data_6Y0L # _entry.id 6Y0L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6Y0L pdb_00006y0l 10.2210/pdb6y0l/pdb WWPDB D_1200012173 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-06-16 2 'Structure model' 2 0 2021-06-23 3 'Structure model' 2 1 2021-07-07 4 'Structure model' 2 2 2021-07-14 5 'Structure model' 2 3 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Database references' 4 2 'Structure model' 'Derived calculations' 5 2 'Structure model' 'Experimental preparation' 6 2 'Structure model' 'Polymer sequence' 7 2 'Structure model' 'Source and taxonomy' 8 2 'Structure model' 'Structure summary' 9 3 'Structure model' 'Database references' 10 4 'Structure model' 'Database references' 11 5 'Structure model' 'Data collection' 12 5 'Structure model' 'Database references' 13 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' atom_site_anisotrop 3 2 'Structure model' entity 4 2 'Structure model' entity_name_com 5 2 'Structure model' entity_poly 6 2 'Structure model' entity_poly_seq 7 2 'Structure model' entity_src_gen 8 2 'Structure model' exptl_crystal 9 2 'Structure model' pdbx_poly_seq_scheme 10 2 'Structure model' pdbx_struct_sheet_hbond 11 2 'Structure model' pdbx_struct_special_symmetry 12 2 'Structure model' pdbx_unobs_or_zero_occ_atoms 13 2 'Structure model' pdbx_unobs_or_zero_occ_residues 14 2 'Structure model' struct_conf 15 2 'Structure model' struct_conn 16 2 'Structure model' struct_mon_prot_cis 17 2 'Structure model' struct_ref 18 2 'Structure model' struct_ref_seq 19 2 'Structure model' struct_ref_seq_dif 20 2 'Structure model' struct_sheet_range 21 2 'Structure model' struct_site_gen 22 3 'Structure model' citation 23 4 'Structure model' citation 24 4 'Structure model' citation_author 25 5 'Structure model' chem_comp_atom 26 5 'Structure model' chem_comp_bond 27 5 'Structure model' database_2 28 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.label_seq_id' 2 2 'Structure model' '_atom_site_anisotrop.pdbx_label_seq_id' 3 2 'Structure model' '_entity.formula_weight' 4 2 'Structure model' '_entity.pdbx_description' 5 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 6 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 7 2 'Structure model' '_entity_src_gen.pdbx_end_seq_num' 8 2 'Structure model' '_exptl_crystal.density_Matthews' 9 2 'Structure model' '_exptl_crystal.density_percent_sol' 10 2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_seq_id' 11 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_seq_id' 12 2 'Structure model' '_pdbx_struct_special_symmetry.label_seq_id' 13 2 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.label_seq_id' 14 2 'Structure model' '_struct_conf.beg_label_seq_id' 15 2 'Structure model' '_struct_conf.end_label_seq_id' 16 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 17 2 'Structure model' '_struct_conn.ptnr2_label_seq_id' 18 2 'Structure model' '_struct_mon_prot_cis.label_seq_id' 19 2 'Structure model' '_struct_mon_prot_cis.pdbx_label_seq_id_2' 20 2 'Structure model' '_struct_ref.pdbx_align_begin' 21 2 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 22 2 'Structure model' '_struct_ref_seq.db_align_beg' 23 2 'Structure model' '_struct_ref_seq.db_align_end' 24 2 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_beg' 25 2 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_end' 26 2 'Structure model' '_struct_ref_seq.seq_align_end' 27 2 'Structure model' '_struct_ref_seq_dif.seq_num' 28 2 'Structure model' '_struct_sheet_range.beg_label_seq_id' 29 2 'Structure model' '_struct_sheet_range.end_label_seq_id' 30 2 'Structure model' '_struct_site_gen.label_seq_id' 31 3 'Structure model' '_citation.title' 32 4 'Structure model' '_citation.journal_volume' 33 4 'Structure model' '_citation.page_first' 34 4 'Structure model' '_citation.page_last' 35 4 'Structure model' '_citation_author.identifier_ORCID' 36 5 'Structure model' '_database_2.pdbx_DOI' 37 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6Y0L _pdbx_database_status.recvd_initial_deposition_date 2020-02-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ilkow, V.F.' 1 0000-0003-3968-465X 'Davies, A.M.' 2 0000-0003-1498-1594 'Sutton, B.J.' 3 0000-0002-4363-7568 'McDonnell, J.M.' 4 0000-0001-9037-2980 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Febs Open Bio' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2211-5463 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 1827 _citation.page_last 1840 _citation.title 'Reviving lost binding sites: Exploring calcium-binding site transitions between human and murine CD23.