data_6XX2 # _entry.id 6XX2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6XX2 pdb_00006xx2 10.2210/pdb6xx2/pdb WWPDB D_1292106477 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-22 2 'Structure model' 1 1 2020-06-03 3 'Structure model' 2 0 2020-07-29 4 'Structure model' 2 1 2024-01-24 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Author supporting evidence' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Non-polymer description' 7 3 'Structure model' 'Structure summary' 8 4 'Structure model' 'Data collection' 9 4 'Structure model' 'Database references' 10 4 'Structure model' 'Refinement description' 11 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' atom_site 3 3 'Structure model' atom_site_anisotrop 4 3 'Structure model' chem_comp 5 3 'Structure model' entity 6 3 'Structure model' entity_name_com 7 3 'Structure model' pdbx_branch_scheme 8 3 'Structure model' pdbx_chem_comp_identifier 9 3 'Structure model' pdbx_entity_branch 10 3 'Structure model' pdbx_entity_branch_descriptor 11 3 'Structure model' pdbx_entity_branch_link 12 3 'Structure model' pdbx_entity_branch_list 13 3 'Structure model' pdbx_entity_instance_feature 14 3 'Structure model' pdbx_entity_nonpoly 15 3 'Structure model' pdbx_molecule_features 16 3 'Structure model' pdbx_nonpoly_scheme 17 3 'Structure model' pdbx_struct_conn_angle 18 3 'Structure model' struct_conn 19 3 'Structure model' struct_conn_type 20 3 'Structure model' struct_site 21 3 'Structure model' struct_site_gen 22 4 'Structure model' chem_comp 23 4 'Structure model' chem_comp_atom 24 4 'Structure model' chem_comp_bond 25 4 'Structure model' database_2 26 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_atom_site.B_iso_or_equiv' 5 3 'Structure model' '_atom_site.Cartn_x' 6 3 'Structure model' '_atom_site.Cartn_y' 7 3 'Structure model' '_atom_site.Cartn_z' 8 3 'Structure model' '_atom_site.auth_asym_id' 9 3 'Structure model' '_atom_site.auth_atom_id' 10 3 'Structure model' '_atom_site.auth_comp_id' 11 3 'Structure model' '_atom_site.auth_seq_id' 12 3 'Structure model' '_atom_site.label_asym_id' 13 3 'Structure model' '_atom_site.label_atom_id' 14 3 'Structure model' '_atom_site.label_comp_id' 15 3 'Structure model' '_atom_site.label_entity_id' 16 3 'Structure model' '_atom_site.occupancy' 17 3 'Structure model' '_atom_site.type_symbol' 18 3 'Structure model' '_atom_site_anisotrop.U[1][1]' 19 3 'Structure model' '_atom_site_anisotrop.U[1][2]' 20 3 'Structure model' '_atom_site_anisotrop.U[1][3]' 21 3 'Structure model' '_atom_site_anisotrop.U[2][2]' 22 3 'Structure model' '_atom_site_anisotrop.U[2][3]' 23 3 'Structure model' '_atom_site_anisotrop.U[3][3]' 24 3 'Structure model' '_atom_site_anisotrop.id' 25 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_asym_id' 26 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_atom_id' 27 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_comp_id' 28 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_seq_id' 29 3 'Structure model' '_atom_site_anisotrop.pdbx_label_asym_id' 30 3 'Structure model' '_atom_site_anisotrop.pdbx_label_atom_id' 31 3 'Structure model' '_atom_site_anisotrop.pdbx_label_comp_id' 32 3 'Structure model' '_atom_site_anisotrop.type_symbol' 33 3 'Structure model' '_chem_comp.formula' 34 3 'Structure model' '_chem_comp.formula_weight' 35 3 'Structure model' '_chem_comp.id' 36 3 'Structure model' '_chem_comp.mon_nstd_flag' 37 3 'Structure model' '_chem_comp.name' 38 3 'Structure model' '_chem_comp.pdbx_synonyms' 39 3 'Structure model' '_chem_comp.type' 40 3 'Structure model' '_entity.formula_weight' 41 3 'Structure model' '_entity.pdbx_description' 42 3 'Structure model' '_entity.src_method' 43 3 'Structure model' '_entity.type' 44 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 45 4 'Structure model' '_chem_comp.pdbx_synonyms' 46 4 'Structure model' '_database_2.pdbx_DOI' 47 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6XX2 _pdbx_database_status.recvd_initial_deposition_date 2020-01-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Camara-Artigas, A.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0003-2197-726X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GW _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Inorg.Chem. _citation.journal_id_ASTM JJBCFA _citation.journal_id_CSD ? _citation.journal_id_ISSN 1432-1327 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 25 _citation.language ? _citation.page_first 621 _citation.page_last 634 _citation.title 'The effect of an engineered ATCUN motif on the structure and biophysical properties of the SH3 domain of c-Src tyrosine kinase.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1007/s00775-020-01785-0 _citation.pdbx_database_id_PubMed 32279137 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Plaza-Garrido, M.' 1 ? primary 'Salinas-Garcia, M.C.' 2 ? primary 'Martinez, J.C.' 3 ? primary 'Camara-Artigas, A.