data_6YE5 # _entry.id 6YE5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6YE5 pdb_00006ye5 10.2210/pdb6ye5/pdb WWPDB D_1292107466 ? ? BMRB 27532 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 27532 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6YE5 _pdbx_database_status.recvd_initial_deposition_date 2020-03-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Blokhin, D.S.' 1 ? 'Usachev, K.S.' 2 ? 'Bikmullin, A.G.' 3 ? 'Nurullina, L.' 4 ? 'Garaeva, N.' 5 ? 'Validov, S.' 6 ? 'Klochkov, V.' 7 ? 'Aganov, A.' 8 ? 'Khusainov, I.' 9 ? 'Yusupov, M.' 10 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of ribosomal binding factor A RbfA of Staphylococcus aureus bacterium by NMR' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Blokhin, D.S.' 1 ? primary 'Usachev, K.S.' 2 ? primary 'Bikmullin, A.G.' 3 ? primary 'Nurullina, L.' 4 ? primary 'Garaeva, N.' 5 ? primary 'Validov, S.' 6 ? primary 'Klochkov, V.' 7 ? primary 'Aganov, A.' 8 ? primary 'Khusainov, I.' 9 ? primary 'Yusupov, M.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ribosome-binding factor A' _entity.formula_weight 13689.823 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSMRAERVGEQMKKELMDIINNKVKDPRVGFITITDVVLTNDLSQAKVFLTVLGNDKEVENTFKALDKAKGFIKSELGS RMRLRIMPELMYEYDQSIEYGNKIERMIQDLHKQDRVE ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSMRAERVGEQMKKELMDIINNKVKDPRVGFITITDVVLTNDLSQAKVFLTVLGNDKEVENTFKALDKAKGFIKSELGS RMRLRIMPELMYEYDQSIEYGNKIERMIQDLHKQDRVE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 MET n 1 5 ARG n 1 6 ALA n 1 7 GLU n 1 8 ARG n 1 9 VAL n 1 10 GLY n 1 11 GLU n 1 12 GLN n 1 13 MET n 1 14 LYS n 1 15 LYS n 1 16 GLU n 1 17 LEU n 1 18 MET n 1 19 ASP n 1 20 ILE n 1 21 ILE n 1 22 ASN n 1 23 ASN n 1 24 LYS n 1 25 VAL n 1 26 LYS n 1 27 ASP n 1 28 PRO n 1 29 ARG n 1 30 VAL n 1 31 GLY n 1 32 PHE n 1 33 ILE n 1 34 THR n 1 35 ILE n 1 36 THR n 1 37 ASP n 1 38 VAL n 1 39 VAL n 1 40 LEU n 1 41 THR n 1 42 ASN n 1 43 ASP n 1 44 LEU n 1 45 SER n 1 46 GLN n 1 47 ALA n 1 48 LYS n 1 49 VAL n 1 50 PHE n 1 51 LEU n 1 52 THR n 1 53 VAL n 1 54 LEU n 1 55 GLY n 1 56 ASN n 1 57 ASP n 1 58 LYS n 1 59 GLU n 1 60 VAL n 1 61 GLU n 1 62 ASN n 1 63 THR n 1 64 PHE n 1 65 LYS n 1 66 ALA n 1 67 LEU n 1 68 ASP n 1 69 LYS n 1 70 ALA n 1 71 LYS n 1 72 GLY n 1 73 PHE n 1 74 ILE n 1 75 LYS n 1 76 SER n 1 77 GLU n 1 78 LEU n 1 79 GLY n 1 80 SER n 1 81 ARG n 1 82 MET n 1 83 ARG n 1 84 LEU n 1 85 ARG n 1 86 ILE n 1 87 MET n 1 88 PRO n 1 89 GLU n 1 90 LEU n 1 91 MET n 1 92 TYR n 1 93 GLU n 1 94 TYR n 1 95 ASP n 1 96 GLN n 1 97 SER n 1 98 ILE n 1 99 GLU n 1 100 TYR n 1 101 GLY n 1 102 ASN n 1 103 LYS n 1 104 ILE n 1 105 GLU n 1 106 ARG n 1 107 MET n 1 108 ILE n 1 109 GLN n 1 110 ASP n 1 111 LEU n 1 112 HIS n 1 113 LYS n 1 114 GLN n 1 115 ASP n 1 116 ARG n 1 117 VAL n 1 118 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 118 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ;rbfA, BN1321_240118, BTN44_06340, C7P97_08595, CSC83_12510, CSC87_08335, E3A28_02265, EP54_08770, EQ90_07890, ERS072840_01353, FQP72_08125, FVP29_01140, M1K003_0111, NCTC10654_01314, NCTC5664_02210, NCTC7878_01827, NCTC7988_01282, RK64_06775 ; _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code W8UYA0_STAAU _struct_ref.pdbx_db_accession W8UYA0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SSMRAERVGEQMKKELMDIINNKVKDPRVGFITITDVVLTNDLSQAKVFLTVLGNDKEVENTFKALDKAKGFIKSELGSR MRLRIMPELMYEYDQSIEYGNKIERMIQDLHKQDR ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6YE5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 116 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession W8UYA0 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 116 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 116 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6YE5 GLY A 1 ? UNP W8UYA0 ? ? 