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/2211-5463.13214 _citation.pdbx_database_id_PubMed 34075727 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ilkow, V.F.' 1 ? primary 'Davies, A.M.' 2 ? primary 'Dhaliwal, B.' 3 ? primary 'Beavil, A.J.' 4 ? primary 'Sutton, B.J.' 5 ? primary 'McDonnell, J.M.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Low affinity immunoglobulin epsilon Fc receptor membrane-bound form' 16075.762 1 ? 'N225D, K229E, S252N, T251N, R253G, S254G' ? 'Mutations: N225D, K229E, S252N, T251N, R253G, S254G' 2 non-polymer syn GLYCEROL 92.094 3 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 152 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRDLDLEGEFIWV DGSHVDYSNWAPGEPNNGGQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAE ; _entity_poly.pdbx_seq_one_letter_code_can ;SGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRDLDLEGEFIWV DGSHVDYSNWAPGEPNNGGQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 'SULFATE ION' SO4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 PHE n 1 4 VAL n 1 5 CYS n 1 6 ASN n 1 7 THR n 1 8 CYS n 1 9 PRO n 1 10 GLU n 1 11 LYS n 1 12 TRP n 1 13 ILE n 1 14 ASN n 1 15 PHE n 1 16 GLN n 1 17 ARG n 1 18 LYS n 1 19 CYS n 1 20 TYR n 1 21 TYR n 1 22 PHE n 1 23 GLY n 1 24 LYS n 1 25 GLY n 1 26 THR n 1 27 LYS n 1 28 GLN n 1 29 TRP n 1 30 VAL n 1 31 HIS n 1 32 ALA n 1 33 ARG n 1 34 TYR n 1 35 ALA n 1 36 CYS n 1 37 ASP n 1 38 ASP n 1 39 MET n 1 40 GLU n 1 41 GLY n 1 42 GLN n 1 43 LEU n 1 44 VAL n 1 45 SER n 1 46 ILE n 1 47 HIS n 1 48 SER n 1 49 PRO n 1 50 GLU n 1 51 GLU n 1 52 GLN n 1 53 ASP n 1 54 PHE n 1 55 LEU n 1 56 THR n 1 57 LYS n 1 58 HIS n 1 59 ALA n 1 60 SER n 1 61 HIS n 1 62 THR n 1 63 GLY n 1 64 SER n 1 65 TRP n 1 66 ILE n 1 67 GLY n 1 68 LEU n 1 69 ARG n 1 70 ASP n 1 71 LEU n 1 72 ASP n 1 73 LEU n 1 74 GLU n 1 75 GLY n 1 76 GLU n 1 77 PHE n 1 78 ILE n 1 79 TRP n 1 80 VAL n 1 81 ASP n 1 82 GLY n 1 83 SER n 1 84 HIS n 1 85 VAL n 1 86 ASP n 1 87 TYR n 1 88 SER n 1 89 ASN n 1 90 TRP n 1 91 ALA n 1 92 PRO n 1 93 GLY n 1 94 GLU n 1 95 PRO n 1 96 ASN n 1 97 ASN n 1 98 GLY n 1 99 GLY n 1 100 GLN n 1 101 GLY n 1 102 GLU n 1 103 ASP n 1 104 CYS n 1 105 VAL n 1 106 MET n 1 107 MET n 1 108 ARG n 1 109 GLY n 1 110 SER n 1 111 GLY n 1 112 ARG n 1 113 TRP n 1 114 ASN n 1 115 ASP n 1 116 ALA n 1 117 PHE n 1 118 CYS n 1 119 ASP n 1 120 ARG n 1 121 LYS n 1 122 LEU n 1 123 GLY n 1 124 ALA n 1 125 TRP n 1 126 VAL n 1 127 CYS n 1 128 ASP n 1 129 ARG n 1 130 LEU n 1 131 ALA n 1 132 THR n 1 133 CYS n 1 134 THR n 1 135 PRO n 1 136 PRO n 1 137 ALA n 1 138 SER n 1 139 GLU n 1 140 GLY n 1 141 SER n 1 142 ALA n 1 143 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 143 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FCER2, CD23A, CLEC4J, FCE2, IGEBF' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 156 ? ? ? A . n A 1 2 GLY 2 157 157 GLY GLY A . n A 1 3 PHE 3 158 158 PHE PHE A . n A 1 4 VAL 4 159 159 VAL VAL A . n A 1 5 CYS 5 160 160 CYS CYS A . n A 1 6 ASN 6 161 161 ASN ASN A . n A 1 7 THR 7 162 162 THR THR A . n A 1 8 CYS 8 163 163 CYS CYS A . n A 1 9 PRO 9 164 164 PRO PRO A . n A 1 10 GLU 10 165 165 GLU GLU A . n A 1 11 LYS 11 166 166 LYS LYS A . n A 1 12 TRP 12 167 167 TRP TRP A . n A 1 13 ILE 13 168 168 ILE ILE A . n A 1 14 ASN 14 169 169 ASN ASN A . n A 1 15 PHE 15 170 170 PHE PHE A . n A 1 16 GLN 16 171 171 GLN GLN A . n A 1 17 ARG 17 172 172 ARG ARG A . n A 1 18 LYS 18 173 173 LYS LYS A . n A 1 19 CYS 19 174 174 CYS CYS A . n A 1 20 TYR 20 175 175 TYR TYR A . n A 1 21 TYR 21 176 176 TYR TYR A . n A 1 22 PHE 22 177 177 PHE PHE A . n A 1 23 GLY 23 178 178 GLY GLY A . n A 1 24 LYS 24 179 179 LYS LYS A . n A 1 25 GLY 25 180 180 GLY GLY A . n A 1 26 THR 26 181 181 THR THR A . n A 1 27 LYS 27 182 182 LYS LYS A . n A 1 28 GLN 28 183 183 GLN GLN A . n A 1 29 TRP 29 184 184 TRP TRP A . n A 1 30 VAL 30 185 185 VAL VAL A . n A 1 31 HIS 31 186 186 HIS HIS A . n A 1 32 ALA 32 187 187 ALA ALA A . n A 1 33 ARG 33 188 188 ARG ARG A . n A 1 34 TYR 34 189 189 TYR TYR A . n A 1 35 ALA 35 190 190 ALA ALA A . n A 1 36 CYS 36 191 191 CYS CYS A . n A 1 37 ASP 37 192 192 ASP ASP A . n A 1 38 ASP 38 193 193 ASP ASP A . n A 1 39 MET 39 194 194 MET MET A . n A 1 40 GLU 40 195 195 GLU GLU A . n A 1 41 GLY 41 196 196 GLY GLY A . n A 1 42 GLN 42 197 197 GLN GLN A . n A 1 43 LEU 43 198 198 LEU LEU A . n A 1 44 VAL 44 199 199 VAL VAL A . n A 1 45 SER 45 200 200 SER SER A . n A 1 46 ILE 46 201 201 ILE ILE A . n A 1 47 HIS 47 202 202 HIS HIS A . n A 1 48 SER 48 203 203 SER SER A . n A 1 49 PRO 49 204 204 PRO PRO A . n A 1 50 GLU 50 205 205 GLU GLU A . n A 1 51 GLU 51 206 206 GLU GLU A . n A 1 52 GLN 52 207 207 GLN GLN A . n A 1 53 ASP 53 208 208 ASP ASP A . n A 1 54 PHE 54 209 209 PHE PHE A . n A 1 55 LEU 55 210 210 LEU LEU A . n A 1 56 THR 56 211 211 THR THR A . n A 1 57 LYS 57 212 212 LYS LYS A . n A 1 58 HIS 58 213 213 HIS HIS A . n A 1 59 ALA 59 214 214 ALA ALA A . n A 1 60 SER 60 215 215 SER SER A . n A 1 61 HIS 61 216 216 HIS HIS A . n A 1 62 THR 62 217 217 THR THR A . n A 1 63 GLY 63 218 218 GLY GLY A . n A 1 64 SER 64 219 219 SER SER A . n A 1 65 TRP 65 220 220 TRP TRP A . n A 1 66 ILE 66 221 221 ILE ILE A . n A 1 67 GLY 67 222 222 GLY GLY A . n A 1 68 LEU 68 223 223 LEU LEU A . n A 1 69 ARG 69 224 224 ARG ARG A . n A 1 70 ASP 70 225 225 ASP ASP A . n A 1 71 LEU 71 226 226 LEU LEU A . n A 1 72 ASP 72 227 227 ASP ASP A . n A 1 73 LEU 73 228 228 LEU LEU A . n A 1 74 GLU 74 229 229 GLU GLU A . n A 1 75 GLY 75 230 230 GLY GLY A . n A 1 76 GLU 76 231 231 GLU GLU A . n A 1 77 PHE 77 232 232 PHE PHE A . n A 1 78 ILE 78 233 233 ILE ILE A . n A 1 79 TRP 79 234 234 TRP TRP A . n A 1 80 VAL 80 235 235 VAL VAL A . n A 1 81 ASP 81 236 236 ASP ASP A . n A 1 82 GLY 82 237 237 GLY GLY A . n A 1 83 SER 83 238 238 SER SER A . n A 1 84 HIS 84 239 239 HIS HIS A . n A 1 85 VAL 85 240 240 VAL VAL A . n A 1 86 ASP 86 241 241 ASP ASP A . n A 1 87 TYR 87 242 242 TYR TYR A . n A 1 88 SER 88 243 243 SER SER A . n A 1 89 ASN 89 244 244 ASN ASN A . n A 1 90 TRP 90 245 245 TRP TRP A . n A 1 91 ALA 91 246 246 ALA ALA A . n A 1 92 PRO 92 247 247 PRO PRO A . n A 1 93 GLY 93 248 248 GLY GLY A . n A 1 94 GLU 94 249 249 GLU GLU A . n A 1 95 PRO 95 250 250 PRO PRO A . n A 1 96 ASN 96 251 251 ASN ASN A . n A 1 97 ASN 97 252 ? ? ? A . n A 1 98 GLY 98 253 ? ? ? A . n A 1 99 GLY 99 254 ? ? ? A . n A 1 100 GLN 100 255 255 GLN GLN A . n A 1 101 GLY 101 256 256 GLY GLY A . n A 1 102 GLU 102 257 257 GLU GLU A . n A 1 103 ASP 103 258 258 ASP ASP A . n A 1 104 CYS 104 259 259 CYS CYS A . n A 1 105 VAL 105 260 260 VAL VAL A . n A 1 106 MET 106 261 261 MET MET A . n A 1 107 MET 107 262 262 MET MET A . n A 1 108 ARG 108 263 263 ARG ARG A . n A 1 109 GLY 109 264 264 GLY GLY A . n A 1 110 SER 110 265 265 SER SER A . n A 1 111 GLY 111 266 266 GLY GLY A . n A 1 112 ARG 112 267 267 ARG ARG A . n A 1 113 TRP 113 268 268 TRP TRP A . n A 1 114 ASN 114 269 269 ASN ASN A . n A 1 115 ASP 115 270 270 ASP ASP A . n A 1 116 ALA 116 271 271 ALA ALA A . n A 1 117 PHE 117 272 272 PHE PHE A . n A 1 118 CYS 118 273 273 CYS CYS A . n A 1 119 ASP 119 274 274 ASP ASP A . n A 1 120 ARG 120 275 275 ARG ARG A . n A 1 121 LYS 121 276 276 LYS LYS A . n A 1 122 LEU 122 277 277 LEU LEU A . n A 1 123 GLY 123 278 278 GLY GLY A . n A 1 124 ALA 124 279 279 ALA ALA A . n A 1 125 TRP 125 280 280 TRP TRP A . n A 1 126 VAL 126 281 281 VAL VAL A . n A 1 127 CYS 127 282 282 CYS CYS A . n A 1 128 ASP 128 283 283 ASP ASP A . n A 1 129 ARG 129 284 284 ARG ARG A . n A 1 130 LEU 130 285 285 LEU LEU A . n A 1 131 ALA 131 286 286 ALA ALA A . n A 1 132 THR 132 287 287 THR THR A . n A 1 133 CYS 133 288 288 CYS CYS A . n A 1 134 THR 134 289 289 THR THR A . n A 1 135 PRO 135 290 290 PRO PRO A . n A 1 136 PRO 136 291 291 PRO PRO A . n A 1 137 ALA 137 292 292 ALA ALA A . n A 1 138 SER 138 293 ? ? ? A . n A 1 139 GLU 139 294 ? ? ? A . n A 1 140 GLY 140 295 ? ? ? A . n A 1 141 SER 141 296 ? ? ? A . n A 1 142 ALA 142 297 ? ? ? A . n A 1 143 GLU 143 298 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 401 1 GOL GOL A . C 2 GOL 1 402 2 GOL GOL A . D 2 GOL 1 403 3 GOL GOL A . E 3 SO4 1 404 4 SO4 SO4 A . F 4 HOH 1 501 137 HOH HOH A . F 4 HOH 2 502 146 HOH HOH A . F 4 HOH 3 503 89 HOH HOH A . F 4 HOH 4 504 65 HOH HOH A . F 4 HOH 5 505 58 HOH HOH A . F 4 HOH 6 506 128 HOH HOH A . F 4 HOH 7 507 136 HOH HOH A . F 4 HOH 8 508 135 HOH HOH A . F 4 HOH 9 509 149 HOH HOH A . F 4 HOH 10 510 20 HOH HOH A . F 4 HOH 11 511 85 HOH HOH A . F 4 HOH 12 512 103 HOH HOH A . F 4 HOH 13 513 27 HOH HOH A . F 4 HOH 14 514 119 HOH HOH A . F 4 HOH 15 515 99 HOH HOH A . F 4 HOH 16 516 32 HOH HOH A . F 4 HOH 17 517 105 HOH HOH A . F 4 HOH 18 518 11 HOH HOH A . F 4 HOH 19 519 140 HOH HOH A . F 4 HOH 20 520 77 HOH HOH A . F 4 HOH 21 521 115 HOH HOH A . F 4 HOH 22 522 134 HOH HOH A . F 4 HOH 23 523 24 HOH HOH A . F 4 HOH 24 524 37 HOH HOH A . F 4 HOH 25 525 40 HOH HOH A . F 4 HOH 26 526 60 HOH HOH A . F 4 HOH 27 527 151 HOH HOH A . F 4 HOH 28 528 42 HOH HOH A . F 4 HOH 29 529 138 HOH HOH A . F 4 HOH 30 530 9 HOH HOH A . F 4 HOH 31 531 49 HOH HOH A . F 4 HOH 32 532 93 HOH HOH A . F 4 HOH 33 533 38 HOH HOH A . F 4 HOH 34 534 25 HOH HOH A . F 4 HOH 35 535 51 HOH HOH A . F 4 HOH 36 536 1 HOH HOH A . F 4 HOH 37 537 36 HOH HOH A . F 4 HOH 38 538 23 HOH HOH A . F 4 HOH 39 539 44 HOH HOH A . F 4 HOH 40 540 8 HOH HOH A . F 4 HOH 41 541 96 HOH HOH A . F 4 HOH 42 542 3 HOH HOH A . F 4 HOH 43 543 6 HOH HOH A . F 4 HOH 44 544 55 HOH HOH A . F 4 HOH 45 545 70 HOH HOH A . F 4 HOH 46 546 19 HOH HOH A . F 4 HOH 47 547 30 HOH HOH A . F 4 HOH 48 548 72 HOH HOH A . F 4 HOH 49 549 152 HOH HOH A . F 4 HOH 50 550 133 HOH HOH A . F 4 HOH 51 551 84 HOH HOH A . F 4 HOH 52 552 17 HOH HOH A . F 4 HOH 53 553 31 HOH HOH A . F 4 HOH 54 554 82 HOH HOH A . F 4 HOH 55 555 97 HOH HOH A . F 4 HOH 56 556 91 HOH HOH A . F 4 HOH 57 557 46 HOH HOH A . F 4 HOH 58 558 14 HOH HOH A . F 4 HOH 59 559 26 HOH HOH A . F 4 HOH 60 560 10 HOH HOH A . F 4 HOH 61 561 54 HOH HOH A . F 4 HOH 62 562 39 HOH HOH A . F 4 HOH 63 563 4 HOH HOH A . F 4 HOH 64 564 28 HOH HOH A . F 4 HOH 65 565 2 HOH HOH A . F 4 HOH 66 566 18 HOH HOH A . F 4 HOH 67 567 13 HOH HOH A . F 4 HOH 68 568 15 HOH HOH A . F 4 HOH 69 569 12 HOH HOH A . F 4 HOH 70 570 35 HOH HOH A . F 4 HOH 71 571 21 HOH HOH A . F 4 HOH 72 572 57 HOH HOH A . F 4 HOH 73 573 147 HOH HOH A . F 4 HOH 74 574 62 HOH HOH A . F 4 HOH 75 575 34 HOH HOH A . F 4 HOH 76 576 129 HOH HOH A . F 4 HOH 77 577 66 HOH HOH A . F 4 HOH 78 578 108 HOH HOH A . F 4 HOH 79 579 113 HOH HOH A . F 4 HOH 80 580 106 HOH HOH A . F 4 HOH 81 581 150 HOH HOH A . F 4 HOH 82 582 53 HOH HOH A . F 4 HOH 83 583 117 HOH HOH A . F 4 HOH 84 584 141 HOH HOH A . F 4 HOH 85 585 52 HOH HOH A . F 4 HOH 86 586 120 HOH HOH A . F 4 HOH 87 587 148 HOH HOH A . F 4 HOH 88 588 43 HOH HOH A . F 4 HOH 89 589 47 HOH HOH A . F 4 HOH 90 590 109 HOH HOH A . F 4 HOH 91 591 121 HOH HOH A . F 4 HOH 92 592 102 HOH HOH A . F 4 HOH 93 593 144 HOH HOH A . F 4 HOH 94 594 123 HOH HOH A . F 4 HOH 95 595 131 HOH HOH A . F 4 HOH 96 596 16 HOH HOH A . F 4 HOH 97 597 71 HOH HOH A . F 4 HOH 98 598 7 HOH HOH A . F 4 HOH 99 599 98 HOH HOH A . F 4 HOH 100 600 142 HOH HOH A . F 4 HOH 101 601 61 HOH HOH A . F 4 HOH 102 602 33 HOH HOH A . F 4 HOH 103 603 116 HOH HOH A . F 4 HOH 104 604 126 HOH HOH A . F 4 HOH 105 605 78 HOH HOH A . F 4 HOH 106 606 64 HOH HOH A . F 4 HOH 107 607 111 HOH HOH A . F 4 HOH 108 608 107 HOH HOH A . F 4 HOH 109 609 145 HOH HOH A . F 4 HOH 110 610 74 HOH HOH A . F 4 HOH 111 611 112 HOH HOH A . F 4 HOH 112 612 104 HOH HOH A . F 4 HOH 113 613 100 HOH HOH A . F 4 HOH 114 614 79 HOH HOH A . F 4 HOH 115 615 83 HOH HOH A . F 4 HOH 116 616 143 HOH HOH A . F 4 HOH 117 617 69 HOH HOH A . F 4 HOH 118 618 127 HOH HOH A . F 4 HOH 119 619 124 HOH HOH A . F 4 HOH 120 620 22 HOH HOH A . F 4 HOH 121 621 90 HOH HOH A . F 4 HOH 122 622 118 HOH HOH A . F 4 HOH 123 623 59 HOH HOH A . F 4 HOH 124 624 114 HOH HOH A . F 4 HOH 125 625 5 HOH HOH A . F 4 HOH 126 626 110 HOH HOH A . F 4 HOH 127 627 101 HOH HOH A . F 4 HOH 128 628 86 HOH HOH A . F 4 HOH 129 629 88 HOH HOH A . F 4 HOH 130 630 75 HOH HOH A . F 4 HOH 131 631 94 HOH HOH A . F 4 HOH 132 632 68 HOH HOH A . F 4 HOH 133 633 80 HOH HOH A . F 4 HOH 134 634 139 HOH HOH A . F 4 HOH 135 635 81 HOH HOH A . F 4 HOH 136 636 73 HOH HOH A . F 4 HOH 137 637 76 HOH HOH A . F 4 HOH 138 638 87 HOH HOH A . F 4 HOH 139 639 95 HOH HOH A . F 4 HOH 140 640 122 HOH HOH A . F 4 HOH 141 641 50 HOH HOH A . F 4 HOH 142 642 29 HOH HOH A . F 4 HOH 143 643 92 HOH HOH A . F 4 HOH 144 644 132 HOH HOH A . F 4 HOH 145 645 125 HOH HOH A . F 4 HOH 146 646 41 HOH HOH A . F 4 HOH 147 647 56 