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Proto-oncogene tyrosine-protein kinase Src' 6925.596 1 2.7.10.2 'H122R Q128K' ? ? 2 branched man ;Cyclic 2,3-di-O-methyl-alpha-D-glucopyranose-(1-4)-2-O-methyl-alpha-D-glucopyranose-(1-4)-2,6-di-O-methyl-alpha-D-glucopyranose-(1-4)-2-O-methyl-alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose-(1-4)-3-O-methyl-alpha-D-glucopyranose ; 1251.185 1 ? ? ? ? 3 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 4 water nat water 18.015 40 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Proto-oncogene c-Src,pp60c-src,p60-Src' 2 methyl-beta-cyclodextrin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLARSLTTGKTGYIPSNYVAPSD _entity_poly.pdbx_seq_one_letter_code_can GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLARSLTTGKTGYIPSNYVAPSD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'COPPER (II) ION' CU 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 THR n 1 6 PHE n 1 7 VAL n 1 8 ALA n 1 9 LEU n 1 10 TYR n 1 11 ASP n 1 12 TYR n 1 13 GLU n 1 14 SER n 1 15 ARG n 1 16 THR n 1 17 GLU n 1 18 THR n 1 19 ASP n 1 20 LEU n 1 21 SER n 1 22 PHE n 1 23 LYS n 1 24 LYS n 1 25 GLY n 1 26 GLU n 1 27 ARG n 1 28 LEU n 1 29 GLN n 1 30 ILE n 1 31 VAL n 1 32 ASN n 1 33 ASN n 1 34 THR n 1 35 GLU n 1 36 GLY n 1 37 ASP n 1 38 TRP n 1 39 TRP n 1 40 LEU n 1 41 ALA n 1 42 ARG n 1 43 SER n 1 44 LEU n 1 45 THR n 1 46 THR n 1 47 GLY n 1 48 LYS n 1 49 THR n 1 50 GLY n 1 51 TYR n 1 52 ILE n 1 53 PRO n 1 54 SER n 1 55 ASN n 1 56 TYR n 1 57 VAL n 1 58 ALA n 1 59 PRO n 1 60 SER n 1 61 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 61 _entity_src_gen.gene_src_common_name Chicken _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SRC _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gallus gallus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pHTP1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # _pdbx_entity_branch_descriptor.ordinal 1 _pdbx_entity_branch_descriptor.entity_id 2 _pdbx_entity_branch_descriptor.descriptor ;WURCS=2.0/5,7,7/[a2122h-1a_1-5_2*OC_3*OC][a2122h-1a_1-5_3*OC][a2122h-1a_1-5][a2122h-1a_1-5_2*OC][a2122h-1a_1-5_2*OC_6*OC]/1-2-3-3-4-5-4/a1-g4_a4-b1_b4-c1_c4-d1_d4-e1_e4-f1_f4-g1 ; _pdbx_entity_branch_descriptor.type WURCS _pdbx_entity_branch_descriptor.program PDB2Glycan _pdbx_entity_branch_descriptor.program_version 1.1.0 # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 1 ZB1 C1 O1 7 ZB0 O4 HO4 sing ? 2 2 2 GLC C1 O1 1 ZB1 O4 HO4 sing ? 3 2 3 GLC C1 O1 2 GLC O4 HO4 sing ? 4 2 4 ZB2 C1 O1 3 GLC O4 HO4 sing ? 5 2 5 ZB3 C1 O1 4 ZB2 O4 HO4 sing ? 6 2 6 ZB2 C1 O1 5 ZB3 O4 HO4 sing ? 7 2 7 ZB0 C1 O1 6 ZB2 O4 HO4 sing ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose 'alpha-D-glucose; D-glucose; glucose' 'C6 H12 O6' 180.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZB0 'D-saccharide, alpha linking' n 2,3-di-O-methyl-alpha-D-glucopyranose ? 'C8 H16 O6' 208.209 ZB1 'D-saccharide, alpha linking' n 3-O-methyl-alpha-D-glucopyranose ? 'C7 H14 O6' 194.182 ZB2 'D-saccharide, alpha linking' n 2-O-methyl-alpha-D-glucopyranose ? 'C7 H14 O6' 194.182 ZB3 'D-saccharide, alpha linking' n 2,6-di-O-methyl-alpha-D-glucopyranose ? 'C8 H16 O6' 208.209 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier GLC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpa GLC 'COMMON NAME' GMML 1.0 a-D-glucopyranose GLC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Glcp GLC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Glc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 81 ? ? ? A . n A 1 2 SER 2 82 82 SER SER A . n A 1 3 HIS 3 83 83 HIS HIS A . n A 1 4 MET 4 84 84 MET MET A . n A 1 5 THR 5 85 85 THR THR A . n A 1 6 PHE 6 86 86 PHE PHE A . n A 1 7 VAL 7 87 87 VAL VAL A . n A 1 8 ALA 8 88 88 ALA ALA A . n A 1 9 LEU 9 89 89 LEU LEU A . n A 1 10 TYR 10 90 90 TYR TYR A . n A 1 11 ASP 11 91 91 ASP ASP A . n A 1 12 TYR 12 92 92 TYR TYR A . n A 1 13 GLU 13 93 93 GLU GLU A . n A 1 14 SER 14 94 94 SER SER A . n A 1 15 ARG 15 95 95 ARG ARG A . n A 1 16 THR 16 96 96 THR THR A . n A 1 17 GLU 17 97 97 GLU GLU A . n A 1 18 THR 18 98 98 THR THR A . n A 1 19 ASP 19 99 99 ASP ASP A . n A 1 20 LEU 20 100 100 LEU LEU A . n A 1 21 SER 21 101 101 SER SER A . n A 1 22 PHE 22 102 102 PHE PHE A . n A 1 23 LYS 23 103 103 LYS LYS A . n A 1 24 LYS 24 104 104 LYS LYS A . n A 1 25 GLY 25 105 105 GLY GLY A . n A 1 26 GLU 26 106 106 GLU GLU A . n A 1 27 ARG 27 107 107 ARG ARG A . n A 1 28 LEU 28 108 108 LEU LEU A . n A 1 29 GLN 29 109 109 GLN GLN A . n A 1 30 ILE 30 110 110 ILE ILE A . n A 1 31 VAL 31 111 111 VAL VAL A . n A 1 32 ASN 32 112 ? ? ? A . n A 1 33 ASN 33 113 ? ? ? A . n A 1 34 THR 34 114 ? ? ? A . n A 1 35 GLU 35 115 ? ? ? A . n A 1 36 GLY 36 116 116 GLY GLY A . n A 1 37 ASP 37 117 117 ASP ASP A . n A 1 38 TRP 38 118 118 TRP TRP A . n A 1 39 TRP 39 119 119 TRP TRP A . n A 1 40 LEU 40 120 120 LEU LEU A . n A 1 41 ALA 41 121 121 ALA ALA A . n A 1 42 ARG 42 122 122 ARG ARG A . n A 1 43 SER 43 123 123 SER SER A . n A 1 44 LEU 44 124 124 LEU LEU A . n A 1 45 THR 45 125 125 THR THR A . n A 1 46 THR 46 126 126 THR THR A . n A 1 47 GLY 47 127 127 GLY GLY A . n A 1 48 LYS 48 128 128 LYS LYS A . n A 1 49 THR 49 129 129 THR THR A . n A 1 50 GLY 50 130 130 GLY GLY A . n A 1 51 TYR 51 131 131 TYR TYR A . n A 1 52 ILE 52 132 132 ILE ILE A . n A 1 53 PRO 53 133 133 PRO PRO A . n A 1 54 SER 54 134 134 SER SER A . n A 1 55 ASN 55 135 135 ASN ASN A . n A 1 56 TYR 56 136 136 TYR TYR A . n A 1 57 VAL 57 137 137 VAL VAL A . n A 1 58 ALA 58 138 138 ALA ALA A . n A 1 59 PRO 59 139 139 PRO PRO A . n A 1 60 SER 60 140 140 SER SER A . n A 1 61 ASP 61 141 141 ASP ASP A . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 ZB1 1 B ZB1 1 B QKH 1 n B 2 GLC 2 B GLC 2 B QKH 1 n B 2 GLC 3 B GLC 3 B QKH 1 n B 2 ZB2 4 B ZB2 4 B QKH 1 n B 2 ZB3 5 B ZB3 5 B QKH 1 n B 2 ZB2 6 B ZB2 6 B QKH 1 n B 2 ZB0 7 B ZB0 7 B QKH 1 n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CU 1 201 1 CU CU A . D 4 HOH 1 301 10 HOH HOH A . D 4 HOH 2 302 12 HOH HOH A . D 4 HOH 3 303 40 HOH HOH A . D 4 HOH 4 304 41 HOH HOH A . D 4 HOH 5 305 28 HOH HOH A . D 4 HOH 6 306 5 HOH HOH A . D 4 HOH 7 307 9 HOH HOH A . D 4 HOH 8 308 21 HOH HOH A . D 4 HOH 9 309 33 HOH HOH A . D 4 HOH 10 310 3 HOH HOH A . D 4 HOH 11 311 1 HOH HOH A . D 4 HOH 12 312 25 HOH HOH A . D 4 HOH 13 313 11 HOH HOH A . D 4 HOH 14 314 16 HOH HOH A . D 4 HOH 15 315 6 HOH HOH A . D 4 HOH 16 316 2 HOH HOH A . D 4 HOH 17 317 19 HOH HOH A . D 4 HOH 18 318 13 HOH HOH A . D 4 HOH 19 319 7 HOH HOH A . D 4 HOH 20 320 30 HOH HOH A . D 4 HOH 21 321 29 HOH HOH A . D 4 HOH 22 322 15 HOH HOH A . D 4 HOH 23 323 37 HOH HOH A . D 4 HOH 24 324 39 HOH HOH A . D 4 HOH 25 325 26 HOH HOH A . D 4 HOH 26 326 36 HOH HOH A . D 4 HOH 27 327 34 HOH HOH A . D 4 HOH 28 328 35 HOH HOH A . D 4 HOH 29 329 14 HOH HOH A . D 4 HOH 30 330 17 HOH HOH A . D 4 HOH 31 331 4 HOH HOH A . D 4 HOH 32 332 32 HOH HOH A . D 4 HOH 33 333 8 HOH HOH A . D 4 HOH 34 334 24 HOH HOH A . D 4 HOH 35 335 27 HOH HOH A . D 4 HOH 36 336 23 HOH HOH A . D 4 HOH 37 337 18 HOH HOH A . D 4 HOH 38 338 31 HOH HOH A . D 4 HOH 39 339 22 HOH HOH A . D 4 HOH 40 340 38 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 82 ? OG ? A SER 2 OG 2 1 Y 1 A GLU 93 ? CG ? A GLU 13 CG 3 1 Y 1 A GLU 93 ? CD ? A GLU 13 CD 4 1 Y 1 A GLU 93 ? OE1 ? A GLU 13 OE1 5 1 Y 1 A GLU 93 ? OE2 ? A GLU 13 OE2 6 1 Y 1 A GLU 97 ? CG ? A GLU 17 CG 7 1 Y 1 A GLU 97 ? CD ? A GLU 17 CD 8 1 Y 1 A GLU 97 ? OE1 ? A GLU 17 OE1 9 1 Y 1 A GLU 97 ? OE2 ? A GLU 17 OE2 10 1 Y 1 A LYS 103 ? CG ? A LYS 23 CG 11 1 Y 1 A LYS 103 ? CD ? A LYS 23 CD 12 1 Y 1 A LYS 103 ? CE ? A LYS 23 CE 13 1 Y 1 A LYS 103 ? NZ ? A LYS 23 NZ 14 1 Y 1 A ASP 141 ? CG ? A ASP 61 CG 15 1 Y 1 A ASP 141 ? OD1 ? A ASP 61 OD1 16 1 Y 1 A ASP 141 ? OD2 ? A ASP 61 OD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.2.8 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6XX2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 35.606 _cell.length_a_esd ? _cell.length_b 35.606 _cell.length_b_esd ? _cell.length_c 81.228 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6XX2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6XX2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.15 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.69 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.150 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.9 M ammonium sulfate, 0.1 HEPES, 5 mM copper chloride, 5 mM methyl beta-cyclodextrin' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-07-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALBA BEAMLINE XALOC' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97949 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline XALOC _diffrn_source.pdbx_synchrotron_site ALBA # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6XX2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.250 _reflns.d_resolution_low 81.230 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 31902 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.200 _reflns.pdbx_Rmerge_I_obs 0.045 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.900 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.048 _reflns.pdbx_Rpim_I_all 0.016 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.250 1.270 ? ? 6905 ? ? ? 863 100.000 ? ? ? ? 0.610 ? ? ? ? ? ? ? ? 8.000 ? ? ? 3.400 0.652 0.229 ? 1 1 0.934 ? ? 6.850 81.230 ? ? 826 ? ? ? 136 97.500 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 6.100 ? ? ? 47.700 0.067 0.028 ? 2 1 0.992 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 67.700 _refine.B_iso_mean 26.4952 _refine.B_iso_min 13.810 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6XX2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.2500 _refine.ls_d_res_low 28.8300 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 31902 _refine.ls_number_reflns_R_free 1603 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9800 _refine.ls_percent_reflns_R_free 5.0200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1799 _refine.ls_R_factor_R_free 0.2067 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1785 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.040 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4JZ4 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.5500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.2500 _refine_hist.d_res_low 28.8300 _refine_hist.number_atoms_solvent 40 _refine_hist.number_atoms_total 646 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 56 _refine_hist.pdbx_B_iso_mean_ligand 32.12 _refine_hist.pdbx_B_iso_mean_solvent 34.39 _refine_hist.pdbx_number_atoms_protein 437 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 169 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.2500 1.2900 2901 . 148 2753 100.0000 . . . 0.2237 0.0000 0.2233 . . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.2900 1.3400 2908 . 147 2761 100.0000 . . . 0.2700 0.0000 0.2069 . . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.3400 1.3900 2899 . 139 2760 100.0000 . . . 0.2338 0.0000 0.1913 . . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.3900 1.4500 2885 . 149 2736 100.0000 . . . 0.2234 0.0000 0.1754 . . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.4500 1.5300 2900 . 151 2749 100.0000 . . . 0.1873 0.0000 0.1704 . . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.5300 1.6300 2917 . 152 2765 100.0000 . . . 0.2521 0.0000 0.1650 . . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.6300 1.7500 2888 . 144 2744 100.0000 . . . 0.2063 0.0000 0.1533 . . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.7500 1.9300 2907 . 145 2762 100.0000 . . . 0.1996 0.0000 0.1530 . . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.9300 2.2100 2922 . 143 2779 100.0000 . . . 0.1557 0.0000 0.1522 . . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.2100 2.7800 2885 . 157 2728 100.0000 . . . 0.2176 0.0000 0.1938 . . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.7800 28.8300 2890 . 128 2762 100.0000 . . . 0.2115 0.0000 0.1871 . . . . . . . 11 . . . # _struct.entry_id 6XX2 _struct.title ;Crystal structure of the c-Src SH3 domain H122R-Q128K mutant in complex with Cu(II) at pH 7.5 co-crystallized with methyl beta-cyclodextrin ; _struct.pdbx_model_details 'ATCUN site' _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6XX2 _struct_keywords.text 'beta barrel, SH3 domain, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SRC_CHICK _struct_ref.pdbx_db_accession P00523 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD _struct_ref.pdbx_align_begin 85 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6XX2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 61 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00523 _struct_ref_seq.db_align_beg 85 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 141 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 85 _struct_ref_seq.pdbx_auth_seq_align_end 141 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6XX2 GLY A 1 ? UNP P00523 ? ? 'expression tag' 81 1 1 6XX2 SER A 2 ? UNP P00523 ? ? 'expression tag' 82 2 1 6XX2 HIS A 3 ? UNP P00523 ? ? 'expression tag' 83 3 1 6XX2 MET A 4 ? UNP P00523 ? ? 'expression tag' 84 4 1 6XX2 ARG A 42 ? UNP P00523 HIS 122 'engineered mutation' 122 5 1 6XX2 LYS A 48 ? UNP P00523 GLN 128 'engineered mutation' 128 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 270 ? 1 MORE -11 ? 1 'SSA (A^2)' 4740 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ZB1 . O4 ? ? ? 1_555 B GLC . C1 ? ? B ZB1 1 B GLC 2 1_555 ? ? ? ? ? ? ? 1.422 sing ? covale2 covale both ? B ZB1 . C1 ? ? ? 1_555 B ZB0 . O4 ? ? B ZB1 1 B ZB0 7 1_555 ? ? ? ? ? ? ? 1.430 sing ? covale3 covale both ? B GLC . O4 ? ? ? 1_555 B GLC . C1 ? ? B GLC 2 B GLC 3 1_555 ? ? ? ? ? ? ? 1.431 sing ? covale4 covale both ? B GLC . O4 ? ? ? 1_555 B ZB2 . C1 ? ? B GLC 3 B ZB2 4 1_555 ? ? ? ? ? ? ? 1.427 sing ? covale5 covale both ? B ZB2 . O4 ? ? ? 1_555 B ZB3 . C1 ? ? B ZB2 4 B ZB3 5 1_555 ? ? ? ? ? ? ? 1.427 sing ? covale6 covale both ? B ZB3 . O4 ? ? ? 1_555 B ZB2 . C1 ? ? B ZB3 5 B ZB2 6 1_555 ? ? ? ? ? ? ? 1.426 sing ? covale7 covale both ? B ZB2 . O4 ? ? ? 1_555 B ZB0 . C1 ? ? B ZB2 6 B ZB0 7 1_555 ? ? ? ? ? ? ? 1.438 sing ? metalc1 metalc ? ? A SER 2 N ? ? ? 1_555 C CU . CU ? ? A SER 82 A CU 201 1_555 ? ? ? ? ? ? ? 2.045 ? ? metalc2 metalc ? ? A HIS 3 N ? ? ? 1_555 C CU . CU ? ? A HIS 83 A CU 201 1_555 ? ? ? ? ? ? ? 2.177 ? ? metalc3 metalc ? ? A HIS 3 ND1 ? ? ? 1_555 C CU . CU ? ? A HIS 83 A CU 201 1_555 ? ? ? ? ? ? ? 1.825 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 N ? A SER 2 ? A SER 82 ? 1_555 CU ? C CU . ? A CU 201 ? 1_555 N ? A HIS 3 ? A HIS 83 ? 1_555 78.6 ? 2 N ? A SER 2 ? A SER 82 ? 1_555 CU ? C CU . ? A CU 201 ? 1_555 ND1 ? A HIS 3 ? A HIS 83 ? 1_555 160.5 ? 3 N ? A HIS 3 ? A HIS 83 ? 1_555 CU ? C CU . ? A CU 201 ? 1_555 ND1 ? A HIS 3 ? A HIS 83 ? 