N N 389 VAL OXT O N N 390 VAL H H N N 391 VAL H2 H N N 392 VAL HA H N N 393 VAL HB H N N 394 VAL HG11 H N N 395 VAL HG12 H N N 396 VAL HG13 H N N 397 VAL HG21 H N N 398 VAL HG22 H N N 399 VAL HG23 H N N 400 VAL HXT H N N 401 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GCS C1 C2 sing N N 70 GCS C1 O1 sing N N 71 GCS C1 O5 sing N N 72 GCS C1 H1 sing N N 73 GCS C2 C3 sing N N 74 GCS C2 N2 sing N N 75 GCS C2 H2 sing N N 76 GCS C3 C4 sing N N 77 GCS C3 O3 sing N N 78 GCS C3 H3 sing N N 79 GCS C4 C5 sing N N 80 GCS C4 O4 sing N N 81 GCS C4 H4 sing N N 82 GCS C5 C6 sing N N 83 GCS C5 O5 sing N N 84 GCS C5 H5 sing N N 85 GCS C6 O6 sing N N 86 GCS C6 H61 sing N N 87 GCS C6 H62 sing N N 88 GCS N2 HN21 sing N N 89 GCS N2 HN22 sing N N 90 GCS O1 HO1 sing N N 91 GCS O3 HO3 sing N N 92 GCS O4 HO4 sing N N 93 GCS O6 HO6 sing N N 94 GLN N CA sing N N 95 GLN N H sing N N 96 GLN N H2 sing N N 97 GLN CA C sing N N 98 GLN CA CB sing N N 99 GLN CA HA sing N N 100 GLN C O doub N N 101 GLN C OXT sing N N 102 GLN CB CG sing N N 103 GLN CB HB2 sing N N 104 GLN CB HB3 sing N N 105 GLN CG CD sing N N 106 GLN CG HG2 sing N N 107 GLN CG HG3 sing N N 108 GLN CD OE1 doub N N 109 GLN CD NE2 sing N N 110 GLN NE2 HE21 sing N N 111 GLN NE2 HE22 sing N N 112 GLN OXT HXT sing N N 113 GLU N CA sing N N 114 GLU N H sing N N 115 GLU N H2 sing N N 116 GLU CA C sing N N 117 GLU CA CB sing N N 118 GLU CA HA sing N N 119 GLU C O doub N N 120 GLU C OXT sing N N 121 GLU CB CG sing N N 122 GLU CB HB2 sing N N 123 GLU CB HB3 sing N N 124 GLU CG CD sing N N 125 GLU CG HG2 sing N N 126 GLU CG HG3 sing N N 127 GLU CD OE1 doub N N 128 GLU CD OE2 sing N N 129 GLU OE2 HE2 sing N N 130 GLU OXT HXT sing N N 131 GLY N CA sing N N 132 GLY N H sing N N 133 GLY N H2 sing N N 134 GLY CA C sing N N 135 GLY CA HA2 sing N N 136 GLY CA HA3 sing N N 137 GLY C O doub N N 138 GLY C OXT sing N N 139 GLY OXT HXT sing N N 140 HIS N CA sing N N 141 HIS N H sing N N 142 HIS N H2 sing N N 143 HIS CA C sing N N 144 HIS CA CB sing N N 145 HIS CA HA sing N N 146 HIS C O doub N N 147 HIS C OXT sing N N 148 HIS CB CG sing N N 149 HIS CB HB2 sing N N 150 HIS CB HB3 sing N N 151 HIS CG ND1 sing Y N 152 HIS CG CD2 doub Y N 153 HIS ND1 CE1 doub Y N 154 HIS ND1 HD1 sing N N 155 HIS CD2 NE2 sing Y N 156 HIS CD2 HD2 sing N N 157 HIS CE1 NE2 sing Y N 158 HIS CE1 HE1 sing N N 159 HIS NE2 HE2 sing N N 160 HIS OXT HXT sing N N 161 HOH O H1 sing N N 162 HOH O H2 sing N N 163 ILE N CA sing N N 164 ILE N H sing N N 165 ILE N H2 sing N N 166 ILE CA C sing N N 167 ILE CA CB sing N N 168 ILE CA HA sing N N 169 ILE C O doub N N 170 ILE C OXT sing N N 171 ILE CB CG1 sing N N 172 ILE CB CG2 sing N N 173 ILE CB HB sing N N 174 ILE CG1 CD1 sing N N 175 ILE CG1 HG12 sing N N 176 ILE CG1 HG13 sing N N 177 ILE CG2 HG21 sing N N 178 ILE CG2 HG22 sing N N 179 ILE CG2 HG23 sing N N 180 ILE CD1 HD11 sing N N 181 ILE CD1 HD12 sing N N 182 ILE CD1 HD13 sing N N 183 ILE OXT HXT sing N N 184 LEU N CA sing N N 185 LEU N H sing N N 186 LEU N