HOH HOH A . F 4 HOH 148 648 45 HOH HOH A . F 4 HOH 149 649 67 HOH HOH A . F 4 HOH 150 650 130 HOH HOH A . F 4 HOH 151 651 48 HOH HOH A . F 4 HOH 152 652 63 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLY 157 ? N ? A GLY 2 N 2 1 Y 1 A GLY 157 ? CA ? A GLY 2 CA 3 1 Y 1 A GLY 157 ? O ? A GLY 2 O 4 1 Y 1 A GLU 165 ? OE1 ? A GLU 10 OE1 5 1 Y 1 A GLU 165 ? OE2 ? A GLU 10 OE2 6 1 Y 1 A LYS 166 ? CE ? A LYS 11 CE 7 1 Y 1 A LYS 166 ? NZ ? A LYS 11 NZ 8 1 Y 1 A ARG 172 ? CZ ? A ARG 17 CZ 9 1 Y 1 A ARG 172 ? NH1 ? A ARG 17 NH1 10 1 Y 1 A ARG 172 ? NH2 ? A ARG 17 NH2 11 1 Y 1 A LYS 179 ? CE ? A LYS 24 CE 12 1 Y 1 A LYS 179 ? NZ ? A LYS 24 NZ 13 1 Y 1 A LYS 212 ? CD ? A LYS 57 CD 14 1 Y 1 A LYS 212 ? CE ? A LYS 57 CE 15 1 Y 1 A LYS 212 ? NZ ? A LYS 57 NZ 16 1 Y 1 A GLN 255 ? CG ? A GLN 100 CG 17 1 Y 1 A GLN 255 ? CD ? A GLN 100 CD 18 1 Y 1 A GLN 255 ? OE1 ? A GLN 100 OE1 19 1 Y 1 A GLN 255 ? NE2 ? A GLN 100 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13_2998: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6Y0L _cell.details ? _cell.formula_units_Z ? _cell.length_a 113.704 _cell.length_a_esd ? _cell.length_b 113.704 _cell.length_b_esd ? _cell.length_c 45.700 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6Y0L _symmetry.cell_setting ? _symmetry.Int_Tables_number 177 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 6 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6Y0L _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.65 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.63 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.0M ammonium sulphate, 0.2M sodium chloride, 0.1M sodium-cacodylate, 8mM CaCl2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-12-05 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97945 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I02' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97945 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I02 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 19.1 _reflns.entry_id 6Y0L _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.65 _reflns.d_resolution_low 98.48 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20443 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.36 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.5 _reflns.pdbx_Rmerge_I_obs 0.094 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.028 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.65 _reflns_shell.d_res_low 1.73 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.413 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.580 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6Y0L _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.650 _refine.ls_d_res_low 56.852 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20266 _refine.ls_number_reflns_R_free 1016 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.36 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1686 _refine.ls_R_factor_R_free 0.2051 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1667 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4G9A _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.35 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.20 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1046 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.number_atoms_solvent 152 _refine_hist.number_atoms_total 1221 _refine_hist.d_res_high 1.650 _refine_hist.d_res_low 56.852 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 ? 1174 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.246 ? 1609 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 15.812 ? 690 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.072 ? 156 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 206 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.6502 1.7372 . . 148 2807 98.00 . . . 0.2911 . 0.2199 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7372 1.8461 . . 149 2839 100.00 . . . 0.2302 . 0.1820 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8461 1.9886 . . 119 2263 79.00 . . . 0.2694 . 0.1988 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9886 2.1888 . . 146 2770 96.00 . . . 0.2112 . 0.1445 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1888 2.5055 . . 142 2683 93.00 . . . 0.2024 . 