1_555 90.9 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 49 ? PRO A 53 ? THR A 129 PRO A 133 AA1 2 TRP A 38 ? SER A 43 ? TRP A 118 SER A 123 AA1 3 ARG A 27 ? ILE A 30 ? ARG A 107 ILE A 110 AA1 4 THR A 5 ? ALA A 8 ? THR A 85 ALA A 88 AA1 5 VAL A 57 ? PRO A 59 ? VAL A 137 PRO A 139 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLY A 50 ? O GLY A 130 N ALA A 41 ? N ALA A 121 AA1 2 3 O ARG A 42 ? O ARG A 122 N GLN A 29 ? N GLN A 109 AA1 3 4 O LEU A 28 ? O LEU A 108 N PHE A 6 ? N PHE A 86 AA1 4 5 N VAL A 7 ? N VAL A 87 O ALA A 58 ? O ALA A 138 # _pdbx_molecule_features.prd_id PRD_900086 _pdbx_molecule_features.name methyl-beta-cyclodextrin _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class 'Drug delivery' _pdbx_molecule_features.details 'cyclic oligosaccharide' # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_900086 _pdbx_molecule.asym_id B # _pdbx_entry_details.entry_id 6XX2 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 81 ? A GLY 1 2 1 Y 1 A ASN 112 ? A ASN 32 3 1 Y 1 A ASN 113 ? A ASN 33 4 1 Y 1 A THR 114 ? A THR 34 5 1 Y 1 A GLU 115 ? A GLU 35 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CU CU CU N N 74 GLC C1 C N S 75 GLC C2 C N R 76 GLC C3 C N S 77 GLC C4 C N S 78 GLC C5 C N R 79 GLC C6 C N N 80 GLC O1 O N N 81 GLC O2 O N N 82 GLC O3 O N N 83 GLC O4 O N N 84 GLC O5 O N N 85 GLC O6 O N N 86 GLC H1 H N N 87 GLC H2 H N N 88 GLC H3 H N N 89 GLC H4 H N N 90 GLC H5 H N N 91 GLC H61 H N N 92 GLC H62 H N N 93 GLC HO1 H N N 94 GLC HO2 H N N 95 GLC HO3 H N N 96 GLC HO4 H N N 97 GLC HO6 H N N 98 GLN N N N N 99 GLN CA C N S 100 GLN C C N N 101 GLN O O N N 102 GLN CB C N N 103 GLN CG C N N 104 GLN CD C N N 105 GLN OE1 O N N 106 GLN NE2 N N N 107 GLN OXT O N N 108 GLN H H N N 109 GLN H2 H N N 110 GLN HA H N N 111 GLN HB2 H N N 112 GLN HB3 H N N 113 GLN HG2 H N N 114 GLN HG3 H N N 115 GLN HE21 H N N 116 GLN HE22 H N N 117 GLN HXT H N N 118 GLU N N N N 119 GLU CA C N S 120 GLU C C N N 121 GLU O O N N 122 GLU CB C N N 123 GLU CG C N N 124 GLU CD C N N 125 GLU OE1 O N N 126 GLU OE2 O N N 127 GLU OXT O N N 128 GLU H H N N 129 GLU H2 H N N 130 GLU HA H N N 131 GLU HB2 H N N 132 GLU HB3 H N N 133 GLU HG2 H N N 134 GLU HG3 H N N 135 GLU HE2 H N N 136 GLU HXT H N N 137 GLY N N N N 138 GLY CA C N N 139 GLY C C N N 140 GLY O O N N 141 GLY OXT O N N 142 GLY H H N N 143 GLY H2 H N N 144 GLY HA2 H N N 145 GLY HA3 H N N 146 GLY HXT H N N 147 HIS N N N N 148 HIS CA C N S 149 HIS C C N N 150 HIS O O N N 151 HIS CB C N N 152 HIS CG C Y N 153 HIS ND1 N Y N 154 HIS CD2 C Y N 155 HIS CE1 C Y N 156 HIS NE2 N Y N 157 HIS OXT O N N 158 HIS H H N N 159 HIS H2 H N N 160 HIS HA H N N 161 HIS HB2 H N N 162 HIS HB3 H N N 163 HIS HD1 H N N 164 HIS HD2 H N N 165 HIS HE1 H N N 166 HIS HE2 H N N 167 HIS HXT H N N 168 HOH O O N N 169 HOH H1 H N N 170 HOH H2 H N N 171 ILE N N N N 172 ILE CA C N S 173 ILE C C N N 174 ILE O O N N 175 ILE CB C N S 176 ILE CG1 C N N 177 ILE CG2 C N N 178 ILE CD1 C N N 179 ILE OXT O N N 180 ILE H H N N 181 ILE H2 H N N 182 ILE HA H N N 183 ILE HB H N N 184 ILE HG12 H N N 185 ILE HG13 H N N 186 ILE HG21 H N N 187 ILE HG22 H N N 188 ILE HG23 H N N 189 ILE HD11 H N N 190 ILE HD12 H N N 191 ILE HD13 H N N 192 ILE HXT H N N 193 LEU N N N N 194 LEU CA C N S 195 LEU C C N N 196 LEU O O N N 197 LEU CB C N N 198 LEU CG C N N 199 LEU CD1 C N N 200 LEU CD2 C N N 201 LEU OXT O N N 202 LEU H H N N 203 LEU H2 H N N 204 LEU HA H N N 205 LEU HB2 H N N 206 LEU HB3 H N N 207 LEU HG H N N 208 LEU HD11 H N N 209 LEU HD12 H N N 210 LEU HD13 H N N 211 LEU HD21 H N N 212 LEU HD22 H N N 213 LEU HD23 H N N 214 LEU HXT H N N 215 LYS N N N N 216 LYS CA C N S 217 LYS C C N N 218 LYS O O N N 219 LYS CB C N N 220 LYS CG C N N 221 LYS CD C N N 222 LYS CE C N N 223 LYS NZ N N N 224 LYS OXT O N N 225 LYS H H N N 226 LYS H2 H N N 227 LYS HA H N N 228 LYS HB2 H N N 229 LYS HB3 H N N 230 LYS HG2 H N N 231 LYS HG3 H N N 232 LYS HD2 H N N 233 LYS HD3 H N N 234 LYS HE2 H N N 235 LYS HE3 H N N 236 LYS HZ1 H N N 237 LYS HZ2 H N N 238 LYS HZ3 H N N 239 LYS HXT H N N 240 MET N N N N 241 MET CA C N S 242 MET C C N N 243 MET O O N N 244 MET CB C N N 245 MET CG C N N 246 MET SD S N N 247 MET CE C N N 248 MET OXT O N N 249 MET H H N N 250 MET H2 H N N 251 MET HA H N N 252 MET HB2 H N N 253 MET HB3 H N N 254 MET HG2 H N N 255 MET HG3 H N N 256 MET HE1 H N N 257 MET HE2 H N N 258 MET HE3 H N N 259 MET HXT H N N 260 PHE N N N N 261 PHE CA C N S 262 PHE C C N N 263 PHE O O N N 264 PHE CB C N N 265 PHE CG C Y N 266 PHE CD1 C Y N 267 PHE CD2 C Y N 268 PHE CE1 C Y N 269 PHE CE2 C Y N 270 PHE CZ C Y N 271 PHE OXT O N N 272 PHE H H N N 273 PHE H2 H N N 274 PHE HA H N N 275 PHE HB2 H N N 276 PHE HB3 H N N 277 PHE HD1 H N N 278 PHE HD2 H N N 279 PHE HE1 H N N 280 PHE HE2 H N N 281 PHE HZ H N N 282 PHE HXT H N N 283 PRO N N N N 284 PRO CA C N S 285 PRO C C N N 286 PRO O O N N 287 PRO CB C N N 288 PRO CG C N N 289 PRO CD C N N 290 PRO OXT O N N 291 PRO H H N N 292 PRO HA H N N 293 PRO HB2 H N N 294 PRO HB3 H N N 295 PRO HG2 H N N 296 PRO HG3 H N N 297 PRO HD2 H N N 298 PRO HD3 H N N 299 PRO HXT H N N 300 SER N N N N 301 SER CA C N S 302 SER C C N