'expression tag' 1 1 1 6YE5 VAL A 117 ? UNP W8UYA0 ? ? 'expression tag' 117 2 1 6YE5 GLU A 118 ? UNP W8UYA0 ? ? 'expression tag' 118 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 2 '3D HNHA' 1 isotropic 2 1 2 '3D HNHB' 1 isotropic 3 1 2 '3D 1H-15N TOCSY' 1 isotropic 4 1 1 '3D HNCA' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 12 1 1 '3D CBCA(CO)NH' 1 isotropic 11 1 1 '3D HNCO' 1 isotropic 10 1 1 '3D C(CO)NH' 1 isotropic 9 1 1 '3D HN(CO)CA' 1 isotropic 8 1 1 '2D 1H-13C HSQC' 1 isotropic 7 1 2 '2D 1H-15N HSQC' 1 isotropic 6 1 1 '3D 1H-15N NOESY' 1 isotropic 13 1 2 '2D 1H-1H NOESY' 1 isotropic 14 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '1.7 mM [U-99% 13C; U-99% 15N] ribosome Binding Factor A, 95% H2O/5% D2O' '95% H2O/5% D2O' 13C_15N_sample solution ? 2 '0.9 mM [U-99% 15N] ribosome Binding Factor A, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N_sample solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details 'CryoProbe 1H/31P/13C/15N' # _pdbx_nmr_refine.entry_id 6YE5 _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 6YE5 _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6YE5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' CNS ? 'Brunger A. T. et.al.' 2 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 3 'data analysis' TALOS ? 'Cornilescu, Delaglio and Bax' 4 processing TopSpin 3.5 'Bruker Biospin' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6YE5 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6YE5 _struct.title 'Structure of ribosomal binding factor A RbfA of Staphylococcus aureus bacterium by NMR' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6YE5 _struct_keywords.text ;Protein synthesis, heterologous protein expression, spatial structure of protein, Staphylococcus aureus, protein chromatography, STRUCTURAL PROTEIN ; _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 3 ? VAL A 25 ? SER A 3 VAL A 25 1 ? 23 HELX_P HELX_P2 AA2 ASN A 56 ? ALA A 70 ? ASN A 56 ALA A 70 1 ? 15 HELX_P HELX_P3 AA3 ALA A 70 ? SER A 80 ? ALA A 70 SER A 80 1 ? 11 HELX_P HELX_P4 AA4 LEU A 111 ? ASP A 115 ? LEU A 111 ASP A 115 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 33 ? LEU A 40 ? ILE A 33 LEU A 40 AA1 2 GLN A 46 ? VAL A 53 ? GLN A 46 VAL A 53 AA1 3 GLU A 89 ? TYR A 94 ? GLU A 89 TYR A 94 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 39 ? N VAL A 39 O LYS A 48 ? O LYS A 48 AA1 2 3 N ALA A 47 ? N ALA A 47 O MET A 91 ? O MET A 91 # _atom_sites.entry_id 6YE5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 MET 107 107 107 MET MET A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 GLU 118 118 118 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7680 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-03-31 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'ribosome Binding Factor A' 1.7 ? mM '[U-99% 13C; U-99% 15N]' 2 'ribosome Binding Factor A' 0.9 ? mM '[U-99% 15N]' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLU 61 ? ? H A LYS 65 ? ? 1.55 2 1 HZ2 A LYS 75 ? ? OE2 A GLU 89 ? ? 1.58 3 1 H3 A GLY 1 ? ? OE2 A GLU 7 ? ? 