H2 sing N N 187 LEU CA C sing N N 188 LEU CA CB sing N N 189 LEU CA HA sing N N 190 LEU C O doub N N 191 LEU C OXT sing N N 192 LEU CB CG sing N N 193 LEU CB HB2 sing N N 194 LEU CB HB3 sing N N 195 LEU CG CD1 sing N N 196 LEU CG CD2 sing N N 197 LEU CG HG sing N N 198 LEU CD1 HD11 sing N N 199 LEU CD1 HD12 sing N N 200 LEU CD1 HD13 sing N N 201 LEU CD2 HD21 sing N N 202 LEU CD2 HD22 sing N N 203 LEU CD2 HD23 sing N N 204 LEU OXT HXT sing N N 205 LYS N CA sing N N 206 LYS N H sing N N 207 LYS N H2 sing N N 208 LYS CA C sing N N 209 LYS CA CB sing N N 210 LYS CA HA sing N N 211 LYS C O doub N N 212 LYS C OXT sing N N 213 LYS CB CG sing N N 214 LYS CB HB2 sing N N 215 LYS CB HB3 sing N N 216 LYS CG CD sing N N 217 LYS CG HG2 sing N N 218 LYS CG HG3 sing N N 219 LYS CD CE sing N N 220 LYS CD HD2 sing N N 221 LYS CD HD3 sing N N 222 LYS CE NZ sing N N 223 LYS CE HE2 sing N N 224 LYS CE HE3 sing N N 225 LYS NZ HZ1 sing N N 226 LYS NZ HZ2 sing N N 227 LYS NZ HZ3 sing N N 228 LYS OXT HXT sing N N 229 MET N CA sing N N 230 MET N H sing N N 231 MET N H2 sing N N 232 MET CA C sing N N 233 MET CA CB sing N N 234 MET CA HA sing N N 235 MET C O doub N N 236 MET C OXT sing N N 237 MET CB CG sing N N 238 MET CB HB2 sing N N 239 MET CB HB3 sing N N 240 MET CG SD sing N N 241 MET CG HG2 sing N N 242 MET CG HG3 sing N N 243 MET SD CE sing N N 244 MET CE HE1 sing N N 245 MET CE HE2 sing N N 246 MET CE HE3 sing N N 247 MET OXT HXT sing N N 248 PHE N CA sing N N 249 PHE N H sing N N 250 PHE N H2 sing N N 251 PHE CA C sing N N 252 PHE CA CB sing N N 253 PHE CA HA sing N N 254 PHE C O doub N N 255 PHE C OXT sing N N 256 PHE CB CG sing N N 257 PHE CB HB2 sing N N 258 PHE CB HB3 sing N N 259 PHE CG CD1 doub Y N 260 PHE CG CD2 sing Y N 261 PHE CD1 CE1 sing Y N 262 PHE CD1 HD1 sing N N 263 PHE CD2 CE2 doub Y N 264 PHE CD2 HD2 sing N N 265 PHE CE1 CZ doub Y N 266 PHE CE1 HE1 sing N N 267 PHE CE2 CZ sing Y N 268 PHE CE2 HE2 sing N N 269 PHE CZ HZ sing N N 270 PHE OXT HXT sing N N 271 PRO N CA sing N N 272 PRO N CD sing N N 273 PRO N H sing N N 274 PRO CA C sing N N 275 PRO CA CB sing N N 276 PRO CA HA sing N N 277 PRO C O doub N N 278 PRO C OXT sing N N 279 PRO CB CG sing N N 280 PRO CB HB2 sing N N 281 PRO CB HB3 sing N N 282 PRO CG CD sing N N 283 PRO CG HG2 sing N N 284 PRO CG HG3 sing N N 285 PRO CD HD2 sing N N 286 PRO CD HD3 sing N N 287 PRO OXT HXT sing N N 288 SER N CA sing N N 289 SER N H sing N N 290 SER N H2 sing N N 291 SER CA C sing N N 292 SER CA CB sing N N 293 SER CA HA sing N N 294 SER C O doub N N 295 SER C OXT sing N N 296 SER CB OG sing N N 297 SER CB HB2 sing N N 298 SER CB HB3 sing N N 299 SER OG HG sing N N 300 SER OXT HXT sing N N 301 THR N CA sing N N 302 THR N H sing N N 303 THR N H2 sing N N 304 THR CA C sing N N 305 THR CA CB sing N N 306 THR CA HA sing N N 307 THR C O doub N N 308 THR C OXT sing N N 309 THR CB OG1 sing N N 310 THR CB CG2 sing N N 311 THR CB HB sing N N 312 THR OG1 HG1 sing N N 313 THR CG2 HG21 sing N N 314 THR CG2 HG22 sing