N 303 SER O O N N 304 SER CB C N N 305 SER OG O N N 306 SER OXT O N N 307 SER H H N N 308 SER H2 H N N 309 SER HA H N N 310 SER HB2 H N N 311 SER HB3 H N N 312 SER HG H N N 313 SER HXT H N N 314 THR N N N N 315 THR CA C N S 316 THR C C N N 317 THR O O N N 318 THR CB C N R 319 THR OG1 O N N 320 THR CG2 C N N 321 THR OXT O N N 322 THR H H N N 323 THR H2 H N N 324 THR HA H N N 325 THR HB H N N 326 THR HG1 H N N 327 THR HG21 H N N 328 THR HG22 H N N 329 THR HG23 H N N 330 THR HXT H N N 331 TRP N N N N 332 TRP CA C N S 333 TRP C C N N 334 TRP O O N N 335 TRP CB C N N 336 TRP CG C Y N 337 TRP CD1 C Y N 338 TRP CD2 C Y N 339 TRP NE1 N Y N 340 TRP CE2 C Y N 341 TRP CE3 C Y N 342 TRP CZ2 C Y N 343 TRP CZ3 C Y N 344 TRP CH2 C Y N 345 TRP OXT O N N 346 TRP H H N N 347 TRP H2 H N N 348 TRP HA H N N 349 TRP HB2 H N N 350 TRP HB3 H N N 351 TRP HD1 H N N 352 TRP HE1 H N N 353 TRP HE3 H N N 354 TRP HZ2 H N N 355 TRP HZ3 H N N 356 TRP HH2 H N N 357 TRP HXT H N N 358 TYR N N N N 359 TYR CA C N S 360 TYR C C N N 361 TYR O O N N 362 TYR CB C N N 363 TYR CG C Y N 364 TYR CD1 C Y N 365 TYR CD2 C Y N 366 TYR CE1 C Y N 367 TYR CE2 C Y N 368 TYR CZ C Y N 369 TYR OH O N N 370 TYR OXT O N N 371 TYR H H N N 372 TYR H2 H N N 373 TYR HA H N N 374 TYR HB2 H N N 375 TYR HB3 H N N 376 TYR HD1 H N N 377 TYR HD2 H N N 378 TYR HE1 H N N 379 TYR HE2 H N N 380 TYR HH H N N 381 TYR HXT H N N 382 VAL N N N N 383 VAL CA C N S 384 VAL C C N N 385 VAL O O N N 386 VAL CB C N N 387 VAL CG1 C N N 388 VAL CG2 C N N 389 VAL OXT O N N 390 VAL H H N N 391 VAL H2 H N N 392 VAL HA H N N 393 VAL HB H N N 394 VAL HG11 H N N 395 VAL HG12 H N N 396 VAL HG13 H N N 397 VAL HG21 H N N 398 VAL HG22 H N N 399 VAL HG23 H N N 400 VAL HXT H N N 401 ZB0 C1 C N S 402 ZB0 C2 C N R 403 ZB0 C2M C N N 404 ZB0 C3 C N S 405 ZB0 C3M C N N 406 ZB0 C4 C N R 407 ZB0 C5 C N R 408 ZB0 C6 C N N 409 ZB0 O1 O N N 410 ZB0 O2 O N N 411 ZB0 O3 O N N 412 ZB0 O4 O N N 413 ZB0 O5 O N N 414 ZB0 O6 O N N 415 ZB0 H1 H N N 416 ZB0 HO1 H N N 417 ZB0 H2 H N N 418 ZB0 H2M1 H N N 419 ZB0 H2M2 H N N 420 ZB0 H2M3 H N N 421 ZB0 H3 H N N 422 ZB0 H3M1 H N N 423 ZB0 H3M2 H N N 424 ZB0 H3M3 H N N 425 ZB0 H4 H N N 426 ZB0 HO4 H N N 427 ZB0 H5 H N N 428 ZB0 H61 H N N 429 ZB0 H62 H N N 430 ZB0 HO6 H N N 431 ZB1 C1 C N S 432 ZB1 C2 C N R 433 ZB1 C3 C N S 434 ZB1 C3M C N N 435 ZB1 C4 C N R 436 ZB1 C5 C N R 437 ZB1 C6 C N N 438 ZB1 O1 O N N 439 ZB1 O2 O N N 440 ZB1 O3 O N N 441 ZB1 O4 O N N 442 ZB1 O5 O N N 443 ZB1 O6 O N N 444 ZB1 H1 H N N 445 ZB1 HO1 H N N 446 ZB1 H2 H N N 447 ZB1 HO2 H N N 448 ZB1 H3 H N N 449 ZB1 H3M1 H N N 450 ZB1 H3M2 H N N 451 ZB1 H3M3 H N N 452 ZB1 H4 H N N 453 ZB1 HO4 H N N 454 ZB1 H5 H N N 455 ZB1 H61 H N N 456 ZB1 H62 H N N 457 ZB1 HO6 H N N 458 ZB2 C1 C N S 459 ZB2 C2 C N R 460 ZB2 C2M C N N 461 ZB2 C3 C N S 462 ZB2 C4 C N S 463 ZB2 C5 C N R 464 ZB2 C6 C N N 465 ZB2 O1 O N N 466 ZB2 O2 O N N 467 ZB2 O3 O N N 468 ZB2 O4 O N N 469 ZB2 O5 O N N 470 ZB2 O6 O N N 471 ZB2 H1 H N N 472 ZB2 HO1 H N N 473 ZB2 H2 H N N 474 ZB2 H2M1 H N N 475 ZB2 H2M2 H N N 476 ZB2 H2M3 H N N 477 ZB2 H3 H N N 478 ZB2 HO3 H N N 479 ZB2 H4 H N N 480 ZB2 HO4 H N N 481 ZB2 H5 H N N 482 ZB2 H61 H N N 483 ZB2 H62 H N N 484 ZB2 HO6 H N N 485 ZB3 C1 C N S 486 ZB3 C2 C N R 487 ZB3 C2M C N N 488 ZB3 C3 C N S 489 ZB3 C4 C N S 490 ZB3 C5 C N R 491 ZB3 C6 C N N 492 ZB3 C6M C N N 493 ZB3 O1 O N N 494 ZB3 O2 O N N 495 ZB3 O3 O N N 496 ZB3 O4 O N N 497 ZB3 O5 O N N 498 ZB3 O6 O N N 499 ZB3 H1 H N N 500 ZB3 HO1 H N N 501 ZB3 H2 H N N 502 ZB3 H2M1 H N N 503 ZB3 H2M2 H N N 504 ZB3 H2M3 H N N 505 ZB3 H3 H N N 506 ZB3 HO3 H N N 507 ZB3 H4 H N N 508 ZB3 HO4 H N N 509 ZB3 H5 H N N 510 ZB3 H61 H N N 511 ZB3 H62 H N N 512 ZB3 H6M1 H N N 513 ZB3 H6M2 H N N 514 ZB3 H6M3 H N N 515 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLC C1 C2 sing N N 70 GLC C1 O1 sing N N 71 GLC C1 O5 sing N N 72 GLC C1 H1 sing N N 73 GLC C2 C3 sing N N 74 GLC C2 O2 sing N N 75 GLC C2 H2 sing N N 76 GLC C3 C4 sing N N 77 GLC C3 O3 sing N N 78 GLC C3 H3 sing N N 79 GLC C4 C5 sing N N 80 GLC C4 O4 sing N N 81 GLC C4 H4 sing N N 82 GLC C5 C6 sing N N 83 GLC C5 O5 sing N N 84 GLC C5 H5 sing N N 85 GLC C6 O6 sing N N 86 GLC C6 H61 sing N N 87 GLC C6 H62 sing N N 88 GLC O1 HO1 sing N N 89 GLC O2 HO2 sing N N 90 GLC O3 HO3 sing N N 91 GLC O4 HO4 sing N N 92 GLC O6 HO6 sing N N 93 GLN N CA sing N N 94 GLN N H sing N N 95 GLN N H2 sing N N 96 GLN CA C sing N N 97 GLN CA CB sing N N 98 GLN CA HA sing N N 99 GLN C O doub N N 100 GLN C OXT sing N N 101 GLN CB CG sing N N 102 GLN CB HB2 sing N N 103 GLN CB HB3 sing N N 104 GLN CG CD sing N N 105 GLN CG HG2 sing N N 106 GLN CG HG3 sing N N 107 GLN CD OE1 doub N N 108 GLN CD NE2 sing N N 109 GLN NE2 HE21 sing N N 110 GLN NE2 HE22 sing N N 111 GLN OXT HXT sing N N 112 GLU N CA sing N N 113 GLU N H sing N N 114 GLU N H2 sing N N 115 GLU CA C sing N N 116 GLU CA CB sing N N 117 GLU CA HA sing N N 118 GLU C O doub N N 119 GLU C OXT sing N N 120 GLU CB CG sing N N 121 GLU CB HB2 sing N N 122 