0.1632 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5055 3.1566 . . 152 2880 98.00 . . . 0.2123 . 0.1704 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1566 56.8857 . . 160 3008 96.00 . . . 0.1762 . 0.1575 . . . . . . . . . . . # _struct.entry_id 6Y0L _struct.title 'Crystal structure of human CD23 lectin domain N225D, K229E, S252N, T251N, R253G, S254G mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6Y0L _struct_keywords.text 'Antibody receptor, C-type lectin, calcium binding protein, IgE, immunoglobulin E, CD23, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FCER2_HUMAN _struct_ref.pdbx_db_accession P06734 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWV DGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAE ; _struct_ref.pdbx_align_begin 156 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6Y0L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 143 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06734 _struct_ref_seq.db_align_beg 156 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 298 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 156 _struct_ref_seq.pdbx_auth_seq_align_end 298 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6Y0L ASP A 70 ? UNP P06734 ASN 225 'engineered mutation' 225 1 1 6Y0L GLU A 74 ? UNP P06734 LYS 229 'engineered mutation' 229 2 1 6Y0L ASN A 96 ? UNP P06734 THR 251 'engineered mutation' 251 3 1 6Y0L ASN A 97 ? UNP P06734 SER 252 'engineered mutation' 252 4 1 6Y0L GLY A 98 ? UNP P06734 ARG 253 'engineered mutation' 253 5 1 6Y0L GLY A 99 ? UNP P06734 SER 254 'engineered mutation' 254 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 680 ? 1 MORE -12 ? 1 'SSA (A^2)' 7550 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 28 ? MET A 39 ? GLN A 183 MET A 194 1 ? 12 HELX_P HELX_P2 AA2 SER A 48 ? ALA A 59 ? SER A 203 ALA A 214 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 133 SG ? ? A CYS 160 A CYS 288 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf2 disulf ? ? A CYS 8 SG A ? ? 1_555 A CYS 19 SG ? ? A CYS 163 A CYS 174 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf3 disulf ? ? A CYS 36 SG ? ? ? 1_555 A CYS 127 SG ? ? A CYS 191 A CYS 282 1_555 ? ? ? ? ? ? ? 2.045 ? ? disulf4 disulf ? ? A CYS 104 SG ? ? ? 1_555 A CYS 118 SG ? ? A CYS 259 A CYS 273 1_555 ? ? ? ? ? ? ? 2.035 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 94 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 249 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 95 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 250 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -4.18 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 4 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 5 ? THR A 7 ? CYS A 160 THR A 162 AA1 2 THR A 132 ? CYS A 133 ? THR A 287 CYS A 288 AA2 1 ILE A 13 ? PHE A 15 ? ILE A 168 PHE A 170 AA2 2 LYS A 18 ? LYS A 27 ? LYS A 173 LYS A 182 AA2 3 LEU A 122 ? LEU A 130 ? LEU A 277 LEU A 285 AA2 4 GLN A 42 ? LEU A 43 ? GLN A 197 LEU A 198 AA3 1 GLU A 76 ? TRP A 79 ? GLU A 231 TRP A 234 AA3 2 SER A 64 ? LEU A 71 ? SER A 219 LEU A 226 AA3 3 CYS A 104 ? MET A 107 ? CYS A 259 MET A 262 AA3 4 TRP A 113 ? ALA A 116 ? TRP A 268 ALA A 271 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 7 ? N THR A 162 O THR A 132 ? O THR A 287 AA2 1 2 N ILE A 13 ? N ILE A 168 O TYR A 20 ? O TYR A 175 AA2 2 3 N CYS A 19 ? N CYS A 174 O ARG A 129 ? O ARG A 284 AA2 3 4 O ASP A 128 ? O ASP A 283 N GLN A 42 ? N GLN A 197 AA3 1 2 O ILE A 78 ? O ILE A 233 N ARG A 69 ? N ARG A 224 AA3 2 3 N SER A 64 ? N SER A 219 O MET A 107 ? O MET A 262 AA3 3 4 N MET A 106 ? N MET A 261 O ASN A 114 ? O ASN A 269 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GOL 401 ? 4 'binding site for residue GOL A 401' AC2 Software A GOL 402 ? 4 'binding site for residue GOL A 402' AC3 Software A GOL 403 ? 7 'binding site for residue GOL A 403' AC4 Software A SO4 404 ? 3 'binding site for residue SO4 A 404' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 SER A 60 ? SER A 215 . ? 1_555 ? 2 AC1 4 HIS A 61 ? HIS A 216 . ? 1_555 ? 3 AC1 4 HOH F . ? HOH A 541 . ? 1_555 ? 4 AC1 4 HOH F . ? HOH A 549 . ? 1_555 ? 5 AC2 4 CYS A 8 ? CYS A 163 . ? 1_555 ? 6 AC2 4 ILE A 13 ? ILE A 168 . ? 1_555 ? 7 AC2 4 ASN A 14 ? ASN A 169 . ? 1_555 ? 8 AC2 4 HOH F . ? HOH A 520 . ? 1_555 ? 9 AC3 7 ARG A 69 ? ARG A 224 . ? 1_555 ? 10 AC3 7 ASP A 70 ? ASP A 225 . ? 1_555 ? 11 AC3 7 LEU A 71 ? LEU A 226 . ? 1_555 ? 12 AC3 7 ASP A 72 ? ASP A 227 . ? 12_565 ? 13 AC3 7 LEU A 73 ? LEU A 228 . ? 12_565 ? 14 AC3 7 GLU A 74 ? GLU A 229 . ? 12_565 ? 15 AC3 7 HOH F . ? HOH A 547 . ? 1_555 ? 16 AC4 3 ARG A 108 ? ARG A 263 . ? 1_555 ? 17 AC4 3 SER A 110 ? SER A 265 . ? 1_555 ? 18 AC4 3 ARG A 112 ? ARG A 267 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 509 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 593 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 228 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 228 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 228 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 129.53 _pdbx_validate_rmsd_angle.angle_target_value 115.30 _pdbx_validate_rmsd_angle.angle_deviation 14.23 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 166 ? ? 77.74 -5.86 2 1 GLN A 171 ? ? 51.01 -129.76 3 1 ASP A 241 ? ? -101.71 -65.90 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HIS 186 ? A HIS 31 2 1 A HOH 519 ? F HOH . 3 1 A HOH 524 ? F HOH . 4 1 A HOH 565 ? F HOH . 5 1 A HOH 586 ? F HOH . 6 1 A HOH 594 ? F HOH . 7 1 A HOH 620 ? F HOH . 8 1 A HOH 625 ? F HOH . 9 1 A HOH 628 ? F HOH . 10 1 A HOH 642 ? F HOH . # _pdbx_entry_details.entry_id 6Y0L _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 156 ? A SER 1 2 1 Y 1 A ASN 252 ? A ASN 97 3 1 Y 1 A GLY 253 ? A GLY 98 4 1 Y 1 A GLY 254 ? A GLY 99 5 1 Y 1 A SER 293 ? A SER 138 6 1 Y 1 A GLU 294 ? A GLU 139 7 1 Y 1 A GLY 295 ? A GLY 140 8 1 Y 1 A SER 296 ? A SER 141 9 1 Y 1 A ALA 297 ? A ALA 142 10 1 Y 1 A GLU 298 ? A GLU 143 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MET N N N N 244 MET CA C N S 245 MET C C N N 246 MET O O N N 247 MET CB C N N 248 MET CG C N N 249 MET SD S N N 250 MET CE C N N 251 MET OXT O N N 252 MET H H N N 253 MET H2 H N N 254 MET HA H N N 255 MET HB2 H N N 256 MET HB3 H N N 257 MET HG2 H N N 258 MET HG3 H N N 259 MET HE1 H N N 260 MET HE2 H N N 261 MET HE3 H N N 262 MET HXT H N N 263 PHE N N N N 264 PHE CA C N S 265 PHE C C N N 266 PHE O O N N 267 PHE CB C N N 268 PHE CG C Y N 269 PHE CD1 C Y N 270 PHE CD2 C Y N 271 PHE CE1 C Y N 272 PHE CE2 C Y N 273 PHE CZ C Y N 274 PHE OXT O N N 275 PHE H H N N 276 PHE H2 H N N 277 PHE HA H N N 278 PHE HB2 H N N 279 PHE HB3 H N N 280 PHE HD1 H N N 281 PHE HD2 H N N 282 PHE HE1 H N N 283 PHE HE2 H N N 284 PHE HZ H N N 285 PHE HXT H N N 286 PRO N N N N 287 PRO CA C N S 288 PRO C C N N 289 PRO O O N N 290 PRO CB C N N 291 PRO CG C N N 292 PRO CD C N N 293 PRO OXT O N N 294 PRO H H N N 295 PRO HA H N N 296 PRO HB2 H N N 297 PRO HB3 H N N 298 PRO HG2 H N N 299 PRO HG3 H N N 300 PRO HD2 H N N 301 PRO HD3 H N N 302 PRO HXT H N N 303 SER N N N N 304 SER CA C N S 305 SER C C N N 306 SER O O N N 307 SER CB C N N 308 SER OG O N N 309 SER OXT O N N 310 SER H H N N 311 SER H2 H N N 312 SER HA H N N 313 SER HB2 H N N 314 SER HB3 H N N 315 SER HG H N N 316 SER HXT H N N 317 SO4 S S N N 318 SO4 O1 O N N 319 SO4 O2 O N N 320 SO4 O3 O N N 321 SO4 O4 O N N 322 THR N N N N 323 THR CA C N S 324 THR C C N N 325 THR O O N N 326 THR CB C N R 327 THR OG1 O N N 328 THR CG2 C N N 329 THR OXT O N N 330 THR H H N N 331 THR H2 H N N 332 THR HA H N N 333 THR HB H N N 334 THR HG1 H N N 335 THR HG21 H N N 336 THR HG22 H N N 337 THR HG23 H N N 338 THR HXT H N N 339 TRP N N N N 340 TRP CA C N S 341 TRP C C N N 342 TRP O O N N 343 TRP CB C N N 344 TRP CG C Y N 345 TRP CD1 C Y N 346 TRP CD2 C Y N 347 TRP NE1 N Y N 348 TRP CE2 C Y N 349 TRP CE3 C Y N 350 TRP CZ2 C Y N 351 TRP CZ3 C Y N 352 TRP CH2 C Y N 353 TRP OXT O N N 354 TRP H H N N 355 TRP H2 H N N 356 TRP HA H N N 357 TRP HB2 H N N 358 TRP HB3 H N N 359 TRP HD1 H N N 360 TRP HE1 H N N 361 TRP HE3 H N N 362 TRP HZ2 H N N 363 TRP HZ3 H N N 364 TRP HH2 H N N 365 TRP HXT H N N 366 TYR N N N N 367 TYR CA C N S 368 TYR C C N N 369 TYR O O N N 370 TYR CB C N N 371 TYR CG C Y N 372 TYR CD1 C Y N 373 TYR CD2 C Y N 374 TYR CE1 C Y N 375 TYR CE2 C Y N 376 TYR CZ C Y N 377 TYR OH O N N 378 TYR OXT O N N 379 TYR H H N N 380 TYR H2 H N N 381 TYR HA H N N 382 TYR HB2 H N N 383 TYR HB3 H N N 384 TYR HD1 H N N 385 TYR HD2 H N N 386 TYR HE1 H N N 387 TYR HE2 H N N 388 TYR HH H N N 389 TYR HXT H N N 390 VAL N N N N 391 VAL CA C N S 392 VAL C C N N 393 VAL O O N N 394 VAL CB C N N 395 VAL CG1 C N N 396 VAL CG2 C N N 397 VAL OXT O N N 398 VAL H H N N 399 VAL H2 H N N 400 VAL HA H N N 401 VAL HB H N N 402 VAL HG11 H N N 403 VAL HG12 H N N 404 VAL HG13 H N N 405 VAL HG21 H N N 406 VAL HG22 H N N 407 VAL HG23 H N N 408 VAL HXT H N N 409 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 PHE N CA sing N N 250 PHE N H sing N N 251 PHE N H2 sing N N 252 PHE CA C sing N N 253 PHE CA CB sing N N 254 PHE CA HA sing N N 255 PHE C O doub N N 256 PHE C OXT sing N N 257 PHE CB CG sing N N 258 PHE CB HB2 sing N N 259 PHE CB HB3 sing N N 260 PHE CG CD1 doub Y N 261 PHE CG CD2 sing Y N 262 PHE CD1 CE1 sing Y N 263 PHE CD1 HD1 sing N N 264 PHE CD2 CE2 doub Y N 265 PHE CD2 HD2 sing N N 266 PHE CE1 CZ doub Y N 267 PHE CE1 HE1 sing N N 268 PHE CE2 CZ sing Y N 269 PHE CE2 HE2 sing N N 270 PHE CZ HZ sing N N 271 PHE OXT HXT sing N N 272 PRO N CA sing N N 273 PRO N CD sing N N 274 PRO N H sing N N 275 PRO CA C sing N N 276 PRO CA CB sing N N 277 PRO CA HA sing N N 278 PRO C O doub N N 279 PRO C OXT sing N N 280 PRO CB CG sing N N 281 PRO CB HB2 sing N N 282 PRO CB HB3 sing N N 283 PRO CG CD sing N N 284 PRO CG HG2 sing N N 285 PRO CG HG3 sing N N 286 PRO CD HD2 sing N N 287 PRO CD HD3 sing N N 288 PRO OXT HXT sing N N 289 SER N CA sing N N 290 SER N H sing N N 291 SER N H2 sing N N 292 SER CA C sing N N 293 SER CA CB sing N N 294 SER CA HA sing N N 295 SER C O doub N N 296 SER C OXT sing N N 297 SER CB OG sing N N 298 SER CB HB2 sing N N 299 SER CB HB3 sing N N 300 SER OG HG sing N N 301 SER OXT HXT sing N N 302 SO4 S O1 doub N N 303 SO4 S O2 doub N N 304 SO4 S O3 sing N N 305 SO4 S O4 sing N N 306 THR N CA sing N N 307 THR N H sing N N 308 THR N H2 sing N N 309 THR CA C sing N N 310 THR CA CB sing N N 311 THR CA HA sing N N 312 THR C O doub N N 313 THR C OXT sing N N 314 THR CB OG1 sing N N 315 THR CB CG2 sing N N 316 THR CB HB sing N N 317 THR OG1 HG1 sing N N 318 THR CG2 HG21 sing N N 319 THR CG2 HG22 sing N N 320 THR CG2 HG23 sing N N 321 THR OXT HXT sing N N 322 TRP N CA sing N N 323 TRP N H sing N N 324 TRP N H2 sing N N 325 TRP CA C sing N N 326 TRP CA CB sing N N 327 TRP CA HA sing N N 328 TRP C O doub N N 329 TRP C OXT sing N N 330 TRP CB CG sing N N 331 TRP CB HB2 sing N N 332 TRP CB HB3 sing N N 333 TRP CG CD1 doub Y N 334 TRP CG CD2 sing Y N 335 TRP CD1 NE1 sing Y N 336 TRP CD1 HD1 sing N N 337 TRP CD2 CE2 doub Y N 338 TRP CD2 CE3 sing Y N 339 TRP NE1 CE2 sing Y N 340 TRP NE1 HE1 sing N N 341 TRP CE2 CZ2 sing Y N 342 TRP CE3 CZ3 doub Y N 343 TRP CE3 HE3 sing N N 344 TRP CZ2 CH2 doub Y N 345 TRP CZ2 HZ2 sing N N 346 TRP CZ3 CH2 sing Y N 347 TRP CZ3 HZ3 sing N N 348 TRP CH2 HH2 sing N N 349 TRP OXT HXT sing N N 350 TYR N CA sing N N 351 TYR N H sing N N 352 TYR N H2 sing N N 353 TYR CA C sing N N 354 TYR CA CB sing N N 355 TYR CA HA sing N N 356 TYR C O doub N N 357 TYR C OXT sing N N 358 TYR CB CG sing N N 359 TYR CB HB2 sing N N 360 TYR CB HB3 sing N N 361 TYR CG CD1 doub Y N 362 TYR CG CD2 sing Y N 363 TYR CD1 CE1 sing Y N 364 TYR CD1 HD1 sing N N 365 TYR CD2 CE2 doub Y N 366 TYR CD2 HD2 sing N N 367 TYR CE1 CZ doub Y N 368 TYR CE1 HE1 sing N N 369 TYR CE2 CZ sing Y N 370 TYR CE2 HE2 sing N N 371 TYR CZ OH sing N N 372 TYR OH HH sing N N 373 TYR OXT HXT sing N N 374 VAL N CA sing N N 375 VAL N H sing N N 376 VAL N H2 sing N N 377 VAL CA C sing N N 378 VAL CA CB sing N N 379 VAL CA HA sing N N 380 VAL C O doub N N 381 VAL C OXT sing N N 382 VAL CB CG1 sing N N 383 VAL CB CG2 sing N N 384 VAL CB HB sing N N 385 VAL CG1 HG11 sing N N 386 VAL CG1 HG12 sing N N 387 VAL CG1 HG13 sing N N 388 VAL CG2 HG21 sing N N 389 VAL CG2 HG22 sing N N 390 VAL CG2 HG23 sing N N 391 VAL OXT HXT sing N N 392 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Medical Research Council (United Kingdom)' 'United Kingdom' G1100090 1 'Wellcome Trust' 'United Kingdom' 085944 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4G9A _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6Y0L _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008795 _atom_sites.fract_transf_matrix[1][2] 0.005078 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010155 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021882 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_