N N 315 THR CG2 HG23 sing N N 316 THR OXT HXT sing N N 317 TRP N CA sing N N 318 TRP N H sing N N 319 TRP N H2 sing N N 320 TRP CA C sing N N 321 TRP CA CB sing N N 322 TRP CA HA sing N N 323 TRP C O doub N N 324 TRP C OXT sing N N 325 TRP CB CG sing N N 326 TRP CB HB2 sing N N 327 TRP CB HB3 sing N N 328 TRP CG CD1 doub Y N 329 TRP CG CD2 sing Y N 330 TRP CD1 NE1 sing Y N 331 TRP CD1 HD1 sing N N 332 TRP CD2 CE2 doub Y N 333 TRP CD2 CE3 sing Y N 334 TRP NE1 CE2 sing Y N 335 TRP NE1 HE1 sing N N 336 TRP CE2 CZ2 sing Y N 337 TRP CE3 CZ3 doub Y N 338 TRP CE3 HE3 sing N N 339 TRP CZ2 CH2 doub Y N 340 TRP CZ2 HZ2 sing N N 341 TRP CZ3 CH2 sing Y N 342 TRP CZ3 HZ3 sing N N 343 TRP CH2 HH2 sing N N 344 TRP OXT HXT sing N N 345 TYR N CA sing N N 346 TYR N H sing N N 347 TYR N H2 sing N N 348 TYR CA C sing N N 349 TYR CA CB sing N N 350 TYR CA HA sing N N 351 TYR C O doub N N 352 TYR C OXT sing N N 353 TYR CB CG sing N N 354 TYR CB HB2 sing N N 355 TYR CB HB3 sing N N 356 TYR CG CD1 doub Y N 357 TYR CG CD2 sing Y N 358 TYR CD1 CE1 sing Y N 359 TYR CD1 HD1 sing N N 360 TYR CD2 CE2 doub Y N 361 TYR CD2 HD2 sing N N 362 TYR CE1 CZ doub Y N 363 TYR CE1 HE1 sing N N 364 TYR CE2 CZ sing Y N 365 TYR CE2 HE2 sing N N 366 TYR CZ OH sing N N 367 TYR OH HH sing N N 368 TYR OXT HXT sing N N 369 VAL N CA sing N N 370 VAL N H sing N N 371 VAL N H2 sing N N 372 VAL CA C sing N N 373 VAL CA CB sing N N 374 VAL CA HA sing N N 375 VAL C O doub N N 376 VAL C OXT sing N N 377 VAL CB CG1 sing N N 378 VAL CB CG2 sing N N 379 VAL CB HB sing N N 380 VAL CG1 HG11 sing N N 381 VAL CG1 HG12 sing N N 382 VAL CG1 HG13 sing N N 383 VAL CG2 HG21 sing N N 384 VAL CG2 HG22 sing N N 385 VAL CG2 HG23 sing N N 386 VAL OXT HXT sing N N 387 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31701537 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 GCS 1 B GCS 1 B GCS 3 n B 2 GCS 2 B GCS 2 B GCS 2 n B 2 GCS 3 B GCS 3 B GCS 1 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier GCS 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNb GCS 'COMMON NAME' GMML 1.0 b-D-glucopyranosamine GCS 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpN GCS 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcN # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpNb1-4DGlcpNb1-4DGlcpNb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,3,2/[a2122h-1b_1-5_2*N]/1-1-1/a4-b1_b4-c1' WURCS PDB2Glycan 1.1.0 3 2 '[][b-D-GlcpN]{[(4+1)][b-D-GlcpN]{[(4+1)][b-D-GlcpN]{}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 GCS C1 O1 1 GCS O4 HO4 sing ? 2 2 3 GCS C1 O1 2 GCS O4 HO4 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 GCS 1 n 2 GCS 2 n 2 GCS 3 n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id GCS _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id GCS _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 2-amino-2-deoxy-beta-D-glucopyranose GCS 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4ILY _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details ? #