GLU CB HB3 sing N N 123 GLU CG CD sing N N 124 GLU CG HG2 sing N N 125 GLU CG HG3 sing N N 126 GLU CD OE1 doub N N 127 GLU CD OE2 sing N N 128 GLU OE2 HE2 sing N N 129 GLU OXT HXT sing N N 130 GLY N CA sing N N 131 GLY N H sing N N 132 GLY N H2 sing N N 133 GLY CA C sing N N 134 GLY CA HA2 sing N N 135 GLY CA HA3 sing N N 136 GLY C O doub N N 137 GLY C OXT sing N N 138 GLY OXT HXT sing N N 139 HIS N CA sing N N 140 HIS N H sing N N 141 HIS N H2 sing N N 142 HIS CA C sing N N 143 HIS CA CB sing N N 144 HIS CA HA sing N N 145 HIS C O doub N N 146 HIS C OXT sing N N 147 HIS CB CG sing N N 148 HIS CB HB2 sing N N 149 HIS CB HB3 sing N N 150 HIS CG ND1 sing Y N 151 HIS CG CD2 doub Y N 152 HIS ND1 CE1 doub Y N 153 HIS ND1 HD1 sing N N 154 HIS CD2 NE2 sing Y N 155 HIS CD2 HD2 sing N N 156 HIS CE1 NE2 sing Y N 157 HIS CE1 HE1 sing N N 158 HIS NE2 HE2 sing N N 159 HIS OXT HXT sing N N 160 HOH O H1 sing N N 161 HOH O H2 sing N N 162 ILE N CA sing N N 163 ILE N H sing N N 164 ILE N H2 sing N N 165 ILE CA C sing N N 166 ILE CA CB sing N N 167 ILE CA HA sing N N 168 ILE C O doub N N 169 ILE C OXT sing N N 170 ILE CB CG1 sing N N 171 ILE CB CG2 sing N N 172 ILE CB HB sing N N 173 ILE CG1 CD1 sing N N 174 ILE CG1 HG12 sing N N 175 ILE CG1 HG13 sing N N 176 ILE CG2 HG21 sing N N 177 ILE CG2 HG22 sing N N 178 ILE CG2 HG23 sing N N 179 ILE CD1 HD11 sing N N 180 ILE CD1 HD12 sing N N 181 ILE CD1 HD13 sing N N 182 ILE OXT HXT sing N N 183 LEU N CA sing N N 184 LEU N H sing N N 185 LEU N H2 sing N N 186 LEU CA C sing N N 187 LEU CA CB sing N N 188 LEU CA HA sing N N 189 LEU C O doub N N 190 LEU C OXT sing N N 191 LEU CB CG sing N N 192 LEU CB HB2 sing N N 193 LEU CB HB3 sing N N 194 LEU CG CD1 sing N N 195 LEU CG CD2 sing N N 196 LEU CG HG sing N N 197 LEU CD1 HD11 sing N N 198 LEU CD1 HD12 sing N N 199 LEU CD1 HD13 sing N N 200 LEU CD2 HD21 sing N N 201 LEU CD2 HD22 sing N N 202 LEU CD2 HD23 sing N N 203 LEU OXT HXT sing N N 204 LYS N CA sing N N 205 LYS N H sing N N 206 LYS N H2 sing N N 207 LYS CA C sing N N 208 LYS CA CB sing N N 209 LYS CA HA sing N N 210 LYS C O doub N N 211 LYS C OXT sing N N 212 LYS CB CG sing N N 213 LYS CB HB2 sing N N 214 LYS CB HB3 sing N N 215 LYS CG CD sing N N 216 LYS CG HG2 sing N N 217 LYS CG HG3 sing N N 218 LYS CD CE sing N N 219 LYS CD HD2 sing N N 220 LYS CD HD3 sing N N 221 LYS CE NZ sing N N 222 LYS CE HE2 sing N N 223 LYS CE HE3 sing N N 224 LYS NZ HZ1 sing N N 225 LYS NZ HZ2 sing N N 226 LYS NZ HZ3 sing N N 227 LYS OXT HXT sing N N 228 MET N CA sing N N 229 MET N H sing N N 230 MET N H2 sing N N 231 MET CA C sing N N 232 MET CA CB sing N N 233 MET CA HA sing N N 234 MET C O doub N N 235 MET C OXT sing N N 236 MET CB CG sing N N 237 MET CB HB2 sing N N 238 MET CB HB3 sing N N 239 MET CG SD sing N N 240 MET CG HG2 sing N N 241 MET CG HG3 sing N N 242 MET SD CE sing N N 243 MET CE HE1 sing N N 244 MET CE HE2 sing N N 245 MET CE HE3 sing N N 246 MET OXT HXT sing N N 247 PHE N CA sing N N 248 PHE N H sing N N 249 PHE N H2 sing N N 250 PHE CA C sing N N 251 PHE CA CB sing N N 252 PHE CA HA sing N N 253 PHE C O doub N N 254 PHE C OXT sing N N 255 PHE CB CG sing N N 256 PHE CB HB2 sing N N 257 PHE CB HB3 sing N N 258 PHE CG CD1 doub Y N 259 PHE CG CD2 sing Y N 260 PHE CD1 CE1 sing Y N 261 PHE CD1 HD1 sing N N 262 PHE CD2 CE2 doub Y N 263 PHE CD2 HD2 sing N N 264 PHE CE1 CZ doub Y N 265 PHE CE1 HE1 sing N N 266 PHE CE2 CZ sing Y N 267 PHE CE2 HE2 sing N N 268 PHE CZ HZ sing N N 269 PHE OXT HXT sing N N 270 PRO N CA sing N N 271 PRO N CD sing N N 272 PRO N H sing N N 273 PRO CA C sing N N 274 PRO CA CB sing N N 275 PRO CA HA sing N N 276 PRO C O doub N N 277 PRO C OXT sing N N 278 PRO CB CG sing N N 279 PRO CB HB2 sing N N 280 PRO CB HB3 sing N N 281 PRO CG CD sing N N 282 PRO CG HG2 sing N N 283 PRO CG HG3 sing N N 284 PRO CD HD2 sing N N 285 PRO CD HD3 sing N N 286 PRO OXT HXT sing N N 287 SER N CA sing N N 288 SER N H sing N N 289 SER N H2 sing N N 290 SER CA C sing N N 291 SER CA CB sing N N 292 SER CA HA sing N N 293 SER C O doub N N 294 SER C OXT sing N N 295 SER CB OG sing N N 296 SER CB HB2 sing N N 297 SER CB HB3 sing N N 298 SER OG HG sing N N 299 SER OXT HXT sing N N 300 THR N CA sing N N 301 THR N H sing N N 302 THR N H2 sing N N 303 THR CA C sing N N 304 THR CA CB sing N N 305 THR CA HA sing N N 306 THR C O doub N N 307 THR C OXT sing N N 308 THR CB OG1 sing N N 309 THR CB CG2 sing N N 310 THR CB HB sing N N 311 THR OG1 HG1 sing N N 312 THR CG2 HG21 sing N N 313 THR CG2 HG22 sing N N 314 THR CG2 HG23 sing N N 315 THR OXT HXT sing N N 316 TRP N CA sing N N 317 TRP N H sing N N 318 TRP N H2 sing N N 319 TRP CA C sing N N 320 TRP CA CB sing N N 321 TRP CA HA sing N N 322 TRP C O doub N N 323 TRP C OXT sing N N 324 TRP CB CG sing N N 325 TRP CB HB2 sing N N 326 TRP CB HB3 sing N N 327 TRP CG CD1 doub Y N 328 TRP CG CD2 sing Y N 329 TRP CD1 NE1 sing Y N 330 TRP CD1 HD1 sing N N 331 TRP CD2 CE2 doub Y N 332 TRP CD2 CE3 sing Y N 333 TRP NE1 CE2 sing Y N 334 TRP NE1 HE1 sing N N 335 TRP CE2 CZ2 sing Y N 336 TRP CE3 CZ3 doub Y N 337 TRP CE3 HE3 sing N N 338 TRP CZ2 CH2 doub Y N 339 TRP CZ2 HZ2 sing N N 340 TRP CZ3 CH2 sing Y N 341 TRP CZ3 HZ3 sing N N 342 TRP CH2 HH2 sing N N 343 TRP OXT HXT sing N N 344 TYR N CA sing N N 345 TYR N H sing N N 346 TYR N H2 sing N N 347 TYR CA C sing N N 348 TYR CA CB sing N N 349 TYR CA HA sing N N 350 TYR C O doub N N 351 TYR C OXT sing N N 352 TYR CB CG sing N N 353 TYR CB HB2 sing N N 354 TYR CB HB3 sing N N 355 TYR CG CD1 doub Y N 356 TYR CG CD2 sing Y N 357 TYR CD1 CE1 sing Y N 358 TYR CD1 HD1 sing N N 359 TYR CD2 CE2 doub Y N 360 TYR CD2 HD2 sing N N 361 TYR CE1 CZ doub Y N 362 TYR CE1 HE1 sing N N 363 TYR CE2 CZ sing Y N 364 TYR CE2 HE2 sing N N 365 TYR CZ OH sing N N 366 TYR OH HH sing N N 367 TYR OXT HXT sing N N 368 VAL N CA sing N N 369 VAL N H sing N N 370 VAL N H2 sing N N 371 VAL CA C sing N N 372 VAL CA CB sing N N 373 VAL CA HA sing N N 374 VAL C O doub N N 375 VAL C OXT sing N N 376 VAL CB CG1 sing N N 377 VAL CB CG2 sing N N 378 VAL CB HB sing N N 379 VAL CG1 HG11 sing N N 380 VAL CG1 HG12 sing N N 381 VAL CG1 HG13 sing N N 382 VAL CG2 HG21 sing N N 383 VAL CG2 HG22 sing N N 384 VAL CG2 HG23 sing N N 385 VAL OXT HXT sing N N 386 ZB0 C1 H1 sing N N 387 ZB0 C1 O1 sing N N 388 ZB0 O1 HO1 sing N N 389 ZB0 C1 O5 sing N N 390 ZB0 C1 C2 sing N N 391 ZB0 C2 H2 sing N N 392 ZB0 C2 O2 sing N N 393 ZB0 O2 C2M sing N N 394 ZB0 C2M H2M1 sing N N 395 ZB0 C2M H2M2 sing N N 396 ZB0 C2M H2M3 sing N N 397 ZB0 C2 C3 sing N N 398 ZB0 C3 H3 sing N N 399 ZB0 C3 O3 sing N N 400 ZB0 O3 C3M sing N N 401 ZB0 C3M H3M1 sing N N 402 ZB0 C3M H3M2 sing N N 403 ZB0 C3M H3M3 sing N N 404 ZB0 C3 C4 sing N N 405 ZB0 C4 H4 sing N N 406 ZB0 C4 O4 sing N N 407 ZB0 O4 HO4 sing N N 408 ZB0 C4 C5 sing N N 409 ZB0 C5 H5 sing N N 410 ZB0 C5 O5 sing N N 411 ZB0 C5 C6 sing N N 412 ZB0 C6 H61 sing N N 413 ZB0 C6 H62 sing N N 414 ZB0 C6 O6 sing N N 415 ZB0 O6 HO6 sing N N 416 ZB1 C1 H1 sing N N 417 ZB1 C1 O1 sing N N 418 ZB1 O1 HO1 sing N N 419 ZB1 C1 O5 sing N N 420 ZB1 C1 C2 sing N N 421 ZB1 C2 H2 sing N N 422 ZB1 C2 O2 sing N N 423 ZB1 O2 HO2 sing N N 424 ZB1 C2 C3 sing N N 425 ZB1 C3 H3 sing N N 426 ZB1 C3 O3 sing N N 427 ZB1 O3 C3M sing N N 428 ZB1 C3M H3M1 sing N N 429 ZB1 C3M H3M2 sing N N 430 ZB1 C3M H3M3 sing N N 431 ZB1 C3 C4 sing N N 432 ZB1 C4 H4 sing N N 433 ZB1 C4 O4 sing N N 434 ZB1 O4 HO4 sing N N 435 ZB1 C4 C5 sing N N 436 ZB1 C5 H5 sing N N 437 ZB1 C5 O5 sing N N 438 ZB1 C5 C6 sing N N 439 ZB1 C6 H61 sing N N 440 ZB1 C6 H62 sing N N 441 ZB1 C6 O6 sing N N 442 ZB1 O6 HO6 sing N N 443 ZB2 C1 H1 sing N N 444 ZB2 C1 O1 sing N N 445 ZB2 O1 HO1 sing N N 446 ZB2 C1 O5 sing N N 447 ZB2 C1 C2 sing N N 448 ZB2 C2 H2 sing N N 449 ZB2 C2 O2 sing N N 450 ZB2 O2 C2M sing N N 451 ZB2 C2M H2M1 sing N N 452 ZB2 C2M H2M2 sing N N 453 ZB2 C2M H2M3 sing N N 454 ZB2 C2 C3 sing N N 455 ZB2 C3 H3 sing N N 456 ZB2 C3 O3 sing N N 457 ZB2 O3 HO3 sing N N 458 ZB2 C3 C4 sing N N 459 ZB2 C4 H4 sing N N 460 ZB2 C4 O4 sing N N 461 ZB2 O4 HO4 sing N N 462 ZB2 C4 C5 sing N N 463 ZB2 C5 H5 sing N N 464 ZB2 C5 O5 sing N N 465 ZB2 C5 C6 sing N N 466 ZB2 C6 H61 sing N N 467 ZB2 C6 H62 sing N N 468 ZB2 C6 O6 sing N N 469 ZB2 O6 HO6 sing N N 470 ZB3 C1 H1 sing N N 471 ZB3 C1 O1 sing N N 472 ZB3 O1 HO1 sing N N 473 ZB3 C1 O5 sing N N 474 ZB3 C1 C2 sing N N 475 ZB3 C2 H2 sing N N 476 ZB3 C2 O2 sing N N 477 ZB3 O2 C2M sing N N 478 ZB3 C2M H2M1 sing N N 479 ZB3 C2M H2M2 sing N N 480 ZB3 C2M H2M3 sing N N 481 ZB3 C2 C3 sing N N 482 ZB3 C3 H3 sing N N 483 ZB3 C3 O3 sing N N 484 ZB3 O3 HO3 sing N N 485 ZB3 C3 C4 sing N N 486 ZB3 C4 H4 sing N N 487 ZB3 C4 O4 sing N N 488 ZB3 O4 HO4 sing N N 489 ZB3 C4 C5 sing N N 490 ZB3 C5 H5 sing N N 491 ZB3 C5 O5 sing N N 492 ZB3 C5 C6 sing N N 493 ZB3 C6 H61 sing N N 494 ZB3 C6 H62 sing N N 495 ZB3 C6 O6 sing N N 496 ZB3 O6 C6M sing N N 497 ZB3 C6M H6M1 sing N N 498 ZB3 C6M H6M2 sing N N 499 ZB3 C6M H6M3 sing N N 500 # _pdbx_audit_support.funding_organization 'Spanish Ministry of Science, Innovation, and Universities' _pdbx_audit_support.country Spain _pdbx_audit_support.grant_number BIO2016-78020-R _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 ZB1 1 n 2 GLC 2 n 2 GLC 3 n 2 ZB2 4 n 2 ZB3 5 n 2 ZB2 6 n 2 ZB0 7 n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 CU ? ? CU ? ? 'SUBJECT OF INVESTIGATION' ? 2 ZB0 ? ? ZB0 ? ? 'SUBJECT OF INVESTIGATION' ? 3 ZB2 ? ? ZB2 ? ? 'SUBJECT OF INVESTIGATION' ? 4 ZB3 ? ? ZB3 ? ? 'SUBJECT OF INVESTIGATION' ? 5 GLC ? ? GLC ? ? 'SUBJECT OF INVESTIGATION' ? 6 ZB1 ? ? ZB1 ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4JZ4 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6XX2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.028085 _atom_sites.fract_transf_matrix[1][2] 0.016215 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.032430 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012311 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CU H N O S # loop_