1.58 4 1 HZ1 A LYS 71 ? ? OD1 A ASP 110 ? ? 1.60 5 1 OE2 A GLU 16 ? ? HH21 A ARG 83 ? ? 1.60 6 2 O A GLU 61 ? ? H A LYS 65 ? ? 1.56 7 2 HZ3 A LYS 75 ? ? OE2 A GLU 89 ? ? 1.60 8 3 HZ1 A LYS 75 ? ? OD1 A ASP 110 ? ? 1.55 9 3 O A GLU 61 ? ? H A LYS 65 ? ? 1.58 10 3 O A LYS 65 ? ? H A LYS 69 ? ? 1.58 11 4 HZ2 A LYS 75 ? ? OD1 A ASP 110 ? ? 1.56 12 4 O A LYS 65 ? ? H A LYS 69 ? ? 1.59 13 5 HZ1 A LYS 24 ? ? OE1 A GLU 77 ? ? 1.57 14 6 O A GLU 61 ? ? H A LYS 65 ? ? 1.57 15 6 HZ1 A LYS 71 ? ? OD2 A ASP 115 ? ? 1.59 16 6 HH21 A ARG 106 ? ? OD2 A ASP 110 ? ? 1.60 17 7 OD2 A ASP 68 ? ? HZ2 A LYS 71 ? ? 1.54 18 7 OE1 A GLU 93 ? ? HH21 A ARG 106 ? ? 1.58 19 7 O A PHE 64 ? ? H A ASP 68 ? ? 1.59 20 8 OD2 A ASP 19 ? ? HZ3 A LYS 24 ? ? 1.53 21 8 HZ2 A LYS 48 ? ? OE2 A GLU 93 ? ? 1.56 22 8 O A GLU 61 ? ? H A LYS 65 ? ? 1.60 23 9 O A GLU 61 ? ? H A LYS 65 ? ? 1.57 24 9 O A LYS 71 ? ? H A LYS 75 ? ? 1.59 25 9 H2 A GLY 1 ? ? OE2 A GLU 7 ? ? 1.60 26 10 HZ1 A LYS 65 ? ? OD1 A ASP 68 ? ? 1.55 27 10 HZ3 A LYS 75 ? ? OD1 A ASP 110 ? ? 1.55 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A VAL 38 ? ? CG2 A VAL 38 ? ? 1.391 1.524 -0.133 0.021 N 2 3 CB A VAL 38 ? ? CG2 A VAL 38 ? ? 1.395 1.524 -0.129 0.021 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -132.26 -158.90 2 1 ASP A 27 ? ? -149.32 49.40 3 1 MET A 82 ? ? 66.79 -1.91 4 1 ARG A 83 ? ? -112.80 53.23 5 1 LEU A 84 ? ? 173.40 129.92 6 1 LEU A 111 ? ? -47.37 108.53 7 2 ASP A 27 ? ? -154.65 40.99 8 2 LEU A 84 ? ? 66.06 -178.39 9 3 ASP A 27 ? ? -164.39 82.23 10 3 LYS A 71 ? ? -42.22 -71.51 11 3 LEU A 111 ? ? -55.04 109.45 12 4 SER A 2 ? ? 68.16 169.15 13 4 ASP A 27 ? ? -165.99 92.11 14 4 LYS A 71 ? ? -38.31 -72.68 15 4 ARG A 83 ? ? -49.69 100.83 16 4 SER A 97 ? ? -90.45 -60.71 17 4 GLU A 105 ? ? -175.17 118.17 18 4 ASP A 110 ? ? 88.98 -11.84 19 4 LEU A 111 ? ? -59.67 100.48 20 4 VAL A 117 ? ? -97.58 -69.40 21 5 SER A 2 ? ? -163.80 -162.85 22 5 MET A 82 ? ? 44.16 28.52 23 5 LEU A 84 ? ? 68.33 -173.59 24 5 GLU A 105 ? ? -36.01 111.58 25 5 ARG A 106 ? ? -108.35 -81.78 26 5 ASP A 110 ? ? 88.29 -2.40 27 5 LEU A 111 ? ? -58.50 106.75 28 5 ARG A 116 ? ? -73.71 -78.41 29 5 VAL A 117 ? ? -132.78 -82.50 30 6 LYS A 71 ? ? -28.88 -64.78 31 6 ILE A 104 ? ? -54.38 -5.44 32 6 ILE A 108 ? ? -58.33 102.17 33 6 ASP A 110 ? ? 88.20 -14.50 34 7 PRO A 28 ? ? -95.60 32.02 35 7 ASN A 102 ? ? -68.79 99.55 36 7 ASP A 110 ? ? 81.43 -17.35 37 7 ASP A 115 ? ? -80.96 35.72 38 7 ARG A 116 ? ? -23.47 -55.05 39 7 VAL A 117 ? ? -127.63 -77.67 40 8 THR A 41 ? ? -153.17 77.64 41 8 ASN A 42 ? ? -104.27 -62.32 42 8 LEU A 44 ? ? 79.54 33.66 43 8 MET A 82 ? ? 60.56 79.59 44 8 ILE A 98 ? ? -104.23 -61.04 45 8 LEU A 111 ? ? -58.66 103.34 46 9 LEU A 44 ? ? 56.84 19.85 47 9 GLU A 99 ? ? -78.81 -166.89 48 9 ILE A 108 ? ? -57.56 99.88 49 9 ASP A 110 ? ? 83.05 -17.75 50 9 VAL A 117 ? ? -146.66 -42.13 51 10 PRO A 28 ? ? -76.25 24.60 52 10 LYS A 71 ? ? -29.02 -73.93 53 10 ARG A 81 ? ? -62.36 89.27 54 10 MET A 82 ? ? 49.47 27.38 55 10 LEU A 84 ? ? -108.68 -118.81 56 10 ARG A 106 ? ? -162.47 83.55 57 10 ASP A 110 ? ? 85.71 -16.27 58 10 LEU A 111 ? ? -58.36 109.46 59 10 LYS A 113 ? ? -70.64 -70.54 60 10 ASP A 115 ? ? -78.29 36.56 61 10 ARG A 116 ? ? -39.74 141.36 # _pdbx_audit_support.funding_organization 'Russian Foundation for Basic Research' